Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D14311g7.127ON44344323050.0
SAKL0F05346g7.127ON44744618500.0
ADL017C7.127ON44344318290.0
Ecym_83507.127ON44544518140.0
Kwal_55.208437.127ON44144217930.0
KLTH0F12584g7.127ON44144217910.0
TBLA0A009507.127ON46946717810.0
TDEL0H028907.127ON44244317620.0
Kpol_1062.567.127ON45045017480.0
ZYRO0C05236g7.127ON44744617350.0
TPHA0C043207.127ON45445217280.0
KNAG0L009507.127ON46146017210.0
YPL259C (APM1)7.127ON47547417160.0
Suva_16.457.127ON47847717020.0
KAFR0L004707.127ON46546817000.0
Smik_6.4667.127ON47647517010.0
Skud_16.197.127ON47647516850.0
NDAI0E036807.127ON44444416790.0
NCAS0E021407.127ON48144916720.0
CAGL0K00539g7.127ON45645516140.0
Ecym_52393.165ON4644715535e-65
Kwal_33.141823.165ON4674655273e-61
KLTH0F06534g3.165ON4664725273e-61
SAKL0D13090g2.555ON4995215268e-61
SAKL0C07414g3.165ON4824855197e-60
CAGL0C05203g3.165ON4754855134e-59
KLLA0C03894g3.165ON4754805064e-58
TDEL0D045803.165ON4824935059e-58
NDAI0G029203.165ON4864274873e-55
ADR315W3.165ON4924194813e-54
Kpol_1045.443.165ON4694854793e-54
NCAS0C035803.165ON4914984752e-53
TBLA0F008403.165ON4814904742e-53
ZYRO0B04840g3.165ON4764924724e-53
Suva_15.1033.165ON4915034673e-52
YOL062C (APM4)3.165ON4915044577e-51
ABR047W2.555ON4984654534e-50
Kwal_26.81462.555ON5055314509e-50
Smik_15.963.165ON4915044454e-49
KLLA0F25432g2.555ON5075294447e-49
Skud_15.913.165ON4915064351e-47
TPHA0P006603.165ON4734194219e-46
Ecym_45912.555ON5014854001e-42
KLTH0D07502g2.555ON5045303983e-42
TDEL0B064302.555ON5255523897e-41
KNAG0K011503.165ON4744813682e-38
TPHA0I023902.555ON5595873705e-38
Kpol_1056.132.555ON5415633546e-36
ZYRO0E05874g2.555ON5493353521e-35
KAFR0A020602.555ON5404563405e-34
CAGL0K03223g2.555ON5983573372e-33
NCAS0A126502.555ON5883563256e-32
Skud_8.262.555ON5963603161e-30
KNAG0C055502.555ON5823483132e-30
Smik_8.232.555ON6033603107e-30
Suva_8.332.555ON5963633036e-29
YHL019C (APM2)2.555ON6053542992e-28
KAFR0C010203.165ON4284572908e-28
TBLA0B067602.555ON6572272416e-21
NDAI0B016102.555ON6722582114e-17
AGL061W2.522ON4111911651e-11
KLTH0D06556g2.522ON4563801588e-11
TDEL0A029702.522ON4963231526e-10
KAFR0D035602.522ON4552131481e-09
SAKL0A09218g2.522ON4732141481e-09
KLLA0E18789g2.522ON4973291472e-09
TPHA0C041302.522ON5331641472e-09
Kwal_26.79572.522ON4561291444e-09
TBLA0I006202.522ON6091461402e-08
Kpol_1018.422.522ON5752221312e-07
ZYRO0B01738g2.522ON4921711303e-07
Skud_2.4192.522ON4841451195e-06
Suva_4.5482.522ON4841321124e-05
Smik_2.4302.522ON4841281081e-04
YBR288C (APM3)2.522ON4831401071e-04
CAGL0L02145g2.522ON5431361062e-04
NDAI0K019302.522ON612152970.003
NCAS0A048702.522ON489326940.005
KNAG0A069702.522ON50558880.030
Ecym_72662.522ON517129880.036
Ecym_60073.575ON53770860.056
TDEL0D064303.575ON53685820.15
KAFR0C049007.8ON536199790.42
KLLA0D11396g3.575ON53670760.91
KAFR0J001303.575ON54370751.1
ZYRO0E09746g3.575ON538134731.9
SAKL0F00594g3.575ON54570713.3
KLTH0G00528g3.575ON63370713.4
Kpol_507.73.575ON53374695.6
TPHA0G037003.575ON53978688.6
Kwal_47.192923.575ON53870679.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D14311g
         (443 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} simi...   892   0.0  
SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly...   717   0.0  
ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON} S...   709   0.0  
Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar t...   703   0.0  
Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {...   695   0.0  
KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]...   694   0.0  
TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {O...   690   0.0  
TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {O...   683   0.0  
Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON} (1265...   677   0.0  
ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {...   672   0.0  
TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.1...   670   0.0  
KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {...   667   0.0  
YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}  A...   665   0.0  
Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}...   660   0.0  
KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON...   659   0.0  
Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C ...   659   0.0  
Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}...   653   0.0  
NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {O...   651   0.0  
NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {O...   648   0.0  
CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {O...   626   0.0  
Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}...   217   5e-65
Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {...   207   3e-61
KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {...   207   3e-61
SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weak...   207   8e-61
SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {...   204   7e-60
CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly...   202   4e-59
KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {...   199   4e-58
TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.1...   199   9e-58
NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {O...   192   3e-55
ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic ...   189   3e-54
Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa] ...   189   3e-54
NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {O...   187   2e-53
TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.1...   187   2e-53
ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly...   186   4e-53
Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {...   184   3e-52
YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON} ...   180   7e-51
ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic ho...   179   4e-50
Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C...   177   9e-50
Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {O...   176   4e-49
KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]...   175   7e-49
Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {O...   172   1e-47
TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3....   166   9e-46
Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {O...   158   1e-42
KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} simila...   157   3e-42
TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON} Anc_2...   154   7e-41
KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {...   146   2e-38
TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.5...   147   5e-38
Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {O...   140   6e-36
ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} simila...   140   1e-35
KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.5...   135   5e-34
CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} simil...   134   2e-33
NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON} Anc_2...   129   6e-32
Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON} Y...   126   1e-30
KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa] ...   125   2e-30
Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON} Y...   124   7e-30
Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON} Y...   121   6e-29
YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}  AP...   119   2e-28
KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.1...   116   8e-28
TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON} Anc_2...    97   6e-21
NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {O...    86   4e-17
AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic ho...    68   1e-11
KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {...    65   8e-11
TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {O...    63   6e-10
KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {O...    62   1e-09
SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [142...    62   1e-09
KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} simi...    61   2e-09
TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {O...    61   2e-09
Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {O...    60   4e-09
TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {O...    59   2e-08
Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON} (1371...    55   2e-07
ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {...    55   3e-07
Skud_2.419 Chr2 complement(746943..748397) [1455 bp, 484 aa] {ON...    50   5e-06
Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON...    48   4e-05
Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON...    46   1e-04
YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}  ...    46   1e-04
CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} simil...    45   2e-04
NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2....    42   0.003
NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.5...    41   0.005
KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa] ...    39   0.030
Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]...    39   0.036
Ecym_6007 Chr6 (17110..18723) [1614 bp, 537 aa] {ON} similar to ...    38   0.056
TDEL0D06430 Chr4 complement(1151544..1153154) [1611 bp, 536 aa] ...    36   0.15 
KAFR0C04900 Chr3 (973774..975384) [1611 bp, 536 aa] {ON} Anc_7.8...    35   0.42 
KLLA0D11396g Chr4 complement(976408..978018) [1611 bp, 536 aa] {...    34   0.91 
KAFR0J00130 Chr10 (23191..24822) [1632 bp, 543 aa] {ON} Anc_3.57...    33   1.1  
ZYRO0E09746g Chr5 complement(772264..773880) [1617 bp, 538 aa] {...    33   1.9  
SAKL0F00594g Chr6 (54485..56122) [1638 bp, 545 aa] {ON} similar ...    32   3.3  
KLTH0G00528g Chr7 (36584..38485) [1902 bp, 633 aa] {ON} similar ...    32   3.4  
Kpol_507.7 s507 (49309..50910) [1602 bp, 533 aa] {ON} (49309..50...    31   5.6  
TPHA0G03700 Chr7 complement(783421..785040) [1620 bp, 539 aa] {O...    31   8.6  
Kwal_47.19292 s47 complement(1174899..1176515) [1617 bp, 538 aa]...    30   9.2  

>KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} similar
           to uniprot|Q00776 Saccharomyces cerevisiae YPL259C APM1
           medium subunit of the clathrin-associated protein
           complex
          Length = 443

 Score =  892 bits (2305), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/443 (97%), Positives = 431/443 (97%)

Query: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60
           MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV
Sbjct: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60

Query: 61  QYNDVYVLALTRSVSVNATTMFAFMYKLINXXXXXXXXXXXXSIRDNYIIIYELLDEMMD 120
           QYNDVYVLALTRSVSVNATTMFAFMYKLIN            SIRDNYIIIYELLDEMMD
Sbjct: 61  QYNDVYVLALTRSVSVNATTMFAFMYKLINVVEEYVKRVEEESIRDNYIIIYELLDEMMD 120

Query: 121 KGVPQVTETKMLKQYITQKSFKLTRSAKKQKNVARPPTELTNSVSWRPEGIKYKKNEAFL 180
           KGVPQVTETKMLKQYITQKSFKLTRSAKKQKNVARPPTELTNSVSWRPEGIKYKKNEAFL
Sbjct: 121 KGVPQVTETKMLKQYITQKSFKLTRSAKKQKNVARPPTELTNSVSWRPEGIKYKKNEAFL 180

Query: 181 DVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLKLGLNDKGIFTTNDQEDSPEPVV 240
           DVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLKLGLNDKGIFTTNDQEDSPEPVV
Sbjct: 181 DVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLKLGLNDKGIFTTNDQEDSPEPVV 240

Query: 241 SSKKKNSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMTYRLSTPIKPLIWCDVK 300
           SSKKKNSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMTYRLSTPIKPLIWCDVK
Sbjct: 241 SSKKKNSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMTYRLSTPIKPLIWCDVK 300

Query: 301 VQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIPEDADSPTFKYSRGNIKWVPEKNAIL 360
           VQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIPEDADSPTFKYSRGNIKWVPEKNAIL
Sbjct: 301 VQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIPEDADSPTFKYSRGNIKWVPEKNAIL 360

Query: 361 WKFSSFQGGKEYSMAAQLGLPSVSDAEPPKLKRPVQIKFQIPYFTTSGIQVRYLKIEEPK 420
           WKFSSFQGGKEYSMAAQLGLPSVSDAEPPKLKRPVQIKFQIPYFTTSGIQVRYLKIEEPK
Sbjct: 361 WKFSSFQGGKEYSMAAQLGLPSVSDAEPPKLKRPVQIKFQIPYFTTSGIQVRYLKIEEPK 420

Query: 421 LQYNSYPWVRYITQSGDDYTIRL 443
           LQYNSYPWVRYITQSGDDYTIRL
Sbjct: 421 LQYNSYPWVRYITQSGDDYTIRL 443

>SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly
           similar to uniprot|Q00776 Saccharomyces cerevisiae
           YPL259C APM1 medium subunit of the clathrin- associated
           protein complex
          Length = 447

 Score =  717 bits (1850), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/446 (75%), Positives = 383/446 (85%), Gaps = 3/446 (0%)

Query: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60
           MAS + FCDSKGK +LSRRY+DD+  +A++ F  LL+EREQESSV+PPC  HNGI Y++V
Sbjct: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60

Query: 61  QYNDVYVLALTRSVSVNATTMFAFMYKLINXXXXXXXXXXXXSIRDNYIIIYELLDEMMD 120
           Q+ND+YVL +TRS+S N   +FAF+YK++             SIRDN++IIYELLDEMMD
Sbjct: 61  QHNDLYVLTMTRSLSTNVAQLFAFLYKVVEVLTEYVKVVEEESIRDNFVIIYELLDEMMD 120

Query: 121 KGVPQVTETKMLKQYITQKSFKLTRSAKKQKNVARPPTELTNSVSWRPEGIKYKKNEAFL 180
            G+PQ+TETKMLKQYITQKSFKL +SAKK KNV RPP  LTNSVSWRPEGI YKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLMKSAKKSKNVIRPPIALTNSVSWRPEGIMYKKNEAFL 180

Query: 181 DVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLKLGLNDKGIFT---TNDQEDSPE 237
           DV+ESINML+TQQGQVLRSEILG VKV+S LSGMPDLKLGLNDKGIF+   +   ED  +
Sbjct: 181 DVVESINMLITQQGQVLRSEILGKVKVKSHLSGMPDLKLGLNDKGIFSNHVSGGVEDEAD 240

Query: 238 PVVSSKKKNSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMTYRLSTPIKPLIWC 297
            + ++ KK +NIELEDLKFHQCVRLSKFENEKIITFIPPDG+F+LM+YRL+TPIKPLIWC
Sbjct: 241 DLSATGKKKANIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLTTPIKPLIWC 300

Query: 298 DVKVQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIPEDADSPTFKYSRGNIKWVPEKN 357
           D+K+QVHS SRIE+HCRAKAQIKKKS ANNVEILIP+PEDADSP F+YS G+IKW PEKN
Sbjct: 301 DIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSIKWAPEKN 360

Query: 358 AILWKFSSFQGGKEYSMAAQLGLPSVSDAEPPKLKRPVQIKFQIPYFTTSGIQVRYLKIE 417
           AILWK  SF GGKEYSMAAQLGLPSVSD E P +KRPVQ+KFQIPYFTTSGIQVRYLKI 
Sbjct: 361 AILWKIKSFPGGKEYSMAAQLGLPSVSDFEEPVMKRPVQVKFQIPYFTTSGIQVRYLKIN 420

Query: 418 EPKLQYNSYPWVRYITQSGDDYTIRL 443
           EPK+QY SYPWVRYITQSGDDYTIR+
Sbjct: 421 EPKMQYQSYPWVRYITQSGDDYTIRM 446

>ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL259C
           (APM1)
          Length = 443

 Score =  709 bits (1829), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/443 (75%), Positives = 381/443 (86%)

Query: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60
           M S + FCDSKGK LLSRRY+DD+  +A+E F HLL+E+EQESSV+PPCF  NG+ Y+++
Sbjct: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60

Query: 61  QYNDVYVLALTRSVSVNATTMFAFMYKLINXXXXXXXXXXXXSIRDNYIIIYELLDEMMD 120
           Q+ND+YVL LT+S+S+N   +F++++KLI             SI+DN++IIYELLDEMMD
Sbjct: 61  QHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMD 120

Query: 121 KGVPQVTETKMLKQYITQKSFKLTRSAKKQKNVARPPTELTNSVSWRPEGIKYKKNEAFL 180
            G+PQ+T+TKML+QYITQKSFKL RSAKK+KNV RPP  LTNSVSWRPEGI YKKNEAFL
Sbjct: 121 HGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPATLTNSVSWRPEGIVYKKNEAFL 180

Query: 181 DVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLKLGLNDKGIFTTNDQEDSPEPVV 240
           DV+ESINML+TQQGQVLRSEILG VKV+SRLSGMPDLKLGLNDKGIF   D +D  E   
Sbjct: 181 DVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMPDLKLGLNDKGIFAQGDDDDDEEGAS 240

Query: 241 SSKKKNSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMTYRLSTPIKPLIWCDVK 300
              KK SNIELEDLKFHQCVRL+KFENEKIITFIPPDG+F+LM+YRLSTPIKPLIWCDVK
Sbjct: 241 GGTKKKSNIELEDLKFHQCVRLTKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCDVK 300

Query: 301 VQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIPEDADSPTFKYSRGNIKWVPEKNAIL 360
           +QVHS SRIEIHCRAKAQIKKKS ANNVEILIP+PEDADSP F+YS G IKWVP +NAIL
Sbjct: 301 LQVHSRSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGTIKWVPSQNAIL 360

Query: 361 WKFSSFQGGKEYSMAAQLGLPSVSDAEPPKLKRPVQIKFQIPYFTTSGIQVRYLKIEEPK 420
           WK  SF GGK+YSMAA++GLPSVSD    KLKRPVQIKFQIPYFTTSGIQVRYLKI EPK
Sbjct: 361 WKIKSFPGGKDYSMAAEMGLPSVSDNSDHKLKRPVQIKFQIPYFTTSGIQVRYLKINEPK 420

Query: 421 LQYNSYPWVRYITQSGDDYTIRL 443
           +QYNSYPWVRYITQSGDDYTIR+
Sbjct: 421 MQYNSYPWVRYITQSGDDYTIRM 443

>Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii ADL017C
          Length = 445

 Score =  703 bits (1814), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/445 (73%), Positives = 383/445 (86%), Gaps = 2/445 (0%)

Query: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60
           M+S + FCD+KGK LLSRRY+DD+  SA+E F +LL+E+EQES+V+PPCF HNG+ Y+++
Sbjct: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60

Query: 61  QYNDVYVLALTRSVSVNATTMFAFMYKLINXXXXXXXXXXXXSIRDNYIIIYELLDEMMD 120
           Q+ND+Y+L LTRS+  N   +F+F++ L++            SI+DN++IIYELLDE+MD
Sbjct: 61  QHNDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMD 120

Query: 121 KGVPQVTETKMLKQYITQKSFKLTRSAKKQKNVARPPTELTNSVSWRPEGIKYKKNEAFL 180
            G+PQ+T+TKML+QYITQKSFKL RSAKK+KNV RPP+ LT +VSWRPEGIKYKKNEAFL
Sbjct: 121 SGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPSSLTTAVSWRPEGIKYKKNEAFL 180

Query: 181 DVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLKLGLNDKGIFTTNDQEDSPEPVV 240
           DVIESINM+MTQQGQVLRSEILG VKVRSRLSGMPDLKLGLNDKGIFT +++E+  EP  
Sbjct: 181 DVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTQSNEEEEDEPSS 240

Query: 241 --SSKKKNSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMTYRLSTPIKPLIWCD 298
             S  +K SNIELEDLKFHQCVRLSKFENEKIITFIPPDG+F+LM+YRLSTPIKPLIWCD
Sbjct: 241 QPSITRKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCD 300

Query: 299 VKVQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIPEDADSPTFKYSRGNIKWVPEKNA 358
            K+QVHS SR+E+HCRAKAQIK KS ANNVEILIP+P DADSP F+YS G+IKWVPEKNA
Sbjct: 301 AKIQVHSRSRVEVHCRAKAQIKAKSTANNVEILIPVPNDADSPKFRYSHGSIKWVPEKNA 360

Query: 359 ILWKFSSFQGGKEYSMAAQLGLPSVSDAEPPKLKRPVQIKFQIPYFTTSGIQVRYLKIEE 418
           ILWK  SF GGK+YSMAA++GLPSV+D      KRPVQIKFQIPYFTTSGIQVRYLKI E
Sbjct: 361 ILWKIKSFPGGKDYSMAAEMGLPSVNDIADYNFKRPVQIKFQIPYFTTSGIQVRYLKINE 420

Query: 419 PKLQYNSYPWVRYITQSGDDYTIRL 443
           PKLQYNSYPWVRYITQSG+DY IR+
Sbjct: 421 PKLQYNSYPWVRYITQSGEDYIIRM 445

>Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {ON}
           YPL259C (APM1) - medium subunit of the
           clathrin-associated protein complex [contig 138] FULL
          Length = 441

 Score =  695 bits (1793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/442 (73%), Positives = 373/442 (84%), Gaps = 3/442 (0%)

Query: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60
           MAS + FCD+ GK +LSRRY+DDV  SA+E F  LLLE EQESSV+PPC  HNG+ YM++
Sbjct: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60

Query: 61  QYNDVYVLALTRSVSVNATTMFAFMYKLINXXXXXXXXXXXXSIRDNYIIIYELLDEMMD 120
           Q+ND+YVL ++RS+S+N   +F+F+YKL+             SIRDN++IIYELLDEM+D
Sbjct: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLD 120

Query: 121 KGVPQVTETKMLKQYITQKSFKLTRSAKKQKNVARPPTELTNSVSWRPEGIKYKKNEAFL 180
            G+PQ+TETKMLKQYITQKS+KL +S KK KNV RPP +LT SVSWRPEGI YKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSYKLIKSVKKSKNVVRPPAQLTKSVSWRPEGITYKKNEAFL 180

Query: 181 DVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLKLGLNDKGIFTTNDQEDSPEPVV 240
           DV ESINML+T  GQVLRSEILG VKVRSRLSGMPDLKLGLNDKGIFT+ +  ++ E   
Sbjct: 181 DVTESINMLITASGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTSEEGGNNAE--- 237

Query: 241 SSKKKNSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMTYRLSTPIKPLIWCDVK 300
               K SNIELEDL+FHQCVRLSKFENEKII+FIPPDG+FDLM YRLSTPIKPLIWCD K
Sbjct: 238 GGSGKKSNIELEDLQFHQCVRLSKFENEKIISFIPPDGDFDLMNYRLSTPIKPLIWCDAK 297

Query: 301 VQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIPEDADSPTFKYSRGNIKWVPEKNAIL 360
           +QVHS SRIEIHCRAKAQIKKKS ANNVEILIP+PEDADSP F+YS G++K+VPEK+AIL
Sbjct: 298 IQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSAIL 357

Query: 361 WKFSSFQGGKEYSMAAQLGLPSVSDAEPPKLKRPVQIKFQIPYFTTSGIQVRYLKIEEPK 420
           W+  +F GGKEYS AAQLGLPS++D E PK KRP+Q+KFQIPYFTTSGIQVRYLK+ EPK
Sbjct: 358 WRIKTFNGGKEYSFAAQLGLPSMTDVEVPKAKRPIQVKFQIPYFTTSGIQVRYLKVHEPK 417

Query: 421 LQYNSYPWVRYITQSGDDYTIR 442
           LQY SYPWVRYITQSGDDYTIR
Sbjct: 418 LQYQSYPWVRYITQSGDDYTIR 439

>KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]
           {ON} highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 441

 Score =  694 bits (1791), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/442 (73%), Positives = 377/442 (85%), Gaps = 3/442 (0%)

Query: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60
           MAS + FCD+KGK +LSRRY+DDV  SA+E F  LLLE EQESS++PPC  HNG+ Y+++
Sbjct: 1   MASCIYFCDNKGKVILSRRYRDDVPPSAIEKFPSLLLEAEQESSIVPPCLTHNGVQYLFI 60

Query: 61  QYNDVYVLALTRSVSVNATTMFAFMYKLINXXXXXXXXXXXXSIRDNYIIIYELLDEMMD 120
           Q+ND+YVL ++RS+S+N   +F+F+YKL+             SIRDN++IIYELLDEM+D
Sbjct: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYVKTVEEESIRDNFVIIYELLDEMLD 120

Query: 121 KGVPQVTETKMLKQYITQKSFKLTRSAKKQKNVARPPTELTNSVSWRPEGIKYKKNEAFL 180
            G+PQ+TETKMLKQYITQKS+KL +SAKK KNV RPP++LT SVSWRPEGI YKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSYKLIKSAKKSKNVIRPPSQLTKSVSWRPEGITYKKNEAFL 180

Query: 181 DVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLKLGLNDKGIFTTNDQEDSPEPVV 240
           DV ESINML+T  GQVLRSEILG V VRSRLSGMPDLKLGLNDKGIFT+ +   S     
Sbjct: 181 DVTESINMLITASGQVLRSEILGKVNVRSRLSGMPDLKLGLNDKGIFTSVESASS---SE 237

Query: 241 SSKKKNSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMTYRLSTPIKPLIWCDVK 300
           +++ K SNIELEDLKFHQCVRLSKFENEKIITFIPPDG+F+LM YRLSTPIKPLIWCD K
Sbjct: 238 ATEGKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMNYRLSTPIKPLIWCDAK 297

Query: 301 VQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIPEDADSPTFKYSRGNIKWVPEKNAIL 360
           +QVHS SRIEIHCRAKAQIKKKS ANNVEILIP+PEDADSP F+YS G++K+VPEK+AIL
Sbjct: 298 IQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSAIL 357

Query: 361 WKFSSFQGGKEYSMAAQLGLPSVSDAEPPKLKRPVQIKFQIPYFTTSGIQVRYLKIEEPK 420
           WK  +F GGKEYS AAQLGLPS++DAE P+ KRP+Q+KFQIPYFTTSGIQVRYLKI EPK
Sbjct: 358 WKIKTFNGGKEYSFAAQLGLPSMTDAEVPRAKRPIQVKFQIPYFTTSGIQVRYLKINEPK 417

Query: 421 LQYNSYPWVRYITQSGDDYTIR 442
           LQY SYPWVRYITQSGDDYTIR
Sbjct: 418 LQYQSYPWVRYITQSGDDYTIR 439

>TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {ON}
           Anc_7.127 YPL259C
          Length = 469

 Score =  690 bits (1781), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/467 (70%), Positives = 388/467 (83%), Gaps = 24/467 (5%)

Query: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60
           M S ++FCDSKGK LLSR+Y+DD+  +A+++F  LL++ E+ESSV+PPC  HNGIHY+++
Sbjct: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60

Query: 61  QYNDVYVLALTRSVSVNATTMFAFMYKLINXXXXXXXXXXXXSIRDNYIIIYELLDEMMD 120
           Q+ND+Y++ALT S+S NA+ +F F++KL+             SIRDN++IIYELLDEMMD
Sbjct: 61  QHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMMD 120

Query: 121 KGVPQVTETKMLKQYITQKSFKLTRSAKKQKNVARPPTELTNSVSWRPEGIKYKKNEAFL 180
            G+PQ+TETKMLKQYITQKSFKL ++AKK++N ARPP  LTNSVSWRPEGIKYKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKAAKKKRNAARPPQALTNSVSWRPEGIKYKKNEAFL 180

Query: 181 DVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLKLGLNDKGIFT------------ 228
           D++ESINMLMTQQGQVLRSEI+G VKVRSRLSGMPDLKLG+NDKGIF+            
Sbjct: 181 DIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMPDLKLGINDKGIFSKYLESTSSNSNS 240

Query: 229 --------TNDQEDSPEPVVS----SKKKNSNIELEDLKFHQCVRLSKFENEKIITFIPP 276
                    + +  +P+P       S +K SN+ELEDLKFHQCVRLSKFENEKIITFIPP
Sbjct: 241 NDDNSNEVNSSKSSTPQPSTGQDEGSSRKTSNVELEDLKFHQCVRLSKFENEKIITFIPP 300

Query: 277 DGEFDLMTYRLSTPIKPLIWCDVKVQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIPE 336
           DG F+LM+YRL+TPIKPLIWCDV + VHS SR+EIHCRAKAQIKKKS+ANNVEILIP+P+
Sbjct: 301 DGNFELMSYRLTTPIKPLIWCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPD 360

Query: 337 DADSPTFKYSRGNIKWVPEKNAILWKFSSFQGGKEYSMAAQLGLPSVSDAEPPKLKRPVQ 396
           DAD+P+F+YS G+IKWVPEKNAILWK  SF GGKEYSMAAQLGLPS+ D E PKLKRPVQ
Sbjct: 361 DADTPSFRYSHGSIKWVPEKNAILWKIRSFAGGKEYSMAAQLGLPSIDDNEKPKLKRPVQ 420

Query: 397 IKFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWVRYITQSGDDYTIRL 443
           IKFQIPYFTTSGIQVRYLK+ EPKLQY SYPWVRYITQSGDDYTIRL
Sbjct: 421 IKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGDDYTIRL 467

>TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {ON}
           Anc_7.127 YPL259C
          Length = 442

 Score =  683 bits (1762), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/443 (71%), Positives = 376/443 (84%), Gaps = 2/443 (0%)

Query: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60
           M S + FCD KG+P+LSRRY+DD+  SA++ F  LL + E+ESSV+PPC +H GI Y+++
Sbjct: 1   MVSGIYFCDIKGRPILSRRYRDDIPLSAIDRFAPLLADLEEESSVIPPCLNHRGIQYLFI 60

Query: 61  QYNDVYVLALTRSVSVNATTMFAFMYKLINXXXXXXXXXXXXSIRDNYIIIYELLDEMMD 120
           ++ D+YV+AL+ S++ NA  +F F++KL+             S+RDN++IIYELLDEMMD
Sbjct: 61  EHEDLYVVALSTSLATNAAQVFTFLHKLVEALGDYLKTVEEESVRDNFVIIYELLDEMMD 120

Query: 121 KGVPQVTETKMLKQYITQKSFKLTRSAKKQKNVARPPTELTNSVSWRPEGIKYKKNEAFL 180
            G+PQ+TETKMLKQYITQKSFKL ++ KK K  ARPPT LTNSVSWR +GI YKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLIKAVKKVKATARPPTGLTNSVSWRADGITYKKNEAFL 180

Query: 181 DVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLKLGLNDKGIFTTNDQEDSPEPVV 240
           D++ESINM+M QQGQVLRSEI+G V VRSRLSGMPDLKLG+NDKGIFT +   ++ E  V
Sbjct: 181 DIVESINMVMNQQGQVLRSEIIGQVIVRSRLSGMPDLKLGINDKGIFTRD--PETGESQV 238

Query: 241 SSKKKNSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMTYRLSTPIKPLIWCDVK 300
           ++ KK S+ ELEDLKFHQCVRLSKFENEKIITFIPPDGEF+LM+YRL+TP+KPLIWCDV 
Sbjct: 239 TAGKKKSSAELEDLKFHQCVRLSKFENEKIITFIPPDGEFELMSYRLTTPVKPLIWCDVN 298

Query: 301 VQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIPEDADSPTFKYSRGNIKWVPEKNAIL 360
           VQVHS SRIEIHCRAKAQIKKKSVANNVEILIP+P+DAD+P+F+YS G+IKWVPEKNAIL
Sbjct: 299 VQVHSKSRIEIHCRAKAQIKKKSVANNVEILIPVPDDADTPSFRYSHGSIKWVPEKNAIL 358

Query: 361 WKFSSFQGGKEYSMAAQLGLPSVSDAEPPKLKRPVQIKFQIPYFTTSGIQVRYLKIEEPK 420
           WK  SF GGKEYSMAAQ+GLPS++  E PK KRPVQ+KFQIPYFTTSGIQVRYLKI EPK
Sbjct: 359 WKIRSFYGGKEYSMAAQMGLPSINGVEKPKFKRPVQVKFQIPYFTTSGIQVRYLKINEPK 418

Query: 421 LQYNSYPWVRYITQSGDDYTIRL 443
           LQY SYPWVRYITQ+GDDYTIRL
Sbjct: 419 LQYKSYPWVRYITQNGDDYTIRL 441

>Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON}
           (126558..127910) [1353 nt, 451 aa]
          Length = 450

 Score =  677 bits (1748), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/450 (72%), Positives = 380/450 (84%), Gaps = 8/450 (1%)

Query: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60
           M S V FCD+ GKP+LSRRY+DD+  SA++ F  +LLE E+ESSV+PPC  + GIHY+++
Sbjct: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60

Query: 61  QYNDVYVLALTRSVSVNATTMFAFMYKLINXXXXXXXXXXXXSIRDNYIIIYELLDEMMD 120
           Q++D+YV+ALT S   N   +F F+++L++            SIRDN++IIYELLDEMMD
Sbjct: 61  QHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMD 120

Query: 121 KGVPQVTETKMLKQYITQKSFKLTRSAKKQKNVARPPTELTNSVSWRPEGIKYKKNEAFL 180
            G+PQ+TETKMLKQYITQKSFKL ++AKK++N ARPP  LTNSVSWR EGIKYKKNEA+L
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLIKAAKKKRNAARPPVALTNSVSWRQEGIKYKKNEAYL 180

Query: 181 DVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLKLGLNDKGIFT--TNDQEDSPEP 238
           D+IESINMLM QQGQVLRSEI+G VKV+SRLSGMPDLKLG+NDKGIF+    ++ED  +P
Sbjct: 181 DIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKYLENEEDFSKP 240

Query: 239 V------VSSKKKNSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMTYRLSTPIK 292
           V       ++  K SNIELEDLKFHQCVRLSKFENEKIITFIPPDGEF+LM YRL+TPIK
Sbjct: 241 VQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFELMNYRLTTPIK 300

Query: 293 PLIWCDVKVQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIPEDADSPTFKYSRGNIKW 352
           PLIWCD+ +QVHS SRIEIHCRAKAQIKKKS+ANNVEILIP+P+DAD+PTFKYS G+IKW
Sbjct: 301 PLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPTFKYSHGSIKW 360

Query: 353 VPEKNAILWKFSSFQGGKEYSMAAQLGLPSVSDAEPPKLKRPVQIKFQIPYFTTSGIQVR 412
           +PEKNAILWK  SF GGKEYSM AQLGLPSV   EPPK+KRPVQIKFQIPYFTTSGIQVR
Sbjct: 361 LPEKNAILWKLRSFAGGKEYSMTAQLGLPSVDGIEPPKVKRPVQIKFQIPYFTTSGIQVR 420

Query: 413 YLKIEEPKLQYNSYPWVRYITQSGDDYTIR 442
           YLKI EPKLQY S+PWVRYITQSGDDYTIR
Sbjct: 421 YLKINEPKLQYKSFPWVRYITQSGDDYTIR 450

>ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 447

 Score =  672 bits (1735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/446 (69%), Positives = 375/446 (84%), Gaps = 4/446 (0%)

Query: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60
           M S V FCD KG+P+LSRRY+DD+  SA++ F  LLL+ E+ESSV+PPC  H+GI Y+++
Sbjct: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60

Query: 61  QYNDVYVLALTRSVSVNATTMFAFMYKLINXXXXXXXXXXXXSIRDNYIIIYELLDEMMD 120
           Q+ND+YV+AL  S++ N   +FAF++KL+             S+RDN+IIIYELLDEMMD
Sbjct: 61  QHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMMD 120

Query: 121 KGVPQVTETKMLKQYITQKSFKLTRSAKKQKNVARPPTELTNSVSWRPEGIKYKKNEAFL 180
            G+PQ+TETKMLKQYITQKSFKL ++ KK K   RPPTE+TNSVSWR   I +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKKNEAFL 180

Query: 181 DVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLKLGLNDKGIFTTNDQEDSPEPV- 239
           D++ESINMLM QQGQVLRSEI+G +KV+S+LSGMPDLKLG+NDKGIF+   + DS +PV 
Sbjct: 181 DIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEGDS-DPVT 239

Query: 240 --VSSKKKNSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMTYRLSTPIKPLIWC 297
             V+  KK +NIELEDLKFHQCVRLSKFENEKIITFIPPDG F+LM YRLS P+KPLIWC
Sbjct: 240 TAVTEGKKKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGAFELMNYRLSMPVKPLIWC 299

Query: 298 DVKVQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIPEDADSPTFKYSRGNIKWVPEKN 357
           DV VQVHS SRIEIHCRA+AQIKK+S+AN+VEILIP+P+DAD+P+FKY+ G++KWVP+KN
Sbjct: 300 DVNVQVHSQSRIEIHCRARAQIKKRSIANSVEILIPVPDDADTPSFKYTHGSVKWVPQKN 359

Query: 358 AILWKFSSFQGGKEYSMAAQLGLPSVSDAEPPKLKRPVQIKFQIPYFTTSGIQVRYLKIE 417
           AILWK  SF GGKEYSM+AQ+GLPS++  + PK+KRPVQIKFQIPYFTTSGIQVRYLKI 
Sbjct: 360 AILWKIRSFTGGKEYSMSAQMGLPSINALDKPKVKRPVQIKFQIPYFTTSGIQVRYLKIT 419

Query: 418 EPKLQYNSYPWVRYITQSGDDYTIRL 443
           EPKL Y SYPWVRYITQSGDDYTI+L
Sbjct: 420 EPKLLYKSYPWVRYITQSGDDYTIKL 445

>TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.127
           YPL259C
          Length = 454

 Score =  670 bits (1728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/452 (69%), Positives = 379/452 (83%), Gaps = 9/452 (1%)

Query: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60
           M S + FCD+ GKP+L+RRY+DD+S +A+++F  LLL+ E+E+ V+PPC  H GIHY+++
Sbjct: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60

Query: 61  QYNDVYVLALTRSVSVNATTMFAFMYKLINXXXXXXXXXXXXSIRDNYIIIYELLDEMMD 120
           +++D+YV+ALT S   N   +F F+++L+             S+RDN++IIYELLDEMMD
Sbjct: 61  KHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMD 120

Query: 121 KGVPQVTETKMLKQYITQKSFKL--TRSAKKQKNVARPPTELTNSVSWRPEGIKYKKNEA 178
            G+PQ+TETKMLK+YITQKSFKL  T ++KK+KN ARPP ELTNSVSWRPEGI YKKNEA
Sbjct: 121 FGIPQITETKMLKKYITQKSFKLIKTSTSKKKKNAARPPAELTNSVSWRPEGITYKKNEA 180

Query: 179 FLDVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLKLGLNDKGIFTTNDQEDSPEP 238
           FLD+IESINML+TQQGQVLRSEI+G V+VRSRLSGMPDLKLG+ND+GIF+   +E++ + 
Sbjct: 181 FLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDLKLGINDRGIFSNYLEENNVDG 240

Query: 239 VVSS-------KKKNSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMTYRLSTPI 291
             SS       + K   IELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLM YRL+TPI
Sbjct: 241 SSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTPI 300

Query: 292 KPLIWCDVKVQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIPEDADSPTFKYSRGNIK 351
           KPLIWCDV +QVHS SRIEIHCRAKAQIKKKS+ANNVEILIP+P+DAD+P F+YS G+IK
Sbjct: 301 KPLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPQFRYSHGSIK 360

Query: 352 WVPEKNAILWKFSSFQGGKEYSMAAQLGLPSVSDAEPPKLKRPVQIKFQIPYFTTSGIQV 411
           W+PEKNAILWK  SF GGKEYSM+AQL LPSV   EPPK++RPVQ+KFQIPYFTTSGIQV
Sbjct: 361 WLPEKNAILWKLRSFAGGKEYSMSAQLHLPSVDGVEPPKVRRPVQVKFQIPYFTTSGIQV 420

Query: 412 RYLKIEEPKLQYNSYPWVRYITQSGDDYTIRL 443
           RYLK+ EPKLQY SYPWVRYITQSG+DYTIRL
Sbjct: 421 RYLKVNEPKLQYKSYPWVRYITQSGEDYTIRL 452

>KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {ON}
           Anc_7.127 YPL259C
          Length = 461

 Score =  667 bits (1721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/460 (68%), Positives = 377/460 (81%), Gaps = 17/460 (3%)

Query: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60
           MAS V FCD KGKPLLSRRY+DDV  SA++ F  LL + E ES+V+PPC +HNGI Y+++
Sbjct: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60

Query: 61  QYNDVYVLALTRSVSVNATTMFAFMYKLINXXXXXXXXXXXXSIRDNYIIIYELLDEMMD 120
           Q+ND+YV+AL  S++VN   +FAF++KL+             SIRDN++IIYEL+DEMMD
Sbjct: 61  QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD 120

Query: 121 KGVPQVTETKMLKQYITQKSFKLTRSAKKQKNVARPPTELTNSVSWRPEGIKYKKNEAFL 180
            G+PQ+TE +MLK+YITQKSFKL ++ KK++N ARPP+EL NSVSWR EGIKYKKNEAFL
Sbjct: 121 YGIPQITEPRMLKKYITQKSFKLEKAHKKKRNAARPPSELNNSVSWRAEGIKYKKNEAFL 180

Query: 181 DVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLKLGLNDKGIFT-----TNDQEDS 235
           D++ESINML+TQ+GQVLRSEI+G VK++SRLSGMPDLKLG+ND+GIFT      N   + 
Sbjct: 181 DIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNI 240

Query: 236 PEP------------VVSSKKKNSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLM 283
           P+P                KK+ +NIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLM
Sbjct: 241 PDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLM 300

Query: 284 TYRLSTPIKPLIWCDVKVQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIPEDADSPTF 343
            YRL+T IKPLIWCDV +QVHS SRIEI CRAKAQIKKKSVA NV+ILIP+P+DAD+P+F
Sbjct: 301 NYRLTTSIKPLIWCDVSIQVHSKSRIEIRCRAKAQIKKKSVAANVQILIPVPDDADTPSF 360

Query: 344 KYSRGNIKWVPEKNAILWKFSSFQGGKEYSMAAQLGLPSVSDAEPPKLKRPVQIKFQIPY 403
           KYS G+IK+VPE++AILWK  SF GGKEY+M A++GLPS+   E PK+KRPVQ+KF+IPY
Sbjct: 361 KYSHGSIKYVPEQSAILWKIKSFPGGKEYAMFAEMGLPSMDSYEEPKVKRPVQVKFEIPY 420

Query: 404 FTTSGIQVRYLKIEEPKLQYNSYPWVRYITQSGDDYTIRL 443
           FTTSGIQVRYLKI EPKLQY SYPWVRYITQSGDDYTIR+
Sbjct: 421 FTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRV 460

>YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}
           APM1Mu1-like medium subunit of the clathrin-associated
           protein complex (AP-1); binds clathrin; involved in
           clathrin-dependent Golgi protein sorting
          Length = 475

 Score =  665 bits (1716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/474 (67%), Positives = 378/474 (79%), Gaps = 31/474 (6%)

Query: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60
           MAS V FCD  GKPLLSRRY+DD+  SA++ F  LL + E++S+++PPC +HNG+ Y+++
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QYNDVYVLALTRSVSVNATTMFAFMYKLINXXXXXXXXXXXXSIRDNYIIIYELLDEMMD 120
           Q+ND+YV+A+  S+S NA  +F F++KL+             SIRDN++IIYELLDE+MD
Sbjct: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 KGVPQVTETKMLKQYITQKSFKLTRSAKKQKNVARPPTELTNSVSWRPEGIKYKKNEAFL 180
            G+PQ+TETKMLKQYITQKSFKL +SAKK++N  RPP  LTNSVSWRPEGI +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGITHKKNEAFL 180

Query: 181 DVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLKLGLNDKGIF------------- 227
           D++ESINMLMTQ+GQVLRSEI+G VKV S+LSGMPDLKLG+NDKGIF             
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDTNIPSA 240

Query: 228 ----TTNDQEDSPEPVVSS----KKKNSNIELEDLKFHQCVRLSKFENEKIITFIPPDGE 279
               + N+ E   +P ++S     KK  NIELEDLKFHQCVRLSKFENEKIITFIPPDG+
Sbjct: 241 SATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGK 300

Query: 280 FDLMTYRLSTPIKPLIWCDVKVQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIPEDAD 339
           FDLM YRLST IKPLIWCDV VQVHS SRIEIHC+AKAQIK+KS A NVEILIP+P+DAD
Sbjct: 301 FDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDAD 360

Query: 340 SPTFKYSRGNIKWVPEKNAILWKFSSFQGGKEYSMAAQLGLPSVSDAEP-----PK---- 390
           +PTFKYS G++K+VPEK+AILWK  SF GGKEYSM+A+LGLPS+S+ E      PK    
Sbjct: 361 TPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNAE 420

Query: 391 -LKRPVQIKFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWVRYITQSGDDYTIRL 443
            LK PVQIKFQIPYFTTSGIQVRYLKI EPKLQY SYPWVRYITQSGDDYTIRL
Sbjct: 421 ILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 474

>Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}
           YPL259C (REAL)
          Length = 478

 Score =  660 bits (1702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/477 (66%), Positives = 378/477 (79%), Gaps = 34/477 (7%)

Query: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60
           MAS V FCD  GKPLLSRRY+DD+  SA++ F  LL + E++S+++PPC +HNG+ Y+++
Sbjct: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QYNDVYVLALTRSVSVNATTMFAFMYKLINXXXXXXXXXXXXSIRDNYIIIYELLDEMMD 120
           Q+ND+Y++A+  S+S NA  +F F++KL+             SIRDN++IIYELLDE+MD
Sbjct: 61  QHNDLYLVAIATSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 KGVPQVTETKMLKQYITQKSFKLTRSAKKQKNVARPPTELTNSVSWRPEGIKYKKNEAFL 180
            G+PQ+TETKMLKQYITQKSFKL +SAKK++N  RPP  LTNSVSWRPEGI +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGISHKKNEAFL 180

Query: 181 DVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLKLGLNDKGIF------------- 227
           D++ESINMLMTQ+GQVLRSEI+G VKV S+LSGMPDLKLG+NDKGIF             
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPA 240

Query: 228 ---TTNDQ----EDSPEPVVSS----KKKNSNIELEDLKFHQCVRLSKFENEKIITFIPP 276
              TT+D     +   +P ++S     K+  NIELEDLKFHQCVRLSKFENEKIITFIPP
Sbjct: 241 ASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQCVRLSKFENEKIITFIPP 300

Query: 277 DGEFDLMTYRLSTPIKPLIWCDVKVQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIPE 336
           DG+FDLM YRLST IKPLIWCDV VQVHS SRIEIHC+AKAQIK+KS A NVEILIP+P+
Sbjct: 301 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPD 360

Query: 337 DADSPTFKYSRGNIKWVPEKNAILWKFSSFQGGKEYSMAAQLGLPSVSDAEP-----PK- 390
           DAD+PTFKYS G++K+VPEK+AILWK  SF GGKEYSM+A+LGLPS+S+        PK 
Sbjct: 361 DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNGNDGSKTIPKN 420

Query: 391 ----LKRPVQIKFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWVRYITQSGDDYTIRL 443
               LK PVQIKFQIPYFTTSGIQVRYLKI EPKLQY SYPWVRYITQSGDDYTIRL
Sbjct: 421 NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 477

>KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON}
           Anc_7.127 YPL259C
          Length = 465

 Score =  659 bits (1700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/468 (67%), Positives = 378/468 (80%), Gaps = 28/468 (5%)

Query: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60
           MAS V FCD KGKPLLSR+Y+DD+  SA++ F  LL ++E+ES+++PPC  HNGI YM++
Sbjct: 1   MASAVYFCDHKGKPLLSRKYRDDIPLSAIDKFSSLLSDKEEESNLLPPCISHNGIQYMFI 60

Query: 61  QYNDVYVLALTRSVSVNATTMFAFMYKLINXXXXXXXXXXXXSIRDNYIIIYELLDEMMD 120
           Q+ND+Y+ AL  SV  N + +FAF++K+I+            SIRDN+IIIYELLDEMMD
Sbjct: 61  QHNDLYLAALATSVQANISLIFAFLHKIIDVLDGYLKTVEEESIRDNFIIIYELLDEMMD 120

Query: 121 KGVPQVTETKMLKQYITQKSFKLTRSAKKQKNVARPPTELTNSVSWRPEGIKYKKNEAFL 180
            G+PQ+TETKMLK+YIT KSFKL ++ KK++N ARPPTELTNSVSWRPEGIKYKKNEAFL
Sbjct: 121 YGLPQITETKMLKKYITTKSFKLEKAHKKKRNAARPPTELTNSVSWRPEGIKYKKNEAFL 180

Query: 181 DVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLKLGLNDKGIFT------------ 228
           D+IESINML+TQ+GQVLRSEI+G V+V+SRLSGMPDLKLG+ND+GIFT            
Sbjct: 181 DIIESINMLITQKGQVLRSEIVGNVRVKSRLSGMPDLKLGINDRGIFTKYLEGNNIGIAK 240

Query: 229 TNDQEDSPE-----PVVS--SKKKNSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFD 281
             D ED+ +      +VS  S K+ +NIELEDLKFHQCVRLSKFENEKII+FIPPDGEFD
Sbjct: 241 NGDDEDADDTNNESSIVSEGSNKRKTNIELEDLKFHQCVRLSKFENEKIISFIPPDGEFD 300

Query: 282 LMTYRLSTPIKPLIWCDVKVQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIPEDADSP 341
           LM YRLST IKPLIWCDV +Q +   RIEIHC+AKAQIKKKS+A NVEILIP+PEDADSP
Sbjct: 301 LMNYRLSTSIKPLIWCDVSIQTY---RIEIHCKAKAQIKKKSIATNVEILIPVPEDADSP 357

Query: 342 TFKYSRGNIKWVPEKNAILWKFSSFQGGKEYSMAAQLGLPSVSDAE------PPKLKRPV 395
            FKYS G IK++PEKN +LWK SSF GGKEYSMAAQ+GLPS+S  +        + K+PV
Sbjct: 358 IFKYSHGKIKYLPEKNLLLWKISSFPGGKEYSMAAQMGLPSISGEDDLNTRVSNQSKKPV 417

Query: 396 QIKFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWVRYITQSGDDYTIRL 443
           Q+KF+IPYFTTSGIQVRYLK+ EPKLQY +YPWVRYITQSGDDYTIR+
Sbjct: 418 QVKFKIPYFTTSGIQVRYLKVNEPKLQYKTYPWVRYITQSGDDYTIRI 465

>Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C
           (REAL)
          Length = 476

 Score =  659 bits (1701), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/475 (66%), Positives = 374/475 (78%), Gaps = 32/475 (6%)

Query: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60
           MAS V FCD  GKPLLSRRY+DDV  SA++ F  LL + E++S+++PPC +HNG+ Y+++
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDVPLSAIDKFSTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QYNDVYVLALTRSVSVNATTMFAFMYKLINXXXXXXXXXXXXSIRDNYIIIYELLDEMMD 120
           Q+ND+Y++A+  S++ NA  +F F++KL+             SIRDN++IIYELLDE+MD
Sbjct: 61  QHNDLYLVAIVTSLTANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 KGVPQVTETKMLKQYITQKSFKLTRSAKKQKNVARPPTELTNSVSWRPEGIKYKKNEAFL 180
            G+PQ+TETKMLKQYITQKSFKL +SAKK++N  RPP  LTNSVSWRPEGI +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGITHKKNEAFL 180

Query: 181 DVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLKLGLNDKGIFTTNDQEDSPEPVV 240
           D++ESINMLMTQ+GQVLRSEI+G VKV S+LSGMPDLKLG+NDKGIF+     DS  P  
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDNDSNIPSA 240

Query: 241 SSK----------------------KKNSNIELEDLKFHQCVRLSKFENEKIITFIPPDG 278
            S                       K+  NIELEDLKFHQCVRLSKFENEKIITFIPPDG
Sbjct: 241 VSAATSDNNTDTDKKPSITSSSTTSKRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDG 300

Query: 279 EFDLMTYRLSTPIKPLIWCDVKVQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIPEDA 338
           +FDLM YRLST IKPLIWCDV VQVHS SRIEIHC+AKAQIK+KS A NVEILIP+P+DA
Sbjct: 301 KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDA 360

Query: 339 DSPTFKYSRGNIKWVPEKNAILWKFSSFQGGKEYSMAAQLGLPSVSDAEP-----PK--- 390
           D+PTFKYS G++K+VPEK+AILWK  SF GGKEYSM+A+LGLPS+S ++      PK   
Sbjct: 361 DTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISTSKDGSRTIPKSNA 420

Query: 391 --LKRPVQIKFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWVRYITQSGDDYTIRL 443
             LK PVQIKFQIPYFTTSGIQVRYLKI EPKLQY SYPWVRYITQSGDDYTIRL
Sbjct: 421 KLLKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 475

>Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}
           YPL259C (REAL)
          Length = 476

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/475 (66%), Positives = 376/475 (79%), Gaps = 32/475 (6%)

Query: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60
           MAS V FCD  GKPLLSRRY+DD+  SA++ F  LL + E++S+++PPC +HNG+ Y+++
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QYNDVYVLALTRSVSVNATTMFAFMYKLINXXXXXXXXXXXXSIRDNYIIIYELLDEMMD 120
           Q+ND+Y++A+  S+  NA  +F F++KL+             SIRDN++IIYELLDE+MD
Sbjct: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 KGVPQVTETKMLKQYITQKSFKLTRSAKKQKNVARPPTELTNSVSWRPEGIKYKKNEAFL 180
            G+PQ+ ETKMLKQYITQKSFKL +SAKK++N  RPP  LTNSVSWRPEGI +KKNEAFL
Sbjct: 121 YGIPQICETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGIIHKKNEAFL 180

Query: 181 DVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLKLGLNDKGIFTT--NDQEDSPEP 238
           D++ESINMLMTQ+GQVLRSEI+G VKV S+LSGMPDLKLG+NDKGIF+   +D  ++P P
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDSNTPPP 240

Query: 239 VVSS--------------------KKKNSNIELEDLKFHQCVRLSKFENEKIITFIPPDG 278
             ++                     K+  NIELEDLKFHQCVRLSKFENEKIITFIPPDG
Sbjct: 241 TSAATSDNITDTDKKPSITSSSTTSKRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDG 300

Query: 279 EFDLMTYRLSTPIKPLIWCDVKVQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIPEDA 338
           +FDLM YRLST IKPLIWCDV VQVHS SRIEIHC+AKAQIK+KS A NVEI+IP+P+DA
Sbjct: 301 KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPDDA 360

Query: 339 DSPTFKYSRGNIKWVPEKNAILWKFSSFQGGKEYSMAAQLGLPSVS-DAEP----PK--- 390
           D+PTFKYS G++K+VPEK+AILWK  SF GGKEYSM+A+LGLPS+S D E     PK   
Sbjct: 361 DTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKSNA 420

Query: 391 --LKRPVQIKFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWVRYITQSGDDYTIRL 443
             LK PVQIKFQIPYFTTSGIQVRYLKI EPKLQY SYPWVRYITQSGDDYTIRL
Sbjct: 421 EILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 475

>NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {ON}
           Anc_7.127
          Length = 444

 Score =  651 bits (1679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/444 (70%), Positives = 371/444 (83%), Gaps = 2/444 (0%)

Query: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60
           MAS + FCD KG+PLLSR+Y+DD+  +A++ F  LL + E+ESSV+PPC  +N   Y+++
Sbjct: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60

Query: 61  QYNDVYVLALTRSVSVNATTMFAFMYKLINXXXXXXXXXXXXSIRDNYIIIYELLDEMMD 120
           Q++D+Y++A+T  +  N   +FAF+YK+I+            SIRDNY+IIYELLDE+MD
Sbjct: 61  QHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMD 120

Query: 121 KGVPQVTETKMLKQYITQKSFKLTRSAKKQKNVARPPTELTNSVSWRPEGIKYKKNEAFL 180
            G+PQ+TETKMLKQYITQKSFKL ++AKK++N ARPP+ LT+SVSWR EGIKYKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKAAKKKQNAARPPSALTDSVSWRSEGIKYKKNEAFL 180

Query: 181 DVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLKLGLNDKGIFTTNDQEDSPEPVV 240
           D++ESINMLMTQ+GQ+LRSEILG VK++SRLSGMPDLKLG+NDKGIF+    ED      
Sbjct: 181 DIVESINMLMTQKGQILRSEILGVVKIKSRLSGMPDLKLGINDKGIFSKQLTEDDTNNNA 240

Query: 241 SSKKKNSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMTYRLSTPIKPLIWCDVK 300
           +SKK+N  IELEDLKFHQCVRLSKFE EKIITFIPPDG+F+LM YRLST IKPLIWCD+ 
Sbjct: 241 TSKKQN-KIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPLIWCDMN 299

Query: 301 VQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIPEDADSPTFKYSRGNIKWVPEKNAIL 360
           VQVHS SRIEIHCRAKAQIKKKS A NVEILIP+PEDAD+P FKYS G+IKWVPEK+AIL
Sbjct: 300 VQVHSNSRIEIHCRAKAQIKKKSTATNVEILIPVPEDADTPNFKYSHGSIKWVPEKSAIL 359

Query: 361 WKFSSFQGGKEYSMAAQLGLPSVSD-AEPPKLKRPVQIKFQIPYFTTSGIQVRYLKIEEP 419
           WK  SF GGKEYSMAA+L LPS S  +E  + K+PVQ+KFQIPYFTTSGIQVRYLKI EP
Sbjct: 360 WKIRSFPGGKEYSMAAELCLPSTSSKSEEVQNKKPVQVKFQIPYFTTSGIQVRYLKINEP 419

Query: 420 KLQYNSYPWVRYITQSGDDYTIRL 443
           KLQY SYPWVRYITQSGDDYTIRL
Sbjct: 420 KLQYKSYPWVRYITQSGDDYTIRL 443

>NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {ON}
           Anc_7.127
          Length = 481

 Score =  648 bits (1672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/449 (70%), Positives = 373/449 (83%), Gaps = 6/449 (1%)

Query: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60
           MAS V FCDSKG PLL+RRY+DD+  SA+E F  LL + E+E++++PPC  +NG+ Y+++
Sbjct: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91

Query: 61  QYNDVYVLALTRSVSVNATTMFAFMYKLINXXXXXXXXXXXXSIRDNYIIIYELLDEMMD 120
           Q+NDVY++A+  S+S NA  +FAF+YKL++            SIRDN++IIYELLDE MD
Sbjct: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151

Query: 121 KGVPQVTETKMLKQYITQKSFKLTRSAKKQKNVARPPTELTNSVSWRPEGIKYKKNEAFL 180
            G+PQ+TETKMLKQYITQKSFKL ++AKK++N ARPP  LTNSVSWR   IKYKKNEAFL
Sbjct: 152 YGIPQITETKMLKQYITQKSFKLVKAAKKKRNAARPPEALTNSVSWRSADIKYKKNEAFL 211

Query: 181 DVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLKLGLNDKGIFTTNDQEDS----P 236
           D+IESINMLMTQ+GQ+LRSEI+G VKV+SRLSGMPDLKLG+NDKGIF+ +  +DS     
Sbjct: 212 DIIESINMLMTQKGQILRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKHMDDDSLNNEG 271

Query: 237 EPVVSS--KKKNSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMTYRLSTPIKPL 294
             V SS   KK +NIELEDLKFHQCVRLSKFE EKIITFIPPDG+F+LM YRLST IKPL
Sbjct: 272 ASVASSTTDKKKNNIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPL 331

Query: 295 IWCDVKVQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIPEDADSPTFKYSRGNIKWVP 354
           IWCD+ +QVHS SRIEIHCRAKAQIKKKS A NV+I+IP+PEDAD+P FKYS G+IK+VP
Sbjct: 332 IWCDMNIQVHSQSRIEIHCRAKAQIKKKSTATNVQIIIPVPEDADTPEFKYSHGSIKYVP 391

Query: 355 EKNAILWKFSSFQGGKEYSMAAQLGLPSVSDAEPPKLKRPVQIKFQIPYFTTSGIQVRYL 414
           EKN I+WK  SF GGKEYSM+AQ+ LPS+ + E  K KRPVQIKFQIPYFTTSGIQV+YL
Sbjct: 392 EKNVIIWKIRSFPGGKEYSMSAQMQLPSIGNIEEHKAKRPVQIKFQIPYFTTSGIQVKYL 451

Query: 415 KIEEPKLQYNSYPWVRYITQSGDDYTIRL 443
           KI EPKLQY SYPWVRYITQSGDDYTIRL
Sbjct: 452 KINEPKLQYKSYPWVRYITQSGDDYTIRL 480

>CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259c Clathrin coat assembly protein
          Length = 456

 Score =  626 bits (1614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/455 (68%), Positives = 376/455 (82%), Gaps = 12/455 (2%)

Query: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60
           MAS + FCD+KG+PLLSR+Y+DD+  SA++ F  LL   E+E++++PPC  HNGI ++++
Sbjct: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60

Query: 61  QYNDVYVLALTRSVSVNATTMFAFMYKLINXXXXXXXXXXXXSIRDNYIIIYELLDEMMD 120
           Q+ND+Y++A+  S+S NA  +F+F++K+I             SIRDN++IIYELLDEMMD
Sbjct: 61  QHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMD 120

Query: 121 KGVPQVTETKMLKQYITQKSFKLTRSAKKQKNVARPPTELTNSVSWRPEGIKYKKNEAFL 180
            G+PQ+TE KMLKQYITQKSFKL ++AKK++N ARPPT LTNSVSWRPEGIK+KKNEAFL
Sbjct: 121 YGIPQITEPKMLKQYITQKSFKLKKAAKKKRNAARPPTSLTNSVSWRPEGIKHKKNEAFL 180

Query: 181 DVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLKLGLNDKGIFTT---NDQEDSP- 236
           D+IESINMLMTQ+GQVLRSEI+G VKV+S+LSGMPDLKLG+NDKG+F+     D+   P 
Sbjct: 181 DIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGINDKGLFSKYLEGDENGVPI 240

Query: 237 EPVVSS-------KKKNSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMTYRLST 289
            P  SS       KK+++N+ELEDLKFHQCVRLSKFENEK ITFIPPDG+F+LM+YRLST
Sbjct: 241 APDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFENEKQITFIPPDGDFELMSYRLST 300

Query: 290 PIKPLIWCDVKVQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIPEDADSPTFKYSRGN 349
            IKPLIWCDV ++ HS SRIEI CRAKAQIKKKS A NVEILIP+PEDAD+P FKYS G+
Sbjct: 301 AIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKKSTATNVEILIPVPEDADTPVFKYSHGS 360

Query: 350 IKWVPEKNAILWKFSSFQGGKEYSMAAQLGLPSVSDA-EPPKLKRPVQIKFQIPYFTTSG 408
           IK+VPEKNAILWK  +F G KEYSMAA++GLPS +   E  KLKRPVQ+KFQIPYFTTSG
Sbjct: 361 IKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPSTNAGEESEKLKRPVQVKFQIPYFTTSG 420

Query: 409 IQVRYLKIEEPKLQYNSYPWVRYITQSGDDYTIRL 443
           IQVRYLKIEE  LQY SYPWVRYIT+SGDDYTIRL
Sbjct: 421 IQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIRL 455

>Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}
           similar to Ashbya gossypii ADR315W
          Length = 464

 Score =  217 bits (553), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 135/471 (28%), Positives = 232/471 (49%), Gaps = 37/471 (7%)

Query: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60
           M S +     +G  ++S+  +D++     E F+   ++      V  P        + ++
Sbjct: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFR---IQVINNLDVRSPILTLGSTTFHHI 57

Query: 61  QYNDVYVLALTRSVSVNATTMFAFMYKLINXXXXXXXXXXXXSIRDNYIIIYELLDEMMD 120
           + N    L      + ++  ++ F+Y   N            S++ ++++ YE+LD ++D
Sbjct: 58  RSNGGLWLVTVSRGNTDSAGIWEFLYNF-NKLLEVYDINSEDSLQGDFMLCYEILDIVLD 116

Query: 121 KGVPQVTETKMLKQYITQKSFKLTRSAKKQKNVARPPTELTNSVS--------------- 165
            G+P+ TE   +  YI++K   L+ +     ++   P+ L  + +               
Sbjct: 117 NGIPRDTELTHIMPYISKK--PLSENLLGSDDILNTPSWLVKAGARGMSSENLGLTSKDM 174

Query: 166 --WRPEGIKYKKNEAFLDVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLKLGLND 223
             WR EGI+YKKNE +LDV E I++L+ + G +L+S + G+V+  + LSGMP  + G ND
Sbjct: 175 CLWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGFND 234

Query: 224 KGIFTTNDQEDSPEPVVSSKKKNSNIE--------LEDLKFHQCVRLSKFENEKIITFIP 275
               ++N Q    +     +     I+        LED KFHQCV+L KF+ E++I F+P
Sbjct: 235 YLSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKFDQERVIRFVP 294

Query: 276 PDGEFDLMTYRLSTPIKPLIWCDVKVQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIP 335
           PDG F+LM Y +   +         V    G  +E     K+    K  A +VE+ IP P
Sbjct: 295 PDGLFELMKYHVRDNLNLPFKVTPMVTTLKGKSVEYRITLKSLFPSKLCAKDVELYIPAP 354

Query: 336 EDADSPTFKYSRGNIKWVPEKNAILWKFSSFQGGKEYSMAAQLGLPSVSDAEPPKLKR-- 393
            D  +     S G  K++PE+NAI+WK   + G  E   +A + +P  +  +   L++  
Sbjct: 355 PDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVI-VPMGNGNDSLNLEQWS 413

Query: 394 --PVQIKFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWVRYITQSGDDYTIR 442
             P+ ++F+I  F+ SG+ VRYLK+ E  L YN+  WV+YI++SG  Y +R
Sbjct: 414 RPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYISKSG-AYEVR 463

>Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {ON}
           YOL062C (APM4) - Clathrin associated protein, medium
           subunit [contig 105] FULL
          Length = 467

 Score =  207 bits (527), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 138/465 (29%), Positives = 235/465 (50%), Gaps = 42/465 (9%)

Query: 11  KGKPLLSRRYQDDVSQSAVESFQHLLLE----REQESSVMPPCFHHNGIHYMYVQYNDVY 66
           +G+ L+S+  +  V +S  E F+  ++     R    ++    FHH           +++
Sbjct: 11  RGELLISKHVKGSVQKSMSEIFRIQVINNLDVRSPVLTLGSTTFHH------IKSAKNLW 64

Query: 67  VLALTRSVSVNATTMFAFMYKLINXXXXXXXXXXXXSIRDNYIIIYELLDEMMDKGVPQV 126
           ++A++RS + ++  ++ F+Y+L N             +++ ++I YELLD +++ G+P  
Sbjct: 65  IVAVSRS-NADSAAIWEFLYRL-NELLEAFNLYSENELKERFMICYELLDIVLEDGLPVD 122

Query: 127 TETKMLKQYITQK------SFKL------------------TRSAKKQKNVARPPTELTN 162
           TE   +   ++ K      +F +                   R      N+    +E  +
Sbjct: 123 TELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGNLQDIASEAPS 182

Query: 163 SVSWRPEGIKYKKNEAFLDVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLKLGLN 222
           ++ WR  GIKYKKNE FL+V E I++L+++ G +L+S + GTV+  + LSGMP  + GLN
Sbjct: 183 NIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMPVCRFGLN 242

Query: 223 DKGIFTTNDQEDSPEPVVSS----KKKNSNIELEDLKFHQCVRLSKFENEKIITFIPPDG 278
           D    +T   +D    V +     K    ++ LED KFHQCV+L KF++E+ I FI PDG
Sbjct: 243 DALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTINFIAPDG 302

Query: 279 EFDLMTYRLSTPIKPLIWCDVKVQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIPEDA 338
            F+LM Y +   +         V V   + I+     K+    K  A +V++ IP+P + 
Sbjct: 303 SFELMKYHVRENLNLPFKVTPIVTVVRSNSIDYQITIKSLFPSKLTAKDVQLRIPVPPET 362

Query: 339 DSPTFKYSRGNIKWVPEKNAILWKFSSFQGGKEYSMAAQLGLPSVSDAEPPKLKR-PVQI 397
            S     S G  K+VPE++AI+WKFS +QG  E S++A       S     +  R P+ +
Sbjct: 363 VSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISATAVPMKDSTLNIEQWPRPPISL 422

Query: 398 KFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWVRYITQSGDDYTIR 442
           KF+I  F+ SG+ VR+  + E    Y    W++Y+++SG  Y +R
Sbjct: 423 KFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKYLSKSG-AYEVR 466

>KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 466

 Score =  207 bits (527), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 138/472 (29%), Positives = 241/472 (51%), Gaps = 37/472 (7%)

Query: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60
           M S +     +G+ L+S+  +  V +S  E F+   ++      V  P        + +V
Sbjct: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFR---IQVINNLDVRSPVLTLGSTTFHHV 57

Query: 61  QY-NDVYVLALTRSVSVNATTMFAFMYKLINXXXXXXXXXXXXSIRDNYIIIYELLDEMM 119
           +   +++++A++RS + ++  ++ F+YKL +             ++++++  YELLD ++
Sbjct: 58  KSPGNLWIVAVSRS-NADSAAIWEFLYKL-SALLEAFGLHSENELKEDFMTCYELLDIVL 115

Query: 120 DKGVPQVTETKMLKQYITQK---------SF---------------KLTRSAKKQKNVAR 155
           + GVP  TE   +   ++ K         +F               +  R+     N+  
Sbjct: 116 EDGVPVDTELSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARSSSSNLHD 175

Query: 156 PPTELTNSVSWRPEGIKYKKNEAFLDVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMP 215
             +++ +++ WR  GIKYKKNE FL+V E I++L+++ G +L+S + GTV+  + LSGMP
Sbjct: 176 SHSKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMP 235

Query: 216 DLKLGLNDK-GIFTTNDQEDSPEPVVSS--KKKNSNIELEDLKFHQCVRLSKFENEKIIT 272
             + GLND   + T     +SP     +  K    ++ LED KFHQCV+L KF++E+ I 
Sbjct: 236 VCRFGLNDSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTIN 295

Query: 273 FIPPDGEFDLMTYRLSTPIKPLIWCDVKVQVHSGSRIEIHCRAKAQIKKKSVANNVEILI 332
           FIPPDG F+LM Y +   +         V +   + I+     K+    K  A +V++ I
Sbjct: 296 FIPPDGSFELMKYHVRENLNLPFKITPVVTLFKANSIDYRVTIKSLFPSKLTAKDVQLRI 355

Query: 333 PIPEDADSPTFKYSRGNIKWVPEKNAILWKFSSFQGGKEYSMAAQLGLPSVSDAEPPK-- 390
           P+P +        S G  K+VPE++AI+WKFS +QG  E S++A   +P    A      
Sbjct: 356 PVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSAT-AVPMKDSALNIDQW 414

Query: 391 LKRPVQIKFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWVRYITQSGDDYTIR 442
            K P+ +KF+I  F+ SG+ VR+  + E    Y    W++Y+++SG  Y +R
Sbjct: 415 SKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSKSG-AYEVR 465

>SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weakly
           similar to uniprot|P38700 Saccharomyces cerevisiae
           YHL019C APM2 homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 499

 Score =  207 bits (526), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 152/521 (29%), Positives = 245/521 (47%), Gaps = 100/521 (19%)

Query: 1   MASYVAFCDSKGKPLLSRRYQD-DVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMY 59
           M+S +   D   +PL+ + ++     + ++E FQ     +      M P FH+ GIH++Y
Sbjct: 1   MSSCIYILDETLQPLIYKNFKAISNGEESIELFQ-----QAHSKHPMVPVFHYKGIHFVY 55

Query: 60  VQYNDVYVLALTRSVS--VNATTMFAFM---------YKLINXXXXXXXXXXXXSIRDNY 108
           ++ +  Y ++    V+   N  + F  M         Y L+              I DN+
Sbjct: 56  IRRDGFYFISAVELVAEASNKKSHFNVMAILTYLENFYTLLKRYFNSQKLNRWL-IVDNF 114

Query: 109 IIIYELLDEMMDKGVPQVTETKMLKQYITQKSFKLTRSAKKQKNVARP------------ 156
            +IYELLDE +D GVPQ+T+  +++ YI  +       A   K +++             
Sbjct: 115 HLIYELLDESLDFGVPQLTDYNIIQDYIKVQVNLHDELADSSKKISKKEDLHGFEDDESY 174

Query: 157 -----PTELTNSVSWRPEGIKYKKNEAFLDVIESINMLMT-QQGQVLRSEILGTVKVRSR 210
                    T+++SWRP+GI Y KNE FLDVIE I   M   + ++ ++ + G ++ RS 
Sbjct: 175 MNSFIARTTTSAISWRPKGIHYTKNEFFLDVIEEIEYCMDFNKSKIRKNFVHGRIRCRSY 234

Query: 211 LSGMPDLKLGLNDKGIFTTNDQEDSPEPVVSSKKKNSNIELEDLKFHQCVRLSKFENEKI 270
           LSGMP LK+GL+                + SS  K     + + KFHQCV L   + + I
Sbjct: 235 LSGMPKLKIGLS---------------KITSSLPKEREQFMNNAKFHQCVSLEDLQ-KNI 278

Query: 271 ITFIPPDGEFDLMTYRLST-----PIKPLIWCDVKVQVHSGSRIEIHCRAKAQIKKKSVA 325
           ++FIPPDGEF L  Y+L       P+  L+  DVK +     +I I        K ++  
Sbjct: 279 VSFIPPDGEFQLCEYKLKRHVRDPPVIKLVKFDVKKEEKKRPKILISLTITTDFKSQNST 338

Query: 326 NNVEILIPIP--------EDADSPTFKYSRGNIKWVPEKNAILWKFSSFQGGK---EYSM 374
           + + I IP+         + A  P FK  +GN+ +    + +LW+  S +GG    E+SM
Sbjct: 339 SVLNIRIPLTKIFSEYQIDLAKPPRFKCDQGNVLFNLTDDLLLWEVGSIKGGHAQTEHSM 398

Query: 375 AAQLGLPSVSD-----------AEPPKLK---------------------RPVQIKFQIP 402
             +  L    +            +PP L+                     R V ++F+IP
Sbjct: 399 YCEFRLYDEEEYKKQLEELKNSMDPPPLRQGPKLEELYKQVHENENTNRSRLVSMEFEIP 458

Query: 403 YFTTSGIQVRYLKIEEPKLQYNSYPWVRYITQSGDDYTIRL 443
           Y+T SG++V+YLKIEE +LQY+S+PWVRY T + ++Y  ++
Sbjct: 459 YYTCSGLKVQYLKIEEDQLQYHSFPWVRYKTVNDEEYAYQI 499

>SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 482

 Score =  204 bits (519), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 146/485 (30%), Positives = 249/485 (51%), Gaps = 67/485 (13%)

Query: 11  KGKPLLSRRYQDDVSQSAVESFQHLLLE----REQESSVMPPCFHHNGIHYMYVQYNDVY 66
           KG+ ++S+  +D + +S  E F+  ++     R    ++    FHH          ++++
Sbjct: 11  KGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRSPVLTLGSTTFHH------IRSSSNLW 64

Query: 67  VLALTRSVSVNATTMFAFMYKLINXXXXXXXXXXXXSIRDNYIIIYELLDEMMDKGVPQV 126
           ++A+TRS + ++  ++ F+YK  N            S+++ ++  YELLD +++ GVP  
Sbjct: 65  IVAVTRS-NADSAAIWEFLYKF-NALLEAYGLNSEESLKEEFMTCYELLDVVLENGVPVD 122

Query: 127 TETKMLKQYITQK----------SFKLTRSAKKQKNVA-RPPTELTNSVS---------- 165
           TE   +   ++++          + +L  SA    ++  R P  L               
Sbjct: 123 TELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGSRSSSSVSSPAN 182

Query: 166 -----------WRPEGIKYKKNEAFLDVIESINMLMTQQGQVLRSEILGTVKVRSRLSGM 214
                      WR  GIKYKKNE FLDV E IN+L+++ G +L+S + G+V + + LSG 
Sbjct: 183 GDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVDLTTHLSGT 242

Query: 215 PDLKLGLNDK----GIFTTNDQEDSPEPVVSSKK-----KNSNIELEDLKFHQCVRLSKF 265
           P  + GLND     G   + D +   E  V +KK        +++LED KFHQCV+L++F
Sbjct: 243 PLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQCVQLNRF 302

Query: 266 ENEKIITFIPPDGEFDLMTYR----LSTPIKPLIWCDVKVQVHSGSRIEIHCRAKAQIKK 321
             ++II F+PPDG F+LM Y     L+ P K  I     V+ ++G+ +E     K+    
Sbjct: 303 NTDRIIRFVPPDGSFELMRYHVRDNLNLPFK--ITPIFSVRSNNGA-VEYRVALKSLFPS 359

Query: 322 KSVANNVEILIPIPEDADSPTFKYSRGNIKWVPEKNAILWKFSSFQGGKEYSMAAQLGLP 381
           K  A +V + IP+P          S G  ++VPE+NA+LWKF+ +QG  E +++A L +P
Sbjct: 360 KLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQGLTENTLSA-LTVP 418

Query: 382 SVSDAEPPKLKR----PVQIKFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWVRYITQSGD 437
            + +     L++    P+ + F+I  F+ SG+ VR+ K+ E    Y++  WV+YI++SG 
Sbjct: 419 -MDNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYHTVKWVKYISRSG- 476

Query: 438 DYTIR 442
            Y +R
Sbjct: 477 AYEVR 481

>CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062c APM4
          Length = 475

 Score =  202 bits (513), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 135/485 (27%), Positives = 248/485 (51%), Gaps = 54/485 (11%)

Query: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60
           M S V    S+G+ ++S+ +++++ +S  + F+   ++      V  P        + ++
Sbjct: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFR---IQVINNLDVRSPILTLGSTTFQHI 57

Query: 61  QYN----DVYVLALTRSVSVNATTMFAFMYKLINXXXXXXXXXXXXSIRDNYIIIYELLD 116
           + N    D++++++TRS ++N   ++ F+YK  +             +++ +++ YELLD
Sbjct: 58  RSNVHGDDLWLVSVTRS-NINCGAVWEFLYKF-DHMLELYGLNNEEFLKEEFMVCYELLD 115

Query: 117 EMM-DKGVPQVTETKMLKQYITQKSFK-----------------------LTRSA----K 148
            M+ + G P  T+   + + ++ K  K                       L R++    +
Sbjct: 116 VMLGENGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSSFLNQ 175

Query: 149 KQKNVARPPTELTNSVSWRPEGIKYKKNEAFLDVIESINMLMTQQGQVLRSEILGTVKVR 208
           +  N +     +   + WRP+GI +KKNE FL V E I++L++++G +L+S + GT+ + 
Sbjct: 176 ESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDLV 235

Query: 209 SRLSGMPDLKLGLNDKGIFTTNDQEDSPEPVVSS----KKKNSNIELEDLKFHQCVRLSK 264
           + LSG P  + GLND      +D  DS + + +     K    ++ LED KFHQCV L K
Sbjct: 236 THLSGTPVCQFGLNDSLSVKNDDYGDSFDYIKNKKAIPKAAAGSVLLEDCKFHQCVSLEK 295

Query: 265 FENEKIITFIPPDGEFDLMTYRLSTPIK-PLIWCDVKVQVHSGSRIEIHCRAKAQIKKKS 323
           F+ ++II F+PPDG  +LM Y + + I  P     +     SG+ +E     K+    K 
Sbjct: 296 FDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRITLKSLFPSKL 355

Query: 324 VANNVEILIPIPEDADSPTFKYSRGNIKWVPEKNAILWKFSSFQGGKEYSMAAQLGLPSV 383
            A NV + IP+P +        S G+ K+ PE+ A+LW F+ + G  E +++A     ++
Sbjct: 356 TAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTENTLSAV----TI 411

Query: 384 SDAEPPKL------KRPVQIKFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWVRYITQSGD 437
           +  + P+L      K P+ + F+I  F+ SG+ VRY  I+E + +Y +  W+RY+++SG 
Sbjct: 412 TSKDAPRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKESE-RYKTVKWIRYVSKSG- 469

Query: 438 DYTIR 442
            Y IR
Sbjct: 470 SYEIR 474

>KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit,
          Length = 475

 Score =  199 bits (506), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 132/480 (27%), Positives = 243/480 (50%), Gaps = 44/480 (9%)

Query: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60
           M S +   ++KG  L+S+  +D V +S  + F+  ++    +  V  P        + +V
Sbjct: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVI---NDPHVRSPILTLGSTTFQHV 57

Query: 61  --QYND---VYVLALTRSVSVNATTMFAFMYKLINXXXXXXXXXXXXSIRDNYIIIYELL 115
             + +D   ++++A++RS +V+++ ++ +++KL               ++D ++++YE+L
Sbjct: 58  IRESSDNLPMWLVAVSRS-NVDSSMIWEYLHKLYQLMEAFGINDEDV-LKDEFMLLYEIL 115

Query: 116 DEMMDKGVPQVTETKMLKQYITQKSFKLTRSAKK--------QKNVARPP---------- 157
           +  ++ G+PQ T+   +   +++K  +    +K           N+ + P          
Sbjct: 116 ELTLENGIPQTTDLAQIIPRVSRKPIENNTISKSPDLDDFLSGSNILKAPKLSKRSSSSI 175

Query: 158 -TELTNSVSWRPEGIKYKKNEAFLDVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPD 216
                +   WRP G+KYKKNE +LD+ E I +L+ + G +++S + G+V   S LSGMP 
Sbjct: 176 ALSSLSECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSGMPL 235

Query: 217 LKLGLNDKGIFTTNDQ------EDSPEPVVSSKKKNSN-----IELEDLKFHQCVRLSKF 265
            +LGLND      N++      E   E  + +KK   N     + LED KFHQCV+L+K+
Sbjct: 236 CQLGLNDTYSIHGNEKSELSIVEMMSEYDIKNKKAIPNAAAGSVILEDCKFHQCVQLNKY 295

Query: 266 ENEKIITFIPPDGEFDLMTYRLSTPIKPLIWCDVKVQVHSGSRIEIHCRAKAQIKKKSVA 325
           E   +I F+PPDG F LM YR+   I        +V++   S +      ++       A
Sbjct: 296 EANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYKVTLRSLFPSNVSA 355

Query: 326 NNVEILIPIPEDADSPTFKYSRGNIKWVPEKNAILWKFSSFQGGKEYSMAAQLGLPSVSD 385
            +V + IP+P       F  S G  K+   +  ++WK++ ++G  E +++ ++ +P+ S 
Sbjct: 356 KDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLSGKVAIPATSH 415

Query: 386 AEPPKL---KRPVQIKFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWVRYITQSGDDYTIR 442
                L   + P+ + F+I  F+ SG+ VR+LK +EP+L Y    W++YI+ SG  Y IR
Sbjct: 416 DLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKYISHSG-AYEIR 474

>TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.165
           YOL062C
          Length = 482

 Score =  199 bits (505), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 141/493 (28%), Positives = 251/493 (50%), Gaps = 63/493 (12%)

Query: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQ-HLLLEREQESSVMPPCFHHNGIHYMY 59
           M S +    S+G+ ++++  +  + +S  + F+  ++   +  S ++         H++ 
Sbjct: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRSPIL--TLGSTTFHHIR 58

Query: 60  VQYND-VYVLALTRSVSVNATTMFAFMYKLINXXXXXXXXXXXXSIRDNYIIIYELLDEM 118
              +D ++++A++RS + N+  ++ F+YKL N            ++++N++  YE+LD +
Sbjct: 59  SDGSDSLWLVAVSRS-NANSGAIWEFLYKL-NVIMDVYGLTKEGTLKENFMNCYEILDTV 116

Query: 119 MDKG-VPQVTE-----TKML----KQ----------YITQKSFKLTRSAKKQKNVARPPT 158
           +++G +P  TE     +KM     KQ           +T  S  L+        ++ P  
Sbjct: 117 LEEGGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPKF 176

Query: 159 ELTNS--------------VSWRPEGIKYKKNEAFLDVIESINMLMTQQGQVLRSEILGT 204
              N+              +SWRP GIKYKKNE  L+V E I++L+++ G +L+S + GT
Sbjct: 177 LTRNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDGT 236

Query: 205 VKVRSRLSGMPDLKLGLNDK-----GIFTTNDQEDSPEPVVSSKKKNSNIELEDLKFHQC 259
           + + + LSGMP  + GLND      G  + ++ ED        K     + LED KFHQC
Sbjct: 237 IDLTTHLSGMPICQFGLNDSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQC 296

Query: 260 VRLSKFENEKIITFIPPDGEFDLMTY----RLSTPIK--PLIWCDVKVQVHSGSRIEIHC 313
           V L KF  +++I F+PPDG  +LM Y     L+ P K  P++       +  G+ I+   
Sbjct: 297 VSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIV-----TSIGRGNTIDYRV 351

Query: 314 RAKAQIKKKSVANNVEILIPIPEDADSPTFKYSRGNIKWVPEKNAILWKFSSFQGGKEYS 373
             K+    K  A +V + IP+P          S G  K+VPE++A++WKF+ + G  E +
Sbjct: 352 TLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLTENT 411

Query: 374 MAAQLGLPSVSDAEPPKLKR----PVQIKFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWV 429
           ++A + +PS SD     +++    P+ + F+I  F+ SG+ VRY K+ +   +Y +  W+
Sbjct: 412 LSA-VTVPS-SDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAKWI 469

Query: 430 RYITQSGDDYTIR 442
           +YI++SG  Y IR
Sbjct: 470 KYISKSG-SYEIR 481

>NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {ON}
           Anc_3.165
          Length = 486

 Score =  192 bits (487), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 127/427 (29%), Positives = 211/427 (49%), Gaps = 50/427 (11%)

Query: 63  NDVYVLALTRSVSVNATTMFAFMYKLINXXXXXXXXXXXXSIRDNYIIIYELLDEMMDK- 121
           ++++++A TR+ + N+  ++ F+YKL +             +++ ++I++ELLD M+   
Sbjct: 64  DNLWLVAATRN-NANSAAIWEFLYKL-DSMLIEYGLNKEEYLKEEFMIVHELLDVMLGSC 121

Query: 122 GVPQVTETKMLKQYITQKSFKLTRS----------AKKQKNVARPPTELT---------- 161
           G+P  TE   +   ++ K  KL  +            K  N    P  L           
Sbjct: 122 GIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRNDSSQSHDS 181

Query: 162 ----NSVSWRPEGIKYKKNEAFLDVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDL 217
               N  SWRP+ IK+KKNE  L V E IN+L+ + G +L++ + G++ +++RLSG P  
Sbjct: 182 NFSFNDFSWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTRLSGTPVC 241

Query: 218 KLGLNDKGIFTTNDQEDSPEPVVSSKKKNS-----------------NIELEDLKFHQCV 260
           + GLND     +ND E S     +   K+S                 N+ LED KFHQCV
Sbjct: 242 QFGLNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDCKFHQCV 301

Query: 261 RLSKFENEKIITFIPPDGEFDLMTYRLSTPIK-PLIWCDVKVQVHSGSRIEIHCRAKAQI 319
            L KF+ E+II F+PPDG  +LM Y +   +  P     +     +G  ++     K+  
Sbjct: 302 SLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSVTGDALDYRIALKSLF 361

Query: 320 KKKSVANNVEILIPIPEDADSPTFKYSRGNIKWVPEKNAILWKFSSFQGGKEYSMAAQLG 379
             +  A  V + IP+P          S G  K+VP +NA++WKF+ + G  E +++A + 
Sbjct: 362 PGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYNGLTENTLSA-VT 420

Query: 380 LPS--VSDAEPPKLKR-PVQIKFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWVRYITQSG 436
           +PS  V+     +  R P+ + F+I  F+ SG+ VRY  I E    Y +  W++Y+++SG
Sbjct: 421 VPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQNYKAVKWIKYVSKSG 480

Query: 437 DDYTIRL 443
             Y +R 
Sbjct: 481 -SYEVRF 486

>ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL062C (APM4)
          Length = 492

 Score =  189 bits (481), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 120/419 (28%), Positives = 203/419 (48%), Gaps = 27/419 (6%)

Query: 11  KGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYVQYNDVYVLAL 70
           +G  ++S+    +  +S  E F+   L+      +  P        + +++ +    + +
Sbjct: 11  RGSLIVSKLISGEAKESLSEVFR---LQVINGLEIRSPVLTLGSTTFQHIRTSGGLWMVV 67

Query: 71  TRSVSVNATTMFAFMYKLINXXXXXXXXXXXXSIRDNYIIIYELLDEMMDKGVPQVTETK 130
               + ++  ++ F+Y + N            ++ D++++ YELLD ++D G+PQ TE  
Sbjct: 68  VVRGNADSAAIWEFLYHM-NKLLDAYAINTEEALLDDFMLCYELLDVVLDSGLPQDTELS 126

Query: 131 MLKQYITQK--------------SFKLTRSAKKQKNVARPPTELTNSVSWRPEGIKYKKN 176
            +   +++K              S +L R+  K  +V        +   WR EGIKYKKN
Sbjct: 127 HIVPLLSRKPATGESASGDDFLNSARLRRTGTKNVSVETLDHFSRDVCPWRGEGIKYKKN 186

Query: 177 EAFLDVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLKLGLNDKGIFTTNDQEDSP 236
           E +LDVIE +++L+ + G +L++ + GTV+  + LSGMP    G ND             
Sbjct: 187 EVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLSGMPLCHFGFNDSQSLRQRSPRRQY 246

Query: 237 EPVVSSKKKNSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMTYRLSTPIKPLIW 296
            P V    +  ++ LED KFHQCV+L+KF+ E++I F+PPDGEF+LM Y +   ++P   
Sbjct: 247 APRVFGTDERESVVLEDCKFHQCVQLNKFDQERVIRFVPPDGEFELMKYHIRDDLRPPFK 306

Query: 297 CDVKVQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIPEDADSPTFKYSRGNIKWVPEK 356
               V   +   IE     ++    K  A +VE+ IP P    S     S G  K+VPE+
Sbjct: 307 VTPVVSKVNERSIEYRITLQSLFPTKLSAKDVELYIPAPPYTISAKVNVSCGKCKFVPEE 366

Query: 357 NAILWKFSSFQGGKEYSMAA------QLGLPSVSDAEPPKLKRPVQIKFQIPYFTTSGI 409
           NAI+WK   F G  E +++A      Q     V D  P   + P+ +K +I  F+T+ +
Sbjct: 367 NAIIWKIHKFHGLTENTLSAVTIADEQGHYAQVLDQWP---RPPISMKLEIMMFSTAAL 422

>Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa]
           {ON} complement(103091..104500) [1410 nt, 470 aa]
          Length = 469

 Score =  189 bits (479), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 135/485 (27%), Positives = 235/485 (48%), Gaps = 60/485 (12%)

Query: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60
           M + V     KG+ ++S+  + +  +S  + F+   ++      V  P        + ++
Sbjct: 1   MINGVLVYTGKGELIVSKFSKSNAKRSISDIFR---VQVINNLDVRSPILTLGSTTFHHI 57

Query: 61  QYND---VYVLALTRSVSVNATTMFAFMYKLINXXXXXXXXXXXXSIRDNYIIIYELLDE 117
           + N    ++++A+TRS + N+  ++ F+YK  +            ++++ ++  YELLD 
Sbjct: 58  RSNSRDHLWLVAVTRS-NANSGAIWEFLYKF-DSLLNAFGLDNETTLKEEFMTCYELLDL 115

Query: 118 MMD-KGVPQVTETKMLKQYITQKSF---------------------KLTRSAKKQKNVAR 155
           M++  GVP  TE   +   ++ K                       K      +  +V  
Sbjct: 116 MLNVDGVPLDTELSSVSAKMSTKPLHSINSPSDSSLDNSSSPLSISKFLNRNNRSMSVDT 175

Query: 156 PPTELTNSVSWRPEGIKYKKNEAFLDVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMP 215
             TE +N   WRP GIKYKKNE FL++ E I++L+++   +L++ + GTV + S LSG P
Sbjct: 176 MNTEPSN-YPWRPNGIKYKKNEIFLNINEKISILVSKDETILKAYVDGTVDLTSHLSGTP 234

Query: 216 DLKLGLNDK------GIFTTND-----QEDSPEPVVSSKKKNSNIELEDLKFHQCVRLSK 264
             + GLND         + ++D     Q++ P     +      + LED KFH+CV L K
Sbjct: 235 TCQFGLNDSLSVDEPNYYNSDDNGFRNQQNIPRATAGT------VVLEDCKFHECVSLDK 288

Query: 265 FENEKIITFIPPDGEFDLMTYRLSTPIK-PLIWCDVKVQVHSGSRIEIHCRAKAQIKKKS 323
           F  ++II F+PPDG  +LM Y +   I  P       +   S + ++     K+    K 
Sbjct: 289 FNRDRIIKFVPPDGHIELMKYHVRDNINLPFKVTPNVINSRSRTGLDYRITLKSLFPSKL 348

Query: 324 VANNVEILIPIPEDADSPTFKYSRGNIKWVPEKNAILWKFSSFQGGKEYSMAAQLGLPSV 383
            AN+V + IP+P          S G  ++VPE++ I+WKF+ + G  E  ++A     +V
Sbjct: 349 SANDVVLKIPVPSSTVDCKLNVSNGKCRFVPEESCIIWKFAKYNGLTENKLSAV----TV 404

Query: 384 SDAEPPKL------KRPVQIKFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWVRYITQSGD 437
           S  +  +L      + P+ + F+I  F+ SG+ VRYLKI E   +Y +  W++YI++SG 
Sbjct: 405 SSNDTTQLMLQQWARPPISLDFEIMMFSNSGLVVRYLKIMEKDQKYRTVKWIKYISRSG- 463

Query: 438 DYTIR 442
            Y +R
Sbjct: 464 SYEVR 468

>NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {ON}
           Anc_3.165
          Length = 491

 Score =  187 bits (475), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 129/498 (25%), Positives = 245/498 (49%), Gaps = 64/498 (12%)

Query: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLE----REQESSVMPPCFHHNGIH 56
           M + +    ++G+ ++S+ ++  + +S  + F+  ++     R    ++    FHH    
Sbjct: 1   MINALLIFTARGELVVSKLFKGSMKRSIADIFRIQVINNLDVRSPILTLGSTTFHH---- 56

Query: 57  YMYVQYNDVYVLALTRSVSVNATTMFAFMYKLINXXXXXXXXXXXXSIRDNYIIIYELLD 116
               + ++++++A++R+ +V++  ++ F+YKL +             +++ ++I++ELLD
Sbjct: 57  IKSTRGDNLWIVAVSRN-NVDSAAIWEFLYKL-DSLLDSYGLNHEEYLKEEFMIVHELLD 114

Query: 117 EMM--DKGVPQVTETKMLKQYITQKSFKLTRSAKKQ------------------------ 150
            MM    G+P +TE  ++   ++ K  K    A+                          
Sbjct: 115 VMMCGSGGIPMLTENSLVISRMSVKPSKSILEAQNSGNGSSNTNSNNNNNNVPDLLMSGP 174

Query: 151 KNVARPPTELTNSVS------WRPEGIKYKKNEAFLDVIESINMLMTQQGQVLRSEILGT 204
           K + R    L+  +S      WRP+GI +KKNE  L V E IN+L+++ G VL++ + G+
Sbjct: 175 KLLRRNSASLSQDLSILTDFKWRPKGIVHKKNEVILHVNERINILVSKDGSVLKAYVDGS 234

Query: 205 VKVRSRLSGMPDLKLGLNDKGIFTTNDQE----------------DSPEPVVSSKKKNSN 248
           + + + LSG P  + GLND    +  D +                D  +    S     +
Sbjct: 235 IDLETHLSGTPICQFGLNDSLSVSGVDSDMYGSHNHNHHFGDVNFDKTDKKQLSMASVGS 294

Query: 249 IELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMTYRLSTPIK-PLIWCDVKVQVHSGS 307
           + LED KFHQCV L KF+ ++II F+PPDG  +LM Y +   +  P     +     +G+
Sbjct: 295 VILEDCKFHQCVSLDKFDKDRIIKFVPPDGSMELMKYHVRDNLNLPFKVSPIVTNTRNGT 354

Query: 308 RIEIHCRAKAQIKKKSVANNVEILIPIPEDADSPTFKYSRGNIKWVPEKNAILWKFSSFQ 367
            +E     K+    +  A NV + IP+P +        + G+ K++PE++A++W+F+ F 
Sbjct: 355 ALEYRITMKSLFPGRLSAKNVALHIPVPPNTMDCKINVTNGSCKFIPEESAMIWRFNKFN 414

Query: 368 GGKEYSMAAQLGLPSVSDAEPPK---LKRPVQIKFQIPYFTTSGIQVRYLKIEEPKLQYN 424
           G  E +++A + +P+  + +       K P+ + F+I  F+ SG+ VRY  I E   +Y 
Sbjct: 415 GLTENTLSA-VTIPTKDNTQLSLQQWSKPPMSLDFEILMFSNSGLVVRYFTITERDQKYK 473

Query: 425 SYPWVRYITQSGDDYTIR 442
           +  W++YI++SG  Y IR
Sbjct: 474 AVKWIKYISRSG-SYEIR 490

>TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.165
           YOL062C
          Length = 481

 Score =  187 bits (474), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 132/490 (26%), Positives = 242/490 (49%), Gaps = 58/490 (11%)

Query: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60
           M + V     +G+ L+ + ++  V ++  + F+  ++  +   ++  P        + ++
Sbjct: 1   MINAVMIFTPRGELLVFKVFKSSVKRTISDIFRVQVINND---NIRSPILTLGSTTFHFI 57

Query: 61  QY---NDVYVLALTRSVSVNATTMFAFMYKLINXXXXXXXXXXXXSIRDNYIIIYELLDE 117
           +    + ++++A+TRS + ++  ++ ++YKL N             ++D +I+ +ELLD 
Sbjct: 58  RTTAGSKLWLVAVTRS-NADSGAIWEYLYKL-NSLMEVYGLTHEDILKDEFIVCHELLDI 115

Query: 118 MMD-KGVPQVTETKMLKQYITQKSFK-LTRSAKKQKNVARPPTELTNS------------ 163
            +   G+P  TE   +   +T K  + LT SA +   +A   T L ++            
Sbjct: 116 TLGMNGLPMDTELSSVIGKMTLKPAQVLTSSADRSDILASSVTTLGHNSTPISMPKFLSR 175

Query: 164 ------------------VSWRPEGIKYKKNEAFLDVIESINMLMTQQGQVLRSEILGTV 205
                             + WR   IKYKKNE  ++VIE IN+L+ +   +LR+ + GT+
Sbjct: 176 NSNRSVTQEFESQFSPSNIPWRSRDIKYKKNEMIVNVIEKINVLVGKDDNILRAYVDGTI 235

Query: 206 KVRSRLSGMPDLKLGLND--------KGIFTTNDQEDSPE--PVVSSKKKNSNIELEDLK 255
            + + LSGMP  ++G+ND           +T  D+  + +  P VS  +    + LE  K
Sbjct: 236 DITAHLSGMPMCQIGMNDLSTIQGGENAHWTNEDRASNRDAMPDVSGDR----VILEGSK 291

Query: 256 FHQCVRLSKFENEKIITFIPPDGEFDLMTYRLSTPIKPLIWCDVKVQVHS-GSRIEIHCR 314
           FHQCV L K+  + +I FIPPDG+F+LM Y +S  +        +V + S G+ +    +
Sbjct: 292 FHQCVALDKYNKDNVIWFIPPDGQFELMKYHVSNNLNLPFRITPQVTLTSHGTALSYAIK 351

Query: 315 AKAQIKKKSVANNVEILIPIPEDADSPTFKYSRGNIKWVPEKNAILWKFSSFQGGKEYSM 374
            K+   +K  A NV + IP+P          S G  K++PE+N ++W F  F G  E  +
Sbjct: 352 LKSLFPRKLSAENVVLRIPVPPGTLDCKINASDGKCKFIPEENCMVWSFHRFNGSTENHL 411

Query: 375 AAQ-LGLPSVSDAEPPKLKR-PVQIKFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWVRYI 432
            AQ +   S++     +  R P+ + F++  F+ +G+ VRYLK++E  + YN+  W++YI
Sbjct: 412 NAQTVPTQSIASQSIKQWTRPPMSLDFKVLMFSNTGLIVRYLKVQEKNMHYNTIKWIKYI 471

Query: 433 TQSGDDYTIR 442
           + +G  Y +R
Sbjct: 472 SAAG-SYEVR 480

>ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 476

 Score =  186 bits (472), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 138/492 (28%), Positives = 237/492 (48%), Gaps = 67/492 (13%)

Query: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLE----REQESSVMPPCFHH---N 53
           M + +    ++G+ ++S+ + + + +S  + F+  ++     R    ++    FHH   N
Sbjct: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60

Query: 54  GIHYMYVQYNDVYVLALTRSVSVNATTMFAFMYKLINXXXXXXXXXXXXSIRDNYIIIYE 113
           G        + ++++ ++R+ + N+  ++ F+YK  N             ++++++I YE
Sbjct: 61  G-------SDSLWIVTVSRT-NANSGAIWEFLYKF-NAILDAYDLTKEEKLKEDFMICYE 111

Query: 114 LLDEMMDKG-VPQVTETKMLKQYITQKSFKL--TRSAKKQKNVARPP------------- 157
           +LD ++  G +P  TE   +   I+ K  K   T S  K   VA  P             
Sbjct: 112 ILDVVIGAGGIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPK 171

Query: 158 --------------TELTNSVSWRPEGIKYKKNEAFLDVIESINMLMTQQGQVLRSEILG 203
                         T   ++  WRP GIKYKKNE FL V E IN+L+++ G +L++ + G
Sbjct: 172 FLTRNNRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDG 231

Query: 204 TVKVRSRLSGMPDLKLGLNDK-----GIFTTNDQEDSPEPVVSSKKKNSNIELEDLKFHQ 258
           T+ + + LSG P  + GLND      G     D ++        K    ++ LED KFHQ
Sbjct: 232 TIDMTTHLSGTPICQFGLNDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQ 291

Query: 259 CVRLSKFENEKIITFIPPDGEFDLMTY----RLSTPIKPLIWCDVKVQVHSGSRIEIHCR 314
           CV L KF  E+II F+PPDG  +LM Y     L+ P K        V    GS +E    
Sbjct: 292 CVSLDKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKI-----TPVVTPCGSTVEYRIT 346

Query: 315 AKAQIKKKSVANNVEILIPIPEDADSPTFKYSRGNIKWVPEKNAILWKFSSFQGGKEYSM 374
            K+    K  A +V + IP+P          S G  K+  E+NA++W+F+ + G  E ++
Sbjct: 347 LKSLFPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENTL 406

Query: 375 AAQLGLPSVSDAEPPKLKR----PVQIKFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWVR 430
           +A + +P+ SD     L++    P+ + F+I  F+ SG+ VRY ++ +   +Y    W++
Sbjct: 407 SA-VTVPT-SDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIK 464

Query: 431 YITQSGDDYTIR 442
           YI++SG  Y +R
Sbjct: 465 YISKSG-SYEVR 475

>Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  184 bits (467), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 141/503 (28%), Positives = 245/503 (48%), Gaps = 74/503 (14%)

Query: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLE----REQESSVMPPCFHHNGIH 56
           M S V    S+G+ +L++ +++ + +S  + F+  ++     R    ++    FHH  I 
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHH--IR 58

Query: 57  YMYVQYNDVYVLALTRSVSVNATTMFAFMYKLINXXXXXXXXXXXXSIRDNYIIIYELLD 116
            M  + ++++++ +TRS + N+  ++ F+YKL +            ++++ ++I++E+LD
Sbjct: 59  SM--RGDNLWLVTITRS-NANSAAIWEFLYKL-DSVMNAYRLDREEALKEEFMIVHEMLD 114

Query: 117 EMMD-KGVPQVTETKMLKQYITQKSFKLTRSA---------------------------- 147
            M+   G+P  TE   L   I Q S K  R+                             
Sbjct: 115 IMLGGNGIPIDTE---LNSVIAQMSVKPIRNVGGLLESPDSIDMLSSTSSPSSVGGELHF 171

Query: 148 ----KKQKNV------ARPPTELTNSVSWRPEGIKYKKNEAFLDVIESINMLMTQQGQVL 197
               KK+ +       +       N ++WRP+GI +KK+E FL V E +N+L+++ G +L
Sbjct: 172 PKFLKKRSSSFLGQGDSHSDFSDGNKIAWRPKGIIHKKDEVFLYVNERMNILVSRDGSIL 231

Query: 198 RSEILGTVKVRSRLSGMPDLKLGLNDKGIFTTNDQED--SPEPVVSS----------KKK 245
           +S + GT+ + + LSG P  + GLND     + DQE+  S +   S           K  
Sbjct: 232 KSYVDGTIDITTHLSGTPVCRFGLNDSLGMQSEDQENWLSQQDQHSHNGFENKNCFPKAA 291

Query: 246 NSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMTYRLSTPIKPLIWCDVKVQVHS 305
             ++ LED KFH+CV + KF    II F+PPDG  +LM Y +   I  L +    +  HS
Sbjct: 292 AGSVLLEDCKFHECVSIDKFNKNHIIEFVPPDGSMELMKYHVRDNIN-LPFKITPIVAHS 350

Query: 306 GSRIEIHCRA--KAQIKKKSVANNVEILIPIPEDADSPTFKYSRGNIKWVPEKNAILWKF 363
               E+  R   K+    K  A +V + IP+P          S GN K+VPE+NA++W+F
Sbjct: 351 ARDNEVDYRITLKSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGNCKFVPEENAMIWRF 410

Query: 364 SSFQGGKEYSMAAQLGLPSVSDAEPPKLKR----PVQIKFQIPYFTTSGIQVRYLKIEEP 419
           + F G  E +++A     S SD     L++    P+ + F++  F+ SG+ VRY  I   
Sbjct: 411 NKFNGLTENTLSAV--TVSTSDTTQLSLQQWTRPPMSLDFEVMMFSNSGLVVRYFTISSR 468

Query: 420 KLQYNSYPWVRYITQSGDDYTIR 442
             ++ +  W++YI++SG  Y +R
Sbjct: 469 DSKHRAVKWIKYISKSG-SYEVR 490

>YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON}
           APM4Mu2-like subunit of the clathrin associated protein
           complex (AP-2); involved in vesicle transport
          Length = 491

 Score =  180 bits (457), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 138/504 (27%), Positives = 240/504 (47%), Gaps = 76/504 (15%)

Query: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLE----REQESSVMPPCFHHNGIH 56
           M S V    S+G+ +L++ +++ + +S  + F+  ++     R    ++    FHH    
Sbjct: 1   MISGVLVYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHH---- 56

Query: 57  YMYVQYND-VYVLALTRSVSVNATTMFAFMYKLINXXXXXXXXXXXXSIRDNYIIIYELL 115
            +  ++ D ++++ +TRS + N+  ++ F+YKL +            ++++ ++I++E+L
Sbjct: 57  -IRSRHGDNLWLVTITRS-NANSAAIWEFLYKL-DAVMNAYRLDREEALKEEFMIVHEML 113

Query: 116 DEMMD-KGVPQVTETKMLKQYITQKSFKLTRS-------------------AKKQKNVAR 155
           D M+   G+P  TE   L   I Q S K  R+                            
Sbjct: 114 DIMLGGNGIPIDTE---LNSVIAQMSVKPVRNMGGLLDSPDGNDVLSSSSSPTSSAGELH 170

Query: 156 PPTELT-------------------NSVSWRPEGIKYKKNEAFLDVIESINMLMTQQGQV 196
            P  LT                   N ++WRP+GI +KK+E FL V E IN+L+++ G +
Sbjct: 171 FPKFLTKRSSSFLGQGDSTSDFYDNNKITWRPKGIIHKKDEVFLYVNERINILVSRDGSI 230

Query: 197 LRSEILGTVKVRSRLSGMPDLKLGLNDKGIFTTNDQE------------DSPEPVVSSKK 244
           L+S + GT+ + + LSG P  + GLND     + D++            D        K 
Sbjct: 231 LKSYVDGTIDITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQRHSGSDFGNKNFIPKA 290

Query: 245 KNSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMTYRLSTPIKPLIWCDVKVQVH 304
              ++ LED KFH+CV L KF    II F+PPDG  +LM Y +   I  L +    +  H
Sbjct: 291 AAGSVLLEDCKFHECVSLDKFNRNHIIEFVPPDGSMELMKYHVRDNIN-LPFKVTPIVTH 349

Query: 305 SGSRIEIHCRA--KAQIKKKSVANNVEILIPIPEDADSPTFKYSRGNIKWVPEKNAILWK 362
           S    EI  R   K+    K  A +V + IP+P          S G+ K+VPE+NA++W+
Sbjct: 350 STRDNEIDYRITLKSLFPGKLSAKDVVLHIPVPPSTVDCKISVSNGHCKFVPEENAMIWR 409

Query: 363 FSSFQGGKEYSMAAQLGLPSVSDAEPPKLKR----PVQIKFQIPYFTTSGIQVRYLKIEE 418
           F+ + G  E +++A     S SD     L++    P+ ++F++  F+ SG+ VRY  I  
Sbjct: 410 FNKYNGLTENTLSAV--TVSTSDTTQLNLQQWTRPPISLEFEVMMFSNSGLVVRYFTISG 467

Query: 419 PKLQYNSYPWVRYITQSGDDYTIR 442
              ++ +  W++YI+++G  Y +R
Sbjct: 468 KDSKHRAVKWIKYISKAG-SYEVR 490

>ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHL019C (APM2)
          Length = 498

 Score =  179 bits (453), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 127/465 (27%), Positives = 206/465 (44%), Gaps = 100/465 (21%)

Query: 48  PCFHHNGIHYMYVQYNDVYVLALTRSV-SVNATTMFAFMYKLINXXXXXXXXXXXXS-IR 105
           P   H G  Y+Y+Q + +Y L+L+  V +V   T+FA++ +L                I 
Sbjct: 41  PVLSHRGYDYIYIQRDGLYFLSLSYGVETVVPMTVFAYLGQLYQLFKKYLGERLNRQLIM 100

Query: 106 DNYIIIYELLDEMMDKGVPQVTETKMLKQYITQKSFKLTRS--------------AKKQK 151
           DN+ ++YEL+DE +D G+PQ+T+  +++ Y+  +  +                  A K++
Sbjct: 101 DNFHLVYELMDESIDMGIPQLTDHNIIRDYVKVQVVRRAEDGEKHAGKHKAKRDKAGKEE 160

Query: 152 NVARPPTE------------LTNSVSWRPEGIKYKKNEAFLDVIESINMLMT-QQGQVLR 198
             A P                T+++SWRP GI Y KNE FLDV+E +  LM  ++ QV  
Sbjct: 161 EEADPGAADEHFMNSYIAKTTTSAISWRPRGIYYSKNEFFLDVVEELEYLMDFERAQVRL 220

Query: 199 SEILGTVKVRSRLSGMPDLKLGLNDKGIFTTNDQEDSPEPVVSSKKKNSNIELEDLKFHQ 258
           +++ G +  RS LSGMP L +GLN              + V   +   S +      FHQ
Sbjct: 221 NQVHGAINCRSYLSGMPQLTVGLN--------------KMVAQDRDFTSQVH-----FHQ 261

Query: 259 CVRLSKFENEKIITFIPPDGEFDLMTYRLS-----TPIKPLIWCDVKVQVH----SGSRI 309
           CV L +   ++ ITF+PPDGEF L  Y+L+      P+  L  C   V+         R+
Sbjct: 262 CVDLERLATDRHITFVPPDGEFQLCHYKLARGANEQPLIKLEECRAAVKPRRRPADADRL 321

Query: 310 EIHCRAKAQIKKKSVANNVEILIPIPEDADS--------PTFKYSRGNIKWVPEKNAILW 361
            +        K +   + +++ +P+    +         P FK   G + +    + +LW
Sbjct: 322 VLTVSISTNFKLQDATSVLKVRVPLARVFEQWKVDLSFPPRFKCDAGCVMFNITDDYLLW 381

Query: 362 ---KFSSFQGGKEYSMAAQLGL----------PSVSDAEPPKLKRPVQ------------ 396
              K     G + ++M +Q  L            +S +  P    P Q            
Sbjct: 382 DIGKAKGSHGDRRFTMQSQFHLYDEAYYSRRRAQLSTSMDPLPAHPGQQLEALYNQTHAS 441

Query: 397 ----------IKFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWVRY 431
                     + F++PY T SG++V +LKI EP+LQY S+PW+RY
Sbjct: 442 APTHASALLRVDFEVPYHTISGLKVEFLKILEPQLQYQSFPWIRY 486

>Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C
           (APM2) - Similiar to clathrin coat proteins [contig 55]
           FULL
          Length = 505

 Score =  177 bits (450), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 146/531 (27%), Positives = 248/531 (46%), Gaps = 114/531 (21%)

Query: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60
           M+S +   D +  PL+ + ++   S    E+F +   E  + S+V  P  +H GI ++ +
Sbjct: 1   MSSSIFLLDEQLNPLIVKSFK---SVQHPEAFAYRFKEVYKVSNV--PVIYHKGIVFISI 55

Query: 61  QYNDVYVLALT----RSVSVNATTMFAFMYKLINXXXXXXXXXXXXSIRDNYIIIYELLD 116
             + +Y ++++    RS S+ +T ++   + ++              I DN+ +IYELLD
Sbjct: 56  CRDGLYFVSMSVGSLRS-SIMSTLVYLNDFHMLLKKYLRVNALDRTRIVDNFNLIYELLD 114

Query: 117 EMMDKGVPQVTETKMLKQYI-TQKSF----KLTRS-------AKKQKNVARPPTE----- 159
           E +D G+PQ+T+  +++  I  Q +     K+ RS        +++ NVA    +     
Sbjct: 115 ESLDFGIPQLTDFNIIRDSIKIQPNIPPDPKIARSNSDDDESEQEESNVAETQEKSNKHG 174

Query: 160 ---------------LTNSVSWRPEGIKYKKNEAFLDVIESINMLMT-QQGQVLRSEILG 203
                           T ++SWRP+GI Y KNE F+DVIES   +M  +  QV ++ I G
Sbjct: 175 FQDDEEYINSFVLRTTTQAISWRPKGIYYAKNELFVDVIESQAYVMDFKHHQVRKNFIFG 234

Query: 204 TVKVRSRLSGMPDLKLGLNDKGIFTTNDQEDSPEPVVSSKKKNSNIELEDLKFHQCVRLS 263
            +  RS LSGMP +K+ +N                      K+ +  L   KFHQCV L 
Sbjct: 235 RIICRSYLSGMPVVKICIN-------------------KMLKDRDQFLSSAKFHQCVSLE 275

Query: 264 KFENEKIITFIPPDGEFDLMTYRL-----STPIKPLIWCDVKVQVHSGSRIEIHCRAKAQ 318
              ++  I FIPPDG+F L  Y++      +P+  LI   V V+     +++I  + +  
Sbjct: 276 SLSSQDFIEFIPPDGDFQLCEYKIKRHISDSPVIKLIEYKV-VEKPKKHKLQISMKIQPH 334

Query: 319 IKKKSVANNVEILIPIPEDADS--------PTFKYSRGNIKWVPEKNAILWKFSSFQGGK 370
            K ++ A  ++I +PI +  ++        P FK   G+I +      +LWK +  +GG 
Sbjct: 335 FKAQNSATFLDIRVPIQDIFETYKIDLTKQPRFKCDFGSILFNLSDGYLLWKANGMKGGH 394

Query: 371 E---YSMAAQLGLPSV-----------SDAEPPKLKRPVQI------------------- 397
               +SM  +  L              +  +PP L+  V++                   
Sbjct: 395 GETYHSMQVEFFLFDAEAHRKEAEELKNSMDPPPLREGVRMEELYALAHEEKGQINNPVR 454

Query: 398 -----KFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWVRYITQSGDDYTIRL 443
                +F++PYFT+SG++V YLKIEE +LQY S+PWVRY T +  +Y  ++
Sbjct: 455 NMITAEFEVPYFTSSGLRVEYLKIEEEQLQYQSFPWVRYKTINDTEYAFQM 505

>Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  176 bits (445), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 136/504 (26%), Positives = 239/504 (47%), Gaps = 76/504 (15%)

Query: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLE----REQESSVMPPCFHHNGIH 56
           M S V    S+G+ +L++ +++ + +S  + F+  ++     R    ++    FHH    
Sbjct: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHH---- 56

Query: 57  YMYVQYND-VYVLALTRSVSVNATTMFAFMYKLINXXXXXXXXXXXXSIRDNYIIIYELL 115
            +  ++ D ++++ +TRS + N+  ++ F+YKL +            ++++ ++I++E+L
Sbjct: 57  -IRSRHGDNLWLVTITRS-NANSAAIWEFLYKL-DFVMNAYRLDREEALKEEFMIVHEML 113

Query: 116 DEMMD-KGVPQVTETKMLKQYITQKSFK-------------------------------- 142
           D M+   G+P  TE   L   I Q S K                                
Sbjct: 114 DIMLGGNGIPIDTE---LNSVIAQMSVKPVRNTGGLLDSPDGNDMLSSSSSPSSVSGELH 170

Query: 143 ----LTRSAKKQKNVARPPTEL--TNSVSWRPEGIKYKKNEAFLDVIESINMLMTQQGQV 196
               L +S+          ++    N ++WRP+GI +KK+E FL V E +N+L+++ G +
Sbjct: 171 FPKFLKKSSSSFLGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSI 230

Query: 197 LRSEILGTVKVRSRLSGMPDLKLGLNDKGIFTTND-------QEDSPEPVVSSKK----- 244
           L+S + GT+ + + LSG P  + GLND     + D       Q+        SK      
Sbjct: 231 LKSYVDGTIDITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKA 290

Query: 245 KNSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMTYRLSTPIKPLIWCDVKVQVH 304
              ++ LED KFH+CV L KF     I F+PPDG  +LM Y +   I  L +    +  H
Sbjct: 291 AAGSVLLEDCKFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNIN-LPFKITPIVTH 349

Query: 305 SGSRIEIHCR--AKAQIKKKSVANNVEILIPIPEDADSPTFKYSRGNIKWVPEKNAILWK 362
           S    EI  R   K+    K  A +V + IP+P          S G+ K+VPE+NA++W+
Sbjct: 350 STRDNEIDYRITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWR 409

Query: 363 FSSFQGGKEYSMAAQLGLPSVSDAEPPKLKR----PVQIKFQIPYFTTSGIQVRYLKIEE 418
           F+ + G  E +++A     S SD     L++    P+ + F++  F+ SG+ VRY  I  
Sbjct: 410 FNKYNGLTENTLSAV--TVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFG 467

Query: 419 PKLQYNSYPWVRYITQSGDDYTIR 442
              ++ +  W++YI++SG  Y +R
Sbjct: 468 KDSKHRAVKWIKYISRSG-SYEVR 490

>KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]
           {ON} some similarities with uniprot|P38700 Saccharomyces
           cerevisiae YHL019C APM2 homologous to the medium chain
           of mammalian clathrin-associated protein complex Similar
           to clathrin coat proteins
          Length = 507

 Score =  175 bits (444), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 145/529 (27%), Positives = 239/529 (45%), Gaps = 118/529 (22%)

Query: 1   MASYVAFCDSKGKPLLSR-----RYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGI 55
           M+S     D   +PL+ R      + DD       + +H             P F  NG 
Sbjct: 1   MSSCFLLLDETYEPLIRRALRPIHFLDDAILQLQNNLKH-------HKGCTKPIFEGNGW 53

Query: 56  HYMYVQYNDVY---VLALTRSVS-VNATTMFAFMYKLINXXXXXXXXXXXXSIRDNYIII 111
           HY  +  +++Y   ++ +  SVS ++       +Y+L              ++RDN+ +I
Sbjct: 54  HYAVITRDNLYFAMIMQVNNSVSPISVLHYLDEIYQLCRKFMGMKLNKL--NVRDNFHLI 111

Query: 112 YELLDEMMDKGVPQVTETKMLKQYITQKSFKLTRSAKKQKNVAR--PPTE---------- 159
           +E+++E  D G+ QVT   ++  +I  +  K    ++   +     PP +          
Sbjct: 112 FEVIEESSDYGIIQVTNYNIIHDFIKVEVIKPDDDSENTASEKHELPPGDQDETFINSYI 171

Query: 160 ---LTNSVSWRPEGIKYKKNEAFLDVIESINMLMTQQGQVLRSEIL-GTVKVRSRLSGMP 215
              +T++VSWRP+GI Y KNE FLDVIE +  +M  +  V+R+ ++ GT+  RS LSGMP
Sbjct: 172 LRTMTSAVSWRPKGIHYGKNEFFLDVIEKLEFIMDFEEGVVRNNVINGTIICRSYLSGMP 231

Query: 216 DLKLGLNDKGIFTTNDQEDSPEPVVSSKKKNSNIELEDLKFHQCVRLSKF--ENEKIITF 273
            L +GLN                     +KN +  ++ LKFH+CV L     E   +I F
Sbjct: 232 QLSIGLN------------------KLMQKNVHF-MKRLKFHECVDLHTLIKEESPVIKF 272

Query: 274 IPPDGEFDLMTYRLSTPI--KPLI-----WCDVKVQVHSGSRIEIHCRAKAQIKKKSVAN 326
           IPPDGEF+L  Y+L+ P+  +P+I         K + +  ++ ++  +A      K+  +
Sbjct: 273 IPPDGEFELCNYKLNRPLLDEPVIKLQSFGLSQKPRKNQETQDKLLLKAAITTHFKAQDS 332

Query: 327 NVEILIPIP----------EDADSPTFKYSRGNIKWVPEKNAILWKFSSFQGG---KEYS 373
             E+LI IP          +    P FK   G++ +     +I+WK ++ +GG   K Y 
Sbjct: 333 AKELLIKIPIKSVIRKWNIDLEKPPLFKSDIGDVVFDITAGSIIWKINNLKGGHGNKNYG 392

Query: 374 M-------------AAQLGLPSVSDAEP----PKLKR----------------------- 393
           +             A ++ L +  D  P    PKL+R                       
Sbjct: 393 LKCMFEIWDRQIHEALEVQLRNSMDPPPLRTGPKLERIWDQYHGKTTEYDGNENQKEDVD 452

Query: 394 ---PVQIKFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWVRYITQSGDDY 439
               + + F+IPY+  SG++V Y KIEEP+L Y S+PWVRY T + ++Y
Sbjct: 453 KFALIAMSFEIPYYAVSGLKVEYFKIEEPQLNYQSFPWVRYKTVNDNEY 501

>Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  172 bits (435), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 132/506 (26%), Positives = 240/506 (47%), Gaps = 80/506 (15%)

Query: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLE----REQESSVMPPCFHHNGIH 56
           M S V    S+G+ +L++ +++ + +S  + F+  ++     R    ++    FHH    
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHH---- 56

Query: 57  YMYVQYND-VYVLALTRSVSVNATTMFAFMYKLINXXXXXXXXXXXXSIRDNYIIIYELL 115
            +  ++ D ++++ +TRS + N+  ++ F+YKL +            ++++ ++I++E+L
Sbjct: 57  -IRSKHGDNLWLVTITRS-NANSAAIWEFLYKL-DAVMNAYRLDREEALKEEFMIVHEML 113

Query: 116 DEMMD-KGVPQVTETKMLKQYITQKSFKLTRSAKKQKNVARPPTEL-------------- 160
           D M+   G+P  TE   L   + + S K  R+     + A     L              
Sbjct: 114 DIMLGGNGIPIDTE---LNSVVARMSVKPMRNTGGLLDGADGSDILSSSSSPSSAGGELH 170

Query: 161 ------------------------TNSVSWRPEGIKYKKNEAFLDVIESINMLMTQQGQV 196
                                   +N ++WR  GI +KK+E FL V E +N+L+++ G +
Sbjct: 171 FPKFLKKSSSSFLGQGDSTSDFYDSNKITWRATGIIHKKDEVFLYVNERMNILVSRDGSI 230

Query: 197 LRSEILGTVKVRSRLSGMPDLKLGLNDKGIFTTNDQE------------DSPEPVVSSKK 244
           L+S + GT+ + + L+G P  + GLND     + D++            D        K 
Sbjct: 231 LKSYVDGTIDIVTHLNGTPVCRFGLNDSLGMQSEDEKNWLAQQHQHSRSDFGNKNFLPKA 290

Query: 245 KNSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMTYRLSTPIKPLIWCDVKVQVH 304
              ++ LED KFH+CV + KF    II FIPPDG  +LM Y +   I  L +    +  H
Sbjct: 291 AAGSVLLEDCKFHECVSIEKFNKNHIIEFIPPDGSMELMKYHVRDNIN-LPFKITPIVSH 349

Query: 305 SGSRIEIHCRA--KAQIKKKSVANNVEILIPIPEDADSPTFKYSRGNIKWVPEKNAILWK 362
           S    EI  R   K+    K  A +V + IP+P          S G+ K+VPE+NA++W+
Sbjct: 350 STRDNEIDYRITLKSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGHCKFVPEENAMIWR 409

Query: 363 FSSFQGGKEYSMAAQLGLPSVSDAEPPKL------KRPVQIKFQIPYFTTSGIQVRYLKI 416
           F+ + G  E +++A     +VS ++  +L      + P+ + F++  F+ SG+ VRY  I
Sbjct: 410 FNKYNGLTENTLSA----ATVSTSDTTQLSFQQWTRPPMSLDFEVMMFSNSGLVVRYFTI 465

Query: 417 EEPKLQYNSYPWVRYITQSGDDYTIR 442
                ++ +  W++YI++SG  Y +R
Sbjct: 466 SGKDSKHRAVKWIKYISKSG-SYEVR 490

>TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3.165
           YOL062C
          Length = 473

 Score =  166 bits (421), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 117/419 (27%), Positives = 209/419 (49%), Gaps = 52/419 (12%)

Query: 65  VYVLALTRSVSVNATTMFAFMYKLINXXXXXXXXXXXXSIRDNYIIIYELLDEMM-DKGV 123
           ++++A+TRS + N+  ++ F+YKL +             + + +++ YE++D M+    +
Sbjct: 65  LWIVAITRS-NANSGVIWEFLYKL-DSMLTAYDLNNEEKLMEKFMVYYEMIDVMLTSNAM 122

Query: 124 PQVTETKMLKQYITQKSFK-LTRSAKKQKN-----------------VARPPTELTNS-V 164
           P  TE   +   I+ +  K ++ S   +KN                 +++  + +T S +
Sbjct: 123 PINTELSSIASKISYRLPKTISNSPTNEKNNNNGLSIPKFLTRNSRSMSQEFSNITQSDI 182

Query: 165 SWRPEGIKYKKNEAFLDVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLKLGLNDK 224
            WRP GIKYKKNE FL V E IN+L+++   +L++ + G++ + S LSG P  + GLND 
Sbjct: 183 PWRPTGIKYKKNEVFLYVNEKINILVSKDQTILKAYVDGSIDLVSHLSGTPICQFGLNDY 242

Query: 225 GIFTTNDQED----------SPEPVVSSKKKNSNIELEDLKFHQCVRLSKFENEKIITFI 274
              T N+  +            E + + +  +S++++ED  FHQCV L KF +E++I F+
Sbjct: 243 LSMTGNNISNRGDEFRHDFMDDEDLSTGRSSSSSVKIEDCTFHQCVSLDKFNDERLINFV 302

Query: 275 PPDGEFDLMTYRLSTPIKPLIWCDVKVQVHSGSRIEI---HCRAKAQIKKKSV------A 325
           PPDG F+LM Y +          D+ +      R+ I    C  + +I  KS+      A
Sbjct: 303 PPDGSFELMRYHVRD--------DLNIPFKVTPRVSISSSRCSMRYKIILKSLFPTSLSA 354

Query: 326 NNVEILIPIPEDADSPTFKYSRGNIKWVPEKNAILWKFSSFQGGKEYSMAAQLGLPSVSD 385
            +  + IP+P          S G   +    N  +WKF+ ++G  E  +  +    S +D
Sbjct: 355 ADAMLKIPLPPGTVDCKINASSGKCNFSTSDNCAIWKFNKYKGLTENELILETVPSSSTD 414

Query: 386 AEPPK--LKRPVQIKFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWVRYITQSGDDYTIR 442
               +   + P+ + F+I  F+ SG+ V+YLK+ E   +Y    W++Y+++SG  Y IR
Sbjct: 415 ILSLQQWTRPPMSMNFEIIMFSNSGLVVKYLKVMERVQKYRPVKWIKYVSKSG-SYEIR 472

>Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {ON}
           similar to Ashbya gossypii ABR047W
          Length = 501

 Score =  158 bits (400), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 132/485 (27%), Positives = 217/485 (44%), Gaps = 113/485 (23%)

Query: 48  PCFHHNGIHYMYVQYNDVYVLALTRSVS-VNATTMFAFMYKL-INXXXXXXXXXXXXSIR 105
           P   +    Y+++Q + +Y L+L+  ++ V    +F+++ +L +              I 
Sbjct: 41  PILQNMDYDYIFIQRDGLYFLSLSYQLTNVYPMVVFSYLNQLHMLFQKYLGENLNKVLIT 100

Query: 106 DNYIIIYELLDEMMDKGVPQVTETKMLKQYITQKSFK-----LTRSAK------------ 148
            N+ +I+EL+DE +  G PQ+T+  +++ YI  +  K      TR A             
Sbjct: 101 GNFHLIHELIDESIFMGTPQLTDYNIIRDYIKVQVVKDSPEPATREATVTNTKKNKKKDS 160

Query: 149 --------------KQKNVARPPTELTNSVSWRPEGIKYKKNEAFLDVIESINMLMTQQG 194
                             +AR  T   +++SWRP+GI Y KNE +LDVIE +  L+  Q 
Sbjct: 161 KKKEEDTEATDENYMNSYIARTTT---SAISWRPKGIHYNKNEFYLDVIEHLEYLVDFQC 217

Query: 195 QVLRSE-ILGTVKVRSRLSGMPDLKLGLNDKGIFTTNDQEDSPEPVVSSKKKNSNIE--L 251
             ++S  + G ++ RS LSGMP L +GLN                     K NS  E  +
Sbjct: 218 MNIKSNTVYGYIQCRSYLSGMPMLTIGLN---------------------KLNSENEYFM 256

Query: 252 EDLKFHQCVRLSKFENEKIITFIPPDGEFDLMTYRLST-----PIKPLIWCDVKVQVHSG 306
               FHQCV L +   +K+I+F PPDGEF L  Y+L+      P+  L  C VK++    
Sbjct: 257 RRANFHQCVNLDQLTTDKLISFTPPDGEFQLCNYKLTRNMSDPPMIKLEDCKVKLKPRKT 316

Query: 307 ----SRIEIHCRAKAQIKKKSVANNVEILIPIPE-----DAD---SPTFKYSRGNIKWVP 354
                R+ +        K +   + + I +P+ +     D D    P FK  +G + +  
Sbjct: 317 KDGLDRLILAVTISTYFKLQDSTSLLNIKVPLSKVFRDWDVDLSYQPRFKCEQGKVMFNI 376

Query: 355 EKNAILWKFSSFQGG----------------KEYSMAAQLGLPSVSDAEP----PKLKRP 394
             + +LW+    +GG                +E+    +  L +  D +P    P L++ 
Sbjct: 377 TDDYLLWEVGKVKGGHGDKTLKMQSEFHLHNREHEARIKQQLSNSMDPKPIRRGPHLEKL 436

Query: 395 VQ----------------IKFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWVRYITQSGDD 438
            Q                ++F+IPY+T SG++V +LKIEE +LQ+ S+PWVRY T + D 
Sbjct: 437 YQQTHELNSPTSEAALLKVEFEIPYYTISGLKVEFLKIEEKQLQFQSFPWVRYKTINHDI 496

Query: 439 YTIRL 443
           Y  +L
Sbjct: 497 YAYQL 501

>KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 504

 Score =  157 bits (398), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 136/530 (25%), Positives = 229/530 (43%), Gaps = 113/530 (21%)

Query: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60
           M+S V   D +  PL+ R    ++   A   +  L  +R    S   P  +  GI Y+Y+
Sbjct: 1   MSSCVFILDEQLNPLILR----NLKSIAHPEWYALYFKRVHPQS-RGPVIYSKGIIYIYI 55

Query: 61  QYNDVYVLALTRS-VSVNATTMFAFM--YKLINXXXXXXXXXXXXSIRDNYIIIYELLDE 117
             + +Y ++++   +  N   + A++  +  +              I DN+ +IYEL DE
Sbjct: 56  LRDGLYFVSVSNGGLRFNLMGILAYLNDFHALLVKYLKVNKVDRTGIIDNFNLIYELFDE 115

Query: 118 MMDKGVPQVTETKMLKQYI-----------------TQKSFKLTRSAKKQKNVA-----R 155
            +D G+PQ+T+  +++  I                  ++S      +K+ K+ A     R
Sbjct: 116 SLDYGIPQLTDYNIIRDSIKIEANVPKVPSNSQADSDEESGPEILQSKENKDKADIHGFR 175

Query: 156 PPTELTNS---------VSWRPEGIKYKKNEAFLDVIESINMLMT-QQGQVLRSEILGTV 205
              +  NS         +SWRP+GI Y KNE F+D+IE  + LM  +  QV ++ + G +
Sbjct: 176 DDEQYINSFVLRTTTQAISWRPKGIYYTKNELFVDIIERQSYLMDFKNSQVRQTFVYGKI 235

Query: 206 KVRSRLSGMPDLKLGLNDKGIFTTNDQEDSPEPVVSSKKKNSNIELEDLKFHQCVRLSKF 265
             RS LSGMP +++ +N                      K+ ++ L   KFHQCV L   
Sbjct: 236 NCRSYLSGMPIVRVCIN-------------------KMLKDKDLFLGSSKFHQCVSLESL 276

Query: 266 ENEKIITFIPPDGEFDLMTYRL-----STPIKPLIWCDVKV-QVHSGSRIEIHCRAKAQI 319
            ++  I FIPPDG+F L  Y+L      +PI  LI  D K+ +     R+ +    +   
Sbjct: 277 SSQDYIEFIPPDGDFQLCEYKLKRHINDSPIIKLI--DYKINERQKKHRLHLSVTIQPHF 334

Query: 320 KKKSVANNVEILIPIP--------EDADSPTFKYSRGNIKWVPEKNAILWKFSSFQGGK- 370
           K ++ A  ++I IP          +   +P FK   G++ +      +LW     +GG  
Sbjct: 335 KAQNSATALKIHIPTRDLFQNYKIDLTKAPRFKCDHGSVFFNLSDELLLWDAQGIKGGHG 394

Query: 371 --EYSMAAQLGLPSVSD-----------AEPPKLKRPVQI-------------------- 397
              YSM  +  L    +            +PP L+    +                    
Sbjct: 395 ETSYSMHVEFALFDEEEHARKLEQIKKSMDPPPLREGAHLEELYAQVKSNKEGKGQFQSN 454

Query: 398 ----KFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWVRYITQSGDDYTIRL 443
               +F++PY+T+SG++V YLKI E  L+Y S+ WVRY T +  +Y  ++
Sbjct: 455 AITAEFEVPYYTSSGLRVEYLKISEENLKYQSFSWVRYKTINDTEYAYQV 504

>TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON}
           Anc_2.555 YHL019C
          Length = 525

 Score =  154 bits (389), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 145/552 (26%), Positives = 232/552 (42%), Gaps = 144/552 (26%)

Query: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMP---PCFHHNGIHY 57
           M+S +   D   +PL+S+  +      A+ + Q +L  R  +S   P   P    +  H+
Sbjct: 1   MSSCIFITDENLEPLISKNIK------AIPNLQGIL--RLFKSVYTPESQPVISASSFHF 52

Query: 58  MYVQYNDVYVLALTRSVSVNATTM----FAFMYKLINXXXXXXXXXXXXSIRDNYIIIYE 113
           ++++ + +  +++  +   +A  M    F   +  +              + DN ++I E
Sbjct: 53  VHIKRSSLLYVSVIHAYDASANVMLIATFLDQFHSLLKKYLAVSALDKNMVLDNVLLIME 112

Query: 114 LLDEMMDKGVPQVTETKMLKQYITQKS--------------------------------- 140
           L+DE +D GV Q+T+  +++ YI  K                                  
Sbjct: 113 LIDESIDFGVIQITDASIMRDYIRVKVNMPENKTIDDLSLGDSDTDEEDNKKTKRRSGKP 172

Query: 141 --FKLTRSAK------KQKNVARPPTELTNS------------VSWRPEGIKYKKNEAFL 180
             +K  R AK      +  + A    ++ +S            VSWR +GI Y +NE FL
Sbjct: 173 NLYKFLRGAKDGTHKAEHTDTAAKEDDVEDSYNSYIAKATIMPVSWRAKGIHYARNEFFL 232

Query: 181 DVIESINMLMT-QQGQVLRSEILGTVKVRSRLSGMPDLKLGLNDKGIFTTNDQEDSPEPV 239
           DV+E +  LM    G + ++ I G +  +S LSGMP LK+  N         Q+D  E  
Sbjct: 233 DVVEQVQYLMDFNSGIIKKNLIHGKIICKSYLSGMPKLKIAFNKLS------QKD--EQF 284

Query: 240 VSSKKKNSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMTYRL-----STPIKPL 294
           +S  K           FHQCV      NEK I FIPPDG+F L  Y L       P+  L
Sbjct: 285 ISHSK-----------FHQCVTWPS-SNEKEIEFIPPDGDFVLCQYELKRHVKDQPMLKL 332

Query: 295 IWCDVKVQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIPE-------DADSPT-FKYS 346
           +   VK ++    +I++ C  +   K ++  + + + IP+         D   P  FK  
Sbjct: 333 VSFGVKPKLKK-YKIQMSCTIETHFKARNSTSTLNLKIPLARLFQEYQIDLKKPARFKSD 391

Query: 347 RGNIKWVPEKNAILWKFSSFQGGK---EYSMAAQLGL-------------------PSVS 384
            G + +    + +LW     +GG    + SMAA+  L                   P + 
Sbjct: 392 SGKVLFNISDDFLLWDIEVMKGGHGDTQLSMAAEFSLFNKKEFEEEQEELKNSMNPPPLR 451

Query: 385 DAEPPKLK-----------------RPVQIKFQIPYFTTSGIQVRYLKIEEPKLQYNSYP 427
           D   PKL+                 R + +KF+IPY T SG+QV YLKI+E +LQY S+P
Sbjct: 452 DG--PKLEELYDQVHNEKGPSKMASRLLSMKFEIPYSTCSGLQVEYLKIDEEQLQYQSFP 509

Query: 428 WVRYITQSGDDY 439
           WVRY T + ++Y
Sbjct: 510 WVRYKTVNDEEY 521

>KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {ON}
           Anc_3.165 YOL062C
          Length = 474

 Score =  146 bits (368), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 110/481 (22%), Positives = 228/481 (47%), Gaps = 47/481 (9%)

Query: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQ-HLLLEREQESSVMPPCFHHNGIHYMY 59
           M + V    ++G+ ++S+ ++  + +S  + F+  ++   +  S ++         HY+ 
Sbjct: 1   MINAVLVYSARGELIVSKMFKPTLKRSVGDIFRVQVINSLDVRSPIL--TLGSTTFHYVR 58

Query: 60  VQYNDVYVLALTRSVSVNATTMFAFMYKLINXXXXXXXXXXXXSIRDNYIIIYELLDEMM 119
                ++V++++R+ + N+   + F+YK                +++ +++ +ELLD M+
Sbjct: 59  TPGEGLWVVSVSRN-NENSAATWEFLYKFATMLAAYRLDSEEV-LKEEFMLAWELLDTMV 116

Query: 120 DKG-VPQVTETKMLKQYITQKS----FKLTRSAKKQKNV----------------ARPPT 158
           + G +P  T+   +   ++ K       +   A++Q+                  A  P 
Sbjct: 117 EGGGIPSETDPHRIISAMSVKPAMSPVDVRADARQQQTTTSTGAFGHAFPQLLHRASNPG 176

Query: 159 ELTNSVSWRPEGIKYKKNEAFLDVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLK 218
            ++       +G + K+NE  + V ESI++L+++ G +L++ + G + + ++L G    +
Sbjct: 177 GISILPHATGDGAQLKRNEIVMVVQESISILVSKDGSILKAYVDGGIDLTTKLEGAAVCQ 236

Query: 219 LGLNDKGIFTTNDQEDSPEPVVSSKKKNSNIE----------LEDLKFHQCVRLSKFENE 268
            GLND  + T N      +P+ S + + +N+E          L D KFHQCV L +F+ +
Sbjct: 237 FGLNDS-LSTDNSSNSKWDPLRSKETQGTNLEMKNAHVGTVLLRDCKFHQCVSLERFDRD 295

Query: 269 KIITFIPPDGEFDLMTYRLSTPIKPLIWCDVKVQVHSGSRIEIHCRAKAQIKKKSVANNV 328
           +II F PP+G  +LM Y +   +         V   + +  +     K+    K  A NV
Sbjct: 296 RIIRFTPPEGTIELMKYHVRDNLNLPFKVTSMVIPTANNETDYRVTIKSLFPGKLSAKNV 355

Query: 329 EILIPIPEDADSPTFKYSRGNIKWVPEKNAILWKFSSFQGGKEYSMAAQLGLPSVSDAEP 388
            + IP+P          S GN K++PE+NA++WKF  + G  E  ++A + +P+  D   
Sbjct: 356 TMRIPVPPGTLDCKINVSNGNCKFLPEENAMVWKFHKYNGLTENKLSA-ITVPT-RDTTQ 413

Query: 389 PKLKR----PVQIKFQIPYFTTSGIQVRYLKI---EEPKLQYNSYPWVRYITQSGDDYTI 441
             L++    P+ + F+I  ++ +G+ VRY  +        ++ +  W++Y++ SG  Y +
Sbjct: 414 LALQQWSRPPISLDFEILMYSNTGLVVRYFTVLDKHNNNTKFKTVKWIKYVSHSG-SYEV 472

Query: 442 R 442
           R
Sbjct: 473 R 473

>TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.555
           YHL019C
          Length = 559

 Score =  147 bits (370), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 150/587 (25%), Positives = 236/587 (40%), Gaps = 176/587 (29%)

Query: 1   MASYVAFCDSKGKPLLSR-----RYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGI 55
           M+S +   D   +PL+S+     R   D+ +S  ES+          +   PP    +  
Sbjct: 1   MSSCLFILDELLEPLISKNTKPVRNLPDIIKSFKESW----------TPTSPPIITVSNW 50

Query: 56  HYMYVQYNDVYVLALTRSVSVNATTMFAFMYKL-----INXXXXXXXXXXXXSIRDNYII 110
           HY+YV+ + ++ +A    +      +   ++ L     +              I DN ++
Sbjct: 51  HYVYVKRDALWFVAAIHYMDEKCMNLMMILFYLDQLYYLLKNYFKKELLTKLLIIDNALL 110

Query: 111 IYELLDEMMDKGVPQVTETKMLKQYITQK---------------SFKLTRSAKKQKNVAR 155
           + EL+DE +D G+ Q+T+  +++ YI  K                   T SA  +KN   
Sbjct: 111 VTELMDESIDFGIIQMTDPSIIRDYIRVKINNSIATGNNSNDDSDDSDTESASSKKNAKS 170

Query: 156 ------PPTELTN----------------------------------------SVSWRPE 169
                     LTN                                        +VSWR +
Sbjct: 171 LGSYMPSANNLTNLWKGYSTKDETLNENVNNDNFENNDDETYINSHIARTTTMAVSWRTK 230

Query: 170 GIKYKKNEAFLDVIESINMLMTQQGQVLRSEIL-GTVKVRSRLSGMPDLKLGLNDKGIFT 228
           GI Y KNE FLDV+ES+  LM  + +V+R  ++ G +K +S LSGMP L++ LN      
Sbjct: 231 GIYYAKNEFFLDVVESVQYLMNFKDKVIRRNLIHGQIKCKSYLSGMPTLRIALN------ 284

Query: 229 TNDQEDSPEPVVSSKKKNSNIELEDLKFHQCVRLS--------------------KFENE 268
                     ++   K+     L   KFHQCV L+                     F N+
Sbjct: 285 ---------KILQDDKQF----LGHAKFHQCVSLNSINIKDLEKDLEGPNDISNKNFVNK 331

Query: 269 KIITFIPPDGEFDLMTYRLSTPIK--PLIWC---DVKVQVHSGSRIEIHCRAKAQIKKKS 323
           K I FIPPDGEF L  Y L   +K  P+I     D+K       R++I  + +   K+++
Sbjct: 332 KEIEFIPPDGEFVLCQYELRRHVKDPPVINMTSFDIKPNFKKF-RVQISLKIETHFKRQN 390

Query: 324 VANNVEILIPIP--------EDADSPTFKYSRGNIKWVPEKNAILWKFSSFQGG---KEY 372
             + + I IP+         + +  P FK   G + +   ++ ++W+  + +GG    E 
Sbjct: 391 STSLMTIKIPLLQLFNDYKIDLSKQPRFKSDVGKVLFNISEDFLIWEIDALKGGHGENEK 450

Query: 373 SMAAQLGL-------------------------PSV----------SDAEPPKLKRPVQ- 396
            M A+  L                         P +           DAE   LK   Q 
Sbjct: 451 GMVAEFFLFNQEEYDRLQEEAKISMNPPPLRNGPKLEELYEEMHENEDAEDTALKMKTQY 510

Query: 397 --IKFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWVRYITQSGDDYTI 441
             ++F+IPY T SG++V YLKIEE  L+Y S+PWVRY T + D+Y  
Sbjct: 511 VFMQFEIPYSTCSGLKVEYLKIEEDLLKYQSFPWVRYKTLNDDEYAF 557

>Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {ON}
           complement(30531..32156) [1626 nt, 542 aa]
          Length = 541

 Score =  140 bits (354), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 143/563 (25%), Positives = 229/563 (40%), Gaps = 148/563 (26%)

Query: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60
           M+S +   D   +PL+S+  +   + + +  F  L  +        PP F     HY+++
Sbjct: 1   MSSCLFILDESLEPLISKNVKSVRNLTGILEFFKLNYKENG-----PPVFTVLEWHYVFI 55

Query: 61  QYNDVYVLALTRSVSVNATTMFAFMYKLINXXXXXXXXXXXXS-----IRDNYIIIYELL 115
           + + ++ +          T + A  + L              S     + DN ++I EL+
Sbjct: 56  KRDSLWFMTAIHETDDRITNLMALTFYLDQLYLLLKTYFNRSSLDRNIVLDNVLLIIELI 115

Query: 116 DEMMDKGVPQVTE------------------------------TKMLKQYITQKS--FKL 143
           DE MD G+ Q+T+                               K L  YI  K+   KL
Sbjct: 116 DESMDFGIVQLTDPSIIKDYIRVKVNSPITHLTSDDDSDTEEKHKGLSTYIPGKTDIVKL 175

Query: 144 TRS----------AKKQKNVARPPTE-LTNS---------VSWRPEGIKYKKNEAFLDVI 183
            +           + +Q N      E   NS         VSWR +GI Y KNE FLDVI
Sbjct: 176 WKGQPAVTANEGKSNEQDNYDDDDDENFINSYIAKTTIMPVSWRTKGIYYAKNEFFLDVI 235

Query: 184 ESINMLMT-QQGQVLRSEILGTVKVRSRLSGMPDLKLGLNDKGIFTTNDQEDSPEPVVSS 242
           E +  LM    G++ ++ I G +K +  LSGMP LK+ LN       ND++         
Sbjct: 236 EKVQYLMDFSTGRIRKNLIHGEIKCKCYLSGMPTLKVALNK---LIKNDEQ--------- 283

Query: 243 KKKNSNIELEDLKFHQCVRLSKFE------------NEKIITFIPPDGEFDLMTYRL--- 287
                   + + KFHQCV ++  +            + K I FIPPDGEF L  Y L   
Sbjct: 284 -------FISNSKFHQCVSINSLKREINNEEEENTYHGKEIEFIPPDGEFVLCKYELKRH 336

Query: 288 --STPIKPLIWCDVKVQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIP--------ED 337
               P+  L   ++K ++    +I+IH   +   KK++  + + I IP+         + 
Sbjct: 337 VRDVPVIKLSNIEIKPKLKK-YKIQIHVTIETHFKKQNSTSVLTIKIPLRMVFSQYKIDL 395

Query: 338 ADSPTFKYSRGNIKWVPEKNAILWKFSSFQGGKEYS---MAAQLGLPSVSD--------- 385
              P FK   G + +    + ++W+  S +GG   S   M A+  + +  +         
Sbjct: 396 TKQPRFKSDFGEVLFNISDDFLIWEVGSMKGGNGESKNNMVAEFFIFNQEEYDRLQEEMK 455

Query: 386 --------AEPPKL--------------------KRPVQIKFQIPYFTTSGIQVRYLKIE 417
                    E PKL                    ++ + +KF++PY T SG++V YLKIE
Sbjct: 456 TSMNPPPLREGPKLEEIYEQTHDNRDEHDKNGISQQLLTMKFEVPYSTCSGLKVEYLKIE 515

Query: 418 EPKLQYNSYPWVRYITQSGDDYT 440
           E ++ Y S+PWVRY T + D+Y 
Sbjct: 516 ENQVNYQSFPWVRYKTINDDEYA 538

>ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 549

 Score =  140 bits (352), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 106/335 (31%), Positives = 156/335 (46%), Gaps = 76/335 (22%)

Query: 161 TNSVSWRPEGIKYKKNEAFLDVIESINMLMTQQGQVLRSEIL-GTVKVRSRLSGMPDLKL 219
           T  VSWR +GI Y KNE FLDV+E +  L   + +V+R  ++ G +  +S LSGMP LK+
Sbjct: 233 TMPVSWRAKGIHYGKNEFFLDVVEKVQYLADFKEKVVRKNLIHGKIYCKSYLSGMPKLKI 292

Query: 220 GLNDKGIFTTNDQEDSPEPVVSSKKKNSNIELEDLKFHQCVRLSKFENEKIITFIPPDGE 279
            LN   +   + Q  S                   KFHQCV L    NEK + FIPPDGE
Sbjct: 293 ALNK--LLQRDAQFMSHS-----------------KFHQCVALETL-NEKELEFIPPDGE 332

Query: 280 FDLMTYRL-----STPIKPLIWCDVKVQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPI 334
           F L  Y L      TPI  +   ++K Q+    ++ I    +   K ++  + + + IP+
Sbjct: 333 FILCEYELKRHVNDTPILKITSFEIKPQLKK-FKLRILLTIETHFKTRNSTSILNVKIPL 391

Query: 335 PE-------DADSPT-FKYSRGNIKWVPEKNAILWKFSSFQGGK---EYSMAAQLGL--- 380
            +       D   PT FK + G + +    + +LW+    +GG    ++SM A+  L   
Sbjct: 392 AKLFADYNIDLSKPTRFKSAAGQVLFNLSDDFLLWEIGQMRGGHGETQFSMVAEFSLFNK 451

Query: 381 ------------------------------PSVSDAEPPKLKRPVQ-----IKFQIPYFT 405
                                          + S  +P  L + +Q     + F+IPY T
Sbjct: 452 EEFEREQEERKHSMNPPPLREGPKLEELYAQTHSQKDPEVLVKSIQSQLVGMDFEIPYTT 511

Query: 406 TSGIQVRYLKIEEPKLQYNSYPWVRYITQSGDDYT 440
            SG++V YLKIEE +LQY S+PWVRY T S ++Y 
Sbjct: 512 CSGLKVEYLKIEEEQLQYQSFPWVRYKTISDEEYA 546

>KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.555
           YHL019C
          Length = 540

 Score =  135 bits (340), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 120/456 (26%), Positives = 187/456 (41%), Gaps = 139/456 (30%)

Query: 104 IRDNYIIIYELLDEMMDKGVPQVTETKMLKQYIT------QKSFKL---------TRSAK 148
           I DN + I EL++E +D G+ Q+T++ ++K YI       Q  +K+         T   K
Sbjct: 102 IMDNLVPILELIEESVDFGIIQITDSNLMKDYIRIKVNLPQDDYKIHYDSSDEEKTNYHK 161

Query: 149 KQKNVARPPTELTNSV-------------------------------------------- 164
            +K++ +  T L   V                                            
Sbjct: 162 GKKHIRKELTYLKKKVLGRGTHEHSKSIDKTIEQKHTTAEDELVDEDTYINSYIAKTTIM 221

Query: 165 --SWRPEGIKYKKNEAFLDVIESINMLMTQQGQVLRSEIL-GTVKVRSRLSGMPDLKLGL 221
             SWR +GI+Y KNE FLDVIE +   M     +++  ++ G +  +S LSGMP LK+ L
Sbjct: 222 SVSWRAKGIQYAKNEFFLDVIEKVEYFMDFSNNIIKKNLIHGEIICKSFLSGMPTLKVSL 281

Query: 222 NDKGIFTTNDQEDSPEPVVSSKKKNSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFD 281
           N                ++   K+     L   KFHQCV     +  K++ F+PPDG+F 
Sbjct: 282 N---------------KIIYQDKQF----LSSCKFHQCVMPDSVDEGKVLEFVPPDGDFV 322

Query: 282 LMTYRL-----STPIKPLIWCDVKVQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPI-- 334
           L  Y L       P+  LI  +VK ++    ++++    ++  KK +    + I IP+  
Sbjct: 323 LCKYELKRHVNDLPLLKLISYEVKPKL-DKYKLKLFVTIESTFKKTNSTTKLNIKIPLKV 381

Query: 335 ---PEDADSPTFKYSR---GNIKWVPEKNAILWKFSSFQGGK-EYSMAAQLGLPSVSD-- 385
                D D      SR   G I +    + +LW+  + +GG  +  M A   L +  +  
Sbjct: 382 LLEKYDIDLSKNIKSRCDEGKILFNVSDDFLLWEIGAMKGGNSQLKMGADFALFNEEEYL 441

Query: 386 ---------AEPPKLKRP--------------------------------VQIKFQIPYF 404
                      PP L+                                  +++ F+IPY 
Sbjct: 442 RQQEELKTSMNPPPLRTGPKLEELYKQIHEEKCNNFTRKGESSDETKGNLIKMDFEIPYN 501

Query: 405 TTSGIQVRYLKIEEPKLQYNSYPWVRYITQSGDDYT 440
           T+SG++V YLKIEEP LQY ++PWVRY T S D Y 
Sbjct: 502 TSSGLKVEYLKIEEPNLQYQAFPWVRYKTISDDGYA 537

>CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019c
           involved in clathrin-independent transport
          Length = 598

 Score =  134 bits (337), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 110/357 (30%), Positives = 165/357 (46%), Gaps = 90/357 (25%)

Query: 164 VSWRPEGIKYKKNEAFLDVIESINMLMT-QQGQVLRSEILGTVKVRSRLSGMPDLKLGLN 222
           VSWR +GI Y KNE FLDVIE +  L+  + G V RS I G +  RS LSGMP LK+ LN
Sbjct: 249 VSWRAKGIHYAKNEFFLDVIEKLQYLVDLESGMVRRSLIHGQIVCRSYLSGMPKLKMSLN 308

Query: 223 DKGIFTTNDQE-------------DSPEPVVSSKKKNSNIELEDLKFHQCVRLSKFENEK 269
                  ND++             DS E V+   +++S+ EL+ LK       ++   E 
Sbjct: 309 K---LLQNDKQFISQVQFHQCVSLDSIEKVIKYAEEHSD-ELKTLKH------TEHNAES 358

Query: 270 IITFIPPDGEFDLMTYRLSTPIK--PLI-WCDVKVQVH-SGSRIEIHCRAKAQIKKKSVA 325
            I FIPPDG+F L +Y L   I+  P++  C  ++       +++I    +   K  +  
Sbjct: 359 EIEFIPPDGDFTLCSYELKRHIRDPPMVKLCSFEITPKWKKYKLKISAAVETHFKPTNST 418

Query: 326 NNVEILIPIPE-------DADSPT-FKYSRGNIKWVPEKNAILWKFSSFQGGKEY----- 372
           + +++ IPI +       D   P  FK S G + +    + +LW+    +GGK +     
Sbjct: 419 SKLDVKIPISKVFKDYQIDLKKPIKFKTSNGRVVYNISDDFLLWEIGVIKGGKMHGSKED 478

Query: 373 --------SMAAQLGL-----------PSVSDAEPPKLK--------------------- 392
                   +MAA+ GL              +   PP L+                     
Sbjct: 479 ISKFDNVATMAAEFGLFNEEEYERERKERETSMNPPPLRTGPKLEDIYKETHEENDGYNS 538

Query: 393 ---RP------VQIKFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWVRYITQSGDDYT 440
              +P      + + F+IPY T SG++V YLKI+E +LQY S+PWVRY T + D+Y 
Sbjct: 539 VGQKPKNNLNLLSMDFEIPYCTCSGLKVEYLKIDEDQLQYQSFPWVRYKTINDDEYA 595

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 24/33 (72%)

Query: 104 IRDNYIIIYELLDEMMDKGVPQVTETKMLKQYI 136
           + DN +++ EL+DE +D G+ Q+TE  ++K YI
Sbjct: 104 VLDNTLLVMELIDETLDYGIVQLTEPSIMKDYI 136

>NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON}
           Anc_2.555 YHL019C
          Length = 588

 Score =  129 bits (325), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 105/356 (29%), Positives = 154/356 (43%), Gaps = 99/356 (27%)

Query: 164 VSWRPEGIKYKKNEAFLDVIESINMLMTQQGQVLRSEIL-GTVKVRSRLSGMPDLKLGLN 222
           +SWR +GI Y KNE FLDVIE +   M  +  V+R  ++ G +  RS LSGMP LK+ +N
Sbjct: 250 ISWRTKGIHYGKNEFFLDVIEKVEYFMDFKSGVIRKNLIHGEIICRSYLSGMPKLKISIN 309

Query: 223 DKGIFTTNDQEDSPEPVVSSKKKNSNIELEDLKFHQCVRL---------------SKFEN 267
              I   + Q                  L ++KFHQCV L                K +N
Sbjct: 310 --KILKQDVQ-----------------FLSNVKFHQCVSLDSIRARSNPPAVEEDGKKKN 350

Query: 268 EKI--------ITFIPPDGEFDLMTYRLSTPIK--PLIWC---DVKVQVHSGSRIEIHCR 314
           E+         I FIPPDGEF L  Y L   +K  P+I     ++  ++H   +I+IH  
Sbjct: 351 EEADTLGNKGEIEFIPPDGEFLLCKYELKRHVKDQPMIKLRNFEIIPKLHK-FKIKIHVI 409

Query: 315 AKAQIKKKSVANNVEILIPIP--------EDADSPTFKYSRGNIKWVPEKNAILWKFSSF 366
            +   K  +  + + + IPI         + +  P FK  +G + +      +LW+  + 
Sbjct: 410 IETHFKTTNSTSKLNLRIPITNLFQSYRIDLSKQPKFKCEQGTVLFNLSDKFLLWEVGTM 469

Query: 367 QGG---KEYSMAAQLGL-----------PSVSDAEPPKLKRP------------------ 394
            GG      SM A+  L              +   PP L+                    
Sbjct: 470 NGGHGENTLSMMAEFALFNEEEYKKMEEERKTSMNPPPLREGPKLEELYKKIHEEGDSDE 529

Query: 395 ----------VQIKFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWVRYITQSGDDYT 440
                     + + F++PY T SG+++ YLKIEE +LQY S+PWVRY T S D+Y 
Sbjct: 530 VSTRKKNESLLTMDFEVPYCTCSGLKIEYLKIEEDQLQYQSFPWVRYKTISDDEYA 585

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 70/145 (48%), Gaps = 11/145 (7%)

Query: 1   MASYVAFCDSKGKPLLSRRYQDDVSQ-SAVESFQHLLLEREQESSVMP-PCFHHNGIHYM 58
           M+S +   D   +P++ +  +   +  S V  FQ L     + + V P P  +     ++
Sbjct: 1   MSSSIFILDETLEPIICKNIRALPNLPSLVTKFQELY----RSNGVSPLPILNDIDWQFL 56

Query: 59  YVQYNDVYVLALTRSVS-VNATTMFAFM---YKLINXXXXXXXXXXXXSIRDNYIIIYEL 114
           +++ + +  L++  + S  N   +F ++   YKL+              I DN++++ EL
Sbjct: 57  HIKRDSLVFLSVVENNSRCNLLGVFTYLEEFYKLLKDYLHVGILNRNLLI-DNFLVVIEL 115

Query: 115 LDEMMDKGVPQVTETKMLKQYITQK 139
           +DE +D GV Q T++ ++K Y+  K
Sbjct: 116 IDESLDFGVVQFTDSSLIKDYVRVK 140

>Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score =  126 bits (316), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 105/360 (29%), Positives = 159/360 (44%), Gaps = 102/360 (28%)

Query: 164 VSWRPEGIKYKKNEAFLDVIESINMLMT-QQGQVLRSEILGTVKVRSRLSGMPDLKLGLN 222
           +SWR +GI Y KNE FLDVIE +  LM  ++G + ++ I G +  RS LSGMP LK+ +N
Sbjct: 253 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRSYLSGMPKLKISIN 312

Query: 223 DKGIFTTNDQEDSPEPVVSSKKKNSNIELEDLKFHQCVRLSKFE---------------- 266
              I   + Q  S          NSN       FHQCV L                    
Sbjct: 313 --KILNRDPQFMS----------NSN-------FHQCVSLDSINTIEKGQEKEQNTGDSQ 353

Query: 267 ---NEKIITFIPPDGEFDLMTYRLSTPIK--PLIWC-DVKVQVH-SGSRIEIHCRAKAQI 319
              + + I F+PPDGEF L  Y L   +K  P+I   D +++     S+I+I  + +   
Sbjct: 354 AAADAREIEFVPPDGEFVLCQYELKRHVKDAPMIKLKDFEIKPKLKKSKIQILTKIQTNF 413

Query: 320 KKKSVANNVEILIPIP--------EDADSPTFKYSRGNIKWVPEKNAILWKFSSFQGGKE 371
           K  +  + + + IP+         + +    FK + G + +    + +LW+  + +G +E
Sbjct: 414 KPTNSTSKLNVKIPLTRVFQDYKIDLSKQIRFKANNGKVVFNLSDDFLLWEIQTMKGHRE 473

Query: 372 ----------------YSMAAQLGLPSVSDAE-----------PPKLK------------ 392
                            SM A+  L +  + +           PP L+            
Sbjct: 474 RNASNAPQDDGDPSTCASMVAEFSLFNQEEYDRLQEEMKTSMNPPPLRTGPKLEELYNQV 533

Query: 393 ------------RPVQIKFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWVRYITQSGDDYT 440
                       R V I F+IPY T SG++V YLK+EEP+LQY S+PWVRY T + ++Y 
Sbjct: 534 HDKHTPHVTPRDRLVSIDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPWVRYKTVNDEEYA 593

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 52/99 (52%), Gaps = 7/99 (7%)

Query: 47  PPCFHHNGIHYMYVQYNDVYVLALTRSV---SVNATTMFAFM---YKLINXXXXXXXXXX 100
           PP    N   +++++ + ++++++  +    +++  T+ AF+   Y L+           
Sbjct: 42  PPILFQNDWFFIHLKRDFLHLVSVIHTTDKPNIDLMTILAFLEQFYHLLQKYFEIKVLSK 101

Query: 101 XXSIRDNYIIIYELLDEMMDKGVPQVTETKMLKQYITQK 139
              I DN +++ EL+DE +D G+ QVT+  ++K YI  K
Sbjct: 102 DL-ILDNVLLVLELMDECIDFGIVQVTDPSIIKDYIRVK 139

>KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa]
           {ON} Anc_2.555 YHL019C
          Length = 582

 Score =  125 bits (313), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 99/348 (28%), Positives = 155/348 (44%), Gaps = 93/348 (26%)

Query: 164 VSWRPEGIKYKKNEAFLDVIESINMLMTQQGQVLRSEIL-GTVKVRSRLSGMPDLKLGLN 222
           +SWR +GI Y KNE FL+VIE +   M     V++  ++ G ++ +  LSGMP+LK+ +N
Sbjct: 253 ISWRTKGIHYAKNEFFLNVIEKVEYFMDFTQNVIKKNLIHGEIRCKCFLSGMPNLKVSIN 312

Query: 223 DKGIFTTNDQEDSPEPVVSSKKKNSNIELEDLKFHQCVRLSKFE--NEKIITFIPPDGEF 280
                           +V+  K+     L + KFHQCV L+  E  + K + F+PPDGEF
Sbjct: 313 ---------------KIVNEDKQF----LANCKFHQCVSLASLESSDHKDVEFVPPDGEF 353

Query: 281 DLMTYRL-----STPIKPLIWCDVK-----VQVHSGSRIEIHCRAKAQIKKKSVANNVEI 330
            L  Y L       P+  L+  +VK      ++     IE H +      K ++   ++ 
Sbjct: 354 TLCRYELKRHVRDEPMVKLVNFEVKPKLKKFKLKLLLTIETHFKTTNATSKLALRVPIKQ 413

Query: 331 L-----IPIPEDADSPTFKYSRGNIKWVPEKNAILWKFSSFQGGK---EYSMAAQLGLPS 382
           L     + + ++  S   K  RG I +    + +LW+  S  GG    + SM  +  L +
Sbjct: 414 LFREYRVDLSKNLKS---KCDRGAILFNISDDFLLWEVGSMSGGHGETQLSMGVEFALFN 470

Query: 383 VSDAE-----------PPKLK-----------------------RPVQ------------ 396
             + +           PP L+                        PV             
Sbjct: 471 QEEYDREQEMLKTSMNPPPLREGPKLEELYKQIHEDDDDDDGNTEPVAEHRLQPRTREID 530

Query: 397 ----IKFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWVRYITQSGDDYT 440
               + F++PY T+SG++V YLKIEEP+L+Y S+PWVRY T S  +Y 
Sbjct: 531 KLLTMDFEVPYCTSSGLRVEYLKIEEPQLEYQSFPWVRYTTLSDAEYA 578

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 31/144 (21%), Positives = 66/144 (45%), Gaps = 12/144 (8%)

Query: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLE-REQESSVMPPCF-HHNGIHYM 58
           M+S +   D   + L+S+  +      AV S ++ + + ++   S  PP   +H+   + 
Sbjct: 1   MSSVLYILDENLETLISKNIK------AVPSLEYPIAQFKKLYGSNAPPVIDYHDLFTFT 54

Query: 59  YVQYNDVYVLALTRSVSVNATTMFAFM---YKLINXXXXXXXXXXXXSIRDNYIIIYELL 115
           Y+Q + +  +++   V         ++   Y+++              + DN ++I EL+
Sbjct: 55  YIQRDSLLFVSVVDRVDTGLVETLVYLEHFYEVLKNYLGVKVLDKNI-VTDNSVLISELI 113

Query: 116 DEMMDKGVPQVTETKMLKQYITQK 139
           +E +D G  QVT++ +L  YI  K
Sbjct: 114 EETIDFGAIQVTDSGLLADYIKMK 137

>Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON}
           YHL019C (REAL)
          Length = 603

 Score =  124 bits (310), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 100/360 (27%), Positives = 157/360 (43%), Gaps = 102/360 (28%)

Query: 164 VSWRPEGIKYKKNEAFLDVIESINMLMT-QQGQVLRSEILGTVKVRSRLSGMPDLKLGLN 222
           +SWR +GI Y KNE FLDVIE +  LM  ++G + ++ I G +  R  LSGMP LK+ +N
Sbjct: 260 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYLSGMPKLKISIN 319

Query: 223 DKGIFTTNDQEDSPEPVVSSKKKNSNIELEDLKFHQCVRLSKFE---------------- 266
              I   + Q                  L +  FHQCV L   +                
Sbjct: 320 --KILNRDAQ-----------------FLSNSSFHQCVSLDSIKTIEKREEKEDDDTGLQ 360

Query: 267 ---NEKIITFIPPDGEFDLMTYRLSTPIK--PLIWC-DVKVQVH-SGSRIEIHCRAKAQI 319
              + K + F+PPDGEF L  Y L   +K  P+I   D +++      +I+I  + +   
Sbjct: 361 AAADAKELEFVPPDGEFVLCQYELKRHVKDAPMIKLKDFQIKPKLKKFKIQIETKIQTNF 420

Query: 320 KKKSVANNVEILIPIP--------EDADSPTFKYSRGNIKWVPEKNAILWKFSSFQGGKE 371
           K  +  + + + IP+         + +    FK + G + +    + +LW+  + +G +E
Sbjct: 421 KPTNSTSKLNVKIPLTKVFQEYRIDLSKQIRFKSNIGKVVFNLSDDFLLWEIQAMKGHRE 480

Query: 372 Y----------------SMAAQLGLPSVSDAE-----------PPKLK------------ 392
           +                SM A+  L +  + +           PP L+            
Sbjct: 481 HNTNKTSQDDNDPDACASMVAEFPLFNQEEYDRLQEEKKTSMNPPPLRTGPRLEELYRQV 540

Query: 393 ------------RPVQIKFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWVRYITQSGDDYT 440
                       + V I F+IPY T SG+++ YLK+EEP+LQY S+PWVRY T S D+Y 
Sbjct: 541 HDQQIAHVTPRDKLVAIDFEIPYCTCSGLKIEYLKVEEPQLQYQSFPWVRYKTTSDDEYA 600

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 51/99 (51%), Gaps = 7/99 (7%)

Query: 47  PPCFHHNGIHYMYVQYNDVYVLALTRSV---SVNATTMFAFM---YKLINXXXXXXXXXX 100
           PP    N   +++++ + ++ +++  +    +++  T+ AF+   Y L+           
Sbjct: 42  PPILSQNDWFFIHLKRDFLHFVSVIHTTDKPNIDLMTILAFLEQFYHLLQEYFEIKVLTK 101

Query: 101 XXSIRDNYIIIYELLDEMMDKGVPQVTETKMLKQYITQK 139
              I DN +++ EL+DE +D G+ QVT+  ++K YI  K
Sbjct: 102 DV-ILDNVLLVLELMDECIDFGIVQVTDPSIIKDYIRVK 139

>Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score =  121 bits (303), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 101/363 (27%), Positives = 157/363 (43%), Gaps = 107/363 (29%)

Query: 164 VSWRPEGIKYKKNEAFLDVIESINMLMTQQGQVLRSEIL-GTVKVRSRLSGMPDLKLGLN 222
           +SWR +GI Y KNE FLDVIE +  LM  +  ++R  ++ G +  R  LSGMP LK+ +N
Sbjct: 252 ISWRTKGIHYSKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYLSGMPKLKISIN 311

Query: 223 DKGIFTTNDQEDSPEPVVSSKKKNSNIE-LEDLKFHQCVRLSKFE--------------- 266
                               K  N + + + + KFHQCV L                   
Sbjct: 312 --------------------KLLNRDPQFMSNSKFHQCVSLDSINIIEEEGRDTDDAGSQ 351

Query: 267 ---NEKIITFIPPDGEFDLMTYRLSTPIK--PLI---WCDVKVQVHSGSRIEIHCRAKAQ 318
              + K I FIPPDGEF L  Y L   +K  P+I     ++K ++    +I+I  + +  
Sbjct: 352 TATDTKEIEFIPPDGEFVLCQYELKRHVKDAPMIKLQGFEIKPKLKK-FKIQIITKIQTN 410

Query: 319 IKKKSVANNVEILIPIP--------EDADSPTFKYSRGNIKWVPEKNAILWKFSSFQGGK 370
            K  +  + + + IP+         + +    FK + G + +    + +LW+  + +G +
Sbjct: 411 FKPTNSTSKLNVKIPLTKVFQDYKIDLSKQIRFKANLGKVVFNLSDDFLLWEIGTMKGHR 470

Query: 371 E---------------YSMAAQLGLPSVSDAE-----------PPKLK------------ 392
           E                SM A+  L +  + +           PP L+            
Sbjct: 471 ERNTGTVPQEDDASTLASMVAEFPLFNQEEYDRLQEELKTSMNPPPLRTGPKLEELYKQV 530

Query: 393 ---------------RPVQIKFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWVRYITQSGD 437
                          + V + F+IPY T SG++V YLK+EEP+LQY S+PWVRY T S D
Sbjct: 531 HEERVLHTHDVAPRDKLVSVDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPWVRYKTISDD 590

Query: 438 DYT 440
           +Y 
Sbjct: 591 EYA 593

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 33/145 (22%), Positives = 71/145 (48%), Gaps = 12/145 (8%)

Query: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60
           M+S +   D   +PL+S+  +   + S++ S       R+      PP    NG  ++++
Sbjct: 1   MSSSLFILDEDLEPLVSKNIRAIPNLSSILSSFKQCYHRDS-----PPILSQNGWFFIHL 55

Query: 61  QYNDVYVLALTRSV---SVNATTMFAFM---YKLINXXXXXXXXXXXXSIRDNYIIIYEL 114
           + + ++ +++  +    +++  ++ AF+   Y L+              I DN +++ EL
Sbjct: 56  KRDFLHFISVIHATDKPNIDLMSILAFLEQFYHLLKKYFEINVLSKNI-ILDNVLLVLEL 114

Query: 115 LDEMMDKGVPQVTETKMLKQYITQK 139
           +DE +D G+ QVT+  ++K YI  K
Sbjct: 115 VDECIDFGIVQVTDPSIIKDYIRVK 139

>YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}
           APM2Protein of unknown function, homologous to the
           medium chain of mammalian clathrin-associated protein
           complex; involved in vesicular transport
          Length = 605

 Score =  119 bits (299), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 100/354 (28%), Positives = 158/354 (44%), Gaps = 86/354 (24%)

Query: 164 VSWRPEGIKYKKNEAFLDVIESINMLMTQQGQVLRSEIL-GTVKVRSRLSGMPDLKLG-- 220
           +SWR +GI Y KNE FLDVIE +  LM  +  V+R  ++ G +  R  LSGMP LK+   
Sbjct: 258 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGVIRKNLIHGEIVCRCYLSGMPKLKISIN 317

Query: 221 --LNDKGIFTTND------QEDSPEPVVSSKKKNSNIELEDLKFHQCVRLSKFENEKIIT 272
             LN    F +N         DS   +   ++KNS+ +           L    + + I 
Sbjct: 318 KILNRDPQFMSNSSFHQCVSLDSINTIEKDEEKNSDDD---------AGLQAATDAREIE 368

Query: 273 FIPPDGEFDLMTYRLSTPIK--PLIWC-DVKVQVH-SGSRIEIHCRAKAQIKKKSVANNV 328
           FIPPDGEF L  Y L   +K  P++   D +++      +I+I  + +   K  +  + +
Sbjct: 369 FIPPDGEFVLCQYELKRHVKDAPMVRLKDFEIKPKLKKFKIQIVTKIQTNFKPTNSTSKL 428

Query: 329 EILIPIP--------EDADSPTFKYSRGNIKWVPEKNAILWKFSSFQGGKEY-------- 372
            + IP+         + +    FK + G + +    + +LW+  + +G +E+        
Sbjct: 429 NVRIPLTKVFQEYKIDLSKQIRFKANIGKVVFNLSDDFLLWEIQTMKGHREHSTNKSSQY 488

Query: 373 -----------SMAAQLGLPSVSDAE-----------PPKLK------------------ 392
                      SM A+  L +  + +           PP L+                  
Sbjct: 489 NSDEDDPNTCASMVAEFPLFNQEEYDRLQEEMKTSMNPPPLRTGPRLEELYRQVHDQQTS 548

Query: 393 ------RPVQIKFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWVRYITQSGDDYT 440
                 + V I F+IPY T SG++V YLK+EEP+LQY S+PWVRY T S ++Y 
Sbjct: 549 HVTPRDKLVNIDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPWVRYKTVSDEEYA 602

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 71/146 (48%), Gaps = 14/146 (9%)

Query: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAV-ESFQHLLLEREQESSVMPPCFHHNGIHYMY 59
           M+S +   D   +PL+S+  +   + S+V  SF+    +        PP    N   +++
Sbjct: 1   MSSSLFILDENLEPLVSKNIRALPNLSSVLSSFKQCYHDGS------PPILSQNDWFFIH 54

Query: 60  VQYNDVYVLALTRSV---SVNATTMFAFM---YKLINXXXXXXXXXXXXSIRDNYIIIYE 113
           ++ + ++ +++  +    +++  T+ AF+   Y L+              I DN +++ E
Sbjct: 55  LKRDFLHFVSVIHTTDKPNIDLMTILAFLEQFYHLLQKYFEIEVLTKNV-ILDNILLVLE 113

Query: 114 LLDEMMDKGVPQVTETKMLKQYITQK 139
           L+DE +D G+ QVT+  ++K YI  K
Sbjct: 114 LIDECIDFGIVQVTDPSIIKDYIRVK 139

>KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.165
           YOL062C
          Length = 428

 Score =  116 bits (290), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 105/457 (22%), Positives = 212/457 (46%), Gaps = 56/457 (12%)

Query: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLE----REQESSVMPPCFHHNGIH 56
           M S +     +G+ ++S+ Y++++ +S  E F+  ++     R    ++    FHH    
Sbjct: 1   MISAILIYTPRGELIVSKLYRNNIKRSISEIFRIQVINNFNVRSPILTLGSTTFHHIRST 60

Query: 57  YMYVQYNDVYVLALTRSVSVNATTMFAFMYKLINXXXXXXXXXXXXSIRDNYIIIYELLD 116
                 ++++++ + R+ + N+  ++ F+ KL N             ++D ++ ++E+LD
Sbjct: 61  ANDPTDDELWLVCVNRN-NANSAAIWEFLQKL-NLILQQYGITSESKLKDEFMTVHEILD 118

Query: 117 EMM-DKGVPQVTETKMLKQYITQKSFKLTRSAKKQKN--VARPPTELTN---SVSWRPEG 170
            M+   G+ Q T+ K +   ++ K    T      +   + R  T LT    + S  P  
Sbjct: 119 NMLLGTGIIQNTDLKSIVDKMSVKPISRTNETTSTQTGFLKRRNTILTTPGANFSLIPTN 178

Query: 171 --IKYKKNEAFLDVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLKLGLNDKGIFT 228
               +KKNE F  V ES+N+L+++ G +L++ + G ++++S L+G P  +  L D     
Sbjct: 179 RHDAHKKNEIFFFVNESMNLLVSKDGSILKNYVDGKIEIKSHLNGNPTCQFELVD----- 233

Query: 229 TNDQEDSPEPVVSSKKKNSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMTY--- 285
             DQ                 ++ D KF QC+   +    + +     DGE +++ Y   
Sbjct: 234 --DQT----------------KITDFKFDQCIEKVQ---SRTVRVAATDGELEIVNYHVR 272

Query: 286 --RLSTPIK--PLIWCDVKVQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIPEDADSP 341
             +++ P K  P++   VK        ++     K+   K   A +V + IP+P +    
Sbjct: 273 DDKINIPFKITPIV-STVK------DTVDYRISLKSLFPKNLSATDVVLTIPVPPNTIDC 325

Query: 342 TFKYSRGNIKWVPEKNAILWKFSSFQGGKEYSMAAQLGLPSVSDAEPPKLKRP-VQIKFQ 400
               S G+ K+  E+NA++W F+ F G  E +++A                RP +Q+ F+
Sbjct: 326 KINVSNGHCKFKAEQNAVIWTFNKFNGSTENTLSAITIADGRQIMNLESWTRPSIQLTFE 385

Query: 401 IPYFTTSGIQVRYLKI-EEPKLQYNSYPWVRYITQSG 436
           I  ++ SG+ +R L I ++ K +Y +  W++YI+++G
Sbjct: 386 ITMYSISGLLLRNLMITDKDKRRYKASRWIKYISRAG 422

>TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON}
           Anc_2.555 YHL019C
          Length = 657

 Score = 97.4 bits (241), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 71/227 (31%), Positives = 112/227 (49%), Gaps = 35/227 (15%)

Query: 164 VSWRPEGIKYKKNEAFLDVIESINMLMTQQGQVLRSEIL-GTVKVRSRLSGMPDLKLGLN 222
           +SWR +GI Y KNE FLDV+E    +M  +  ++R  ++ G +  R  LSGMP LK+ LN
Sbjct: 287 ISWRTKGIYYAKNEFFLDVLEKQEYIMDFKNDLIRKNLIQGKIICRCFLSGMPKLKIALN 346

Query: 223 DKGIFTTNDQEDSPEPVVSSKKKNSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDL 282
                   DQ+                 L  L+FHQCV L   +N++ I FIPPDGEF L
Sbjct: 347 K---LLQKDQQ----------------FLSQLRFHQCVSLETIQNKE-IEFIPPDGEFIL 386

Query: 283 MTYRLSTPIKP-----LIWCDVKVQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIPED 337
             Y L   +K      LI  ++K ++    +I+I+       K ++  + + + IP+ + 
Sbjct: 387 CEYELKRHVKDPPNIKLISFEIKPKLKKF-KIQINLSITTFFKVQNSTSILNLKIPLEKL 445

Query: 338 AD--------SPTFKYSRGNIKWVPEKNAILWKFSSFQGGKEYSMAA 376
            +        SP FK + G +K+    + +LW+  S +GG   ++ A
Sbjct: 446 FNDYKIDLKKSPRFKSNIGQVKFNLSDDFLLWEIGSMKGGHGENIKA 492

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 33/45 (73%)

Query: 395 VQIKFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWVRYITQSGDDY 439
           + + F+IPY+  SG++V YLKIEE +L Y S+PWVRY T +  DY
Sbjct: 609 LTVDFEIPYYACSGLKVEYLKIEEEQLLYQSFPWVRYKTTNDKDY 653

 Score = 34.3 bits (77), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 25/36 (69%)

Query: 104 IRDNYIIIYELLDEMMDKGVPQVTETKMLKQYITQK 139
           I DN ++I EL+DE +D G+ Q+T+  ++K Y+  K
Sbjct: 105 ILDNILLIMELIDESIDFGIIQMTDPNIIKDYVRVK 140

>NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {ON}
           Anc_2.555 YHL019C
          Length = 672

 Score = 85.9 bits (211), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 73/258 (28%), Positives = 111/258 (43%), Gaps = 60/258 (23%)

Query: 164 VSWRPEGIKYKKNEAFLDVIESINMLMT-QQGQVLRSEILGTVKVRSRLSGMPDLKLGLN 222
           +SWR +GI Y KNE FLDVIE +   M  ++G + ++ I G +  +  LSGMP LK+ +N
Sbjct: 295 ISWRTKGIHYAKNEFFLDVIEKVEYFMDFEKGLIRKNLIHGEIVCKCYLSGMPKLKISIN 354

Query: 223 DKGIFTTNDQEDSPEPVVSSKKKNSNIELEDLKFHQCVRLSKF----------------- 265
                  ND +                 L +  FHQCV L                    
Sbjct: 355 K---ILQNDSQ----------------FLSNAHFHQCVSLDSLHLQSAEDDDGDDNANVN 395

Query: 266 ENE--------KIITFIPPDGEFDLMTYRL-----STPIKPLIWCDVKVQVHSGSRIEIH 312
           ENE        K I FIPPDG+F L  Y L       P+  L   D+K ++ S  +++IH
Sbjct: 396 ENENHDERDRKKEIEFIPPDGDFLLCKYELKRHVKDLPVIKLKLFDIKPKL-SKYKLKIH 454

Query: 313 CRAKAQIKKKSVANNVEILIPIP--------EDADSPTFKYSRGNIKWVPEKNAILWKFS 364
              +   K  +  + + + IPI         + +    FK  +G + +    N ++W+  
Sbjct: 455 VIIETHFKTTNNTSKLNLKIPIERLFQEYRIDLSKQIKFKCDQGKVLFNLSDNFLIWEIG 514

Query: 365 SFQGGK-EYSMAAQLGLP 381
           S +GG  E +M+     P
Sbjct: 515 SMKGGHGEVTMSMMAEFP 532

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 27/46 (58%), Positives = 38/46 (82%)

Query: 395 VQIKFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWVRYITQSGDDYT 440
           ++I F+IPY+T SG+++ YLKIEEP+LQY S+PWVRY T S ++Y 
Sbjct: 624 LKIDFEIPYYTCSGLKIEYLKIEEPQLQYQSFPWVRYKTISDEEYA 669

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 51/90 (56%), Gaps = 5/90 (5%)

Query: 54  GIHYMYVQYNDVYVLALTRSVSVNA-TTMFAFM---YKLINXXXXXXXXXXXXSIRDNYI 109
           G  +++++ + +  +++  + S+N+   +F+++   YKL+              I DN++
Sbjct: 75  GWQFLHIKRDSLIFVSIIENNSMNSLMIIFSYLEEFYKLLKSYLNVTKLDKGLLI-DNFL 133

Query: 110 IIYELLDEMMDKGVPQVTETKMLKQYITQK 139
           ++ ELLDE +D G+ Q T++ ++K YI  K
Sbjct: 134 LVMELLDESLDFGIVQFTDSSLIKDYIRVK 163

>AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR288C (APM3)
          Length = 411

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 79/191 (41%), Gaps = 38/191 (19%)

Query: 114 LLDEMMDKGVPQVTETKMLKQYITQK---SFKLTRSAKKQKN--------------VARP 156
           LL  M+D G   VT++  L+Q +  +   S  L  + K   N              VA  
Sbjct: 73  LLHAMLDAGEVAVTDSNRLRQLVPLRNDLSTILNSATKTLANTVKYADSKQLFGAPVATG 132

Query: 157 PTELTNSVSWRPEGIKYKKNEAFLDVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPD 216
             E   +V WR    +Y  NE ++D++E++N  + Q+G  L         +   LSG  D
Sbjct: 133 KVEAGQTVPWRTADCRYVNNEIYVDLVETVNATLRQKGSSL-------TLINGSLSGKID 185

Query: 217 LKLGLNDKGIFTTNDQEDSPEPVVSSKKKNSNIELEDLKFHQCVRLSKFENEKIITFIPP 276
           +K  L             S  P V  K + S   L++   H+CV L +      + F+PP
Sbjct: 186 VKCYL-------------SGNPTVQLKLRTSGHPLDNSALHRCVELGE-AGVATMNFVPP 231

Query: 277 DGEFDLMTYRL 287
           DG F L  Y +
Sbjct: 232 DGRFTLAEYAI 242

>KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 456

 Score = 65.5 bits (158), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 90/380 (23%), Positives = 146/380 (38%), Gaps = 95/380 (25%)

Query: 111 IYELLDEMMDKGVPQVTETKMLKQYITQK--------------SFKLT-RSAKKQKNVAR 155
           I  LL+ M+D   P VT+   L+  +  +              S +++ R+  +  N+  
Sbjct: 115 IALLLNCMVDANEPAVTDFNHLRDMVPSREDLSKVINSTASSLSNRISQRNTSQVLNIGD 174

Query: 156 P---PTELTNSVSWRPEGIKYKKNEAFLDVIESINMLM-----TQQGQVLRSEILGTVKV 207
           P   P      V WR  G+KY  NE ++DV+E++++++     T +   +R  + G V  
Sbjct: 175 PAKGPAAKEKLVPWRSAGVKYSNNELYVDVVETVHVILRKNEKTGELTSVRGVLDGVVDF 234

Query: 208 RSRLSGMPDLKLGLNDKGIFTTNDQEDSPEPVVSSKKKNSNIELEDLKFHQCVRLSKFEN 267
           RS LSG P + L L  +G        D   P +                HQC   S    
Sbjct: 235 RSHLSGNPVIALNLRLRG-------HDLGMPAL----------------HQCCLDSYQGR 271

Query: 268 EKIITFIPPDGEFDLMTY-----------RLSTPIKPLIWCDVKVQVHS-GSRIEIHCRA 315
              + F+PPDG+F LM Y           +L + I  L+  D + ++   G   E++   
Sbjct: 272 PDQLRFVPPDGKFQLMHYSIDLDSLQSKSKLFSNIG-LVSPDYRTELGDLGDEFEVNLNI 330

Query: 316 KAQIKKKSVANNVEILI--PIPEDADSPTFKYSRGNI---------KWVPEKNAILWKFS 364
                 K V + V  L   P+P +      + + G+          KWV +K        
Sbjct: 331 AGSQHAKVVDDLVITLSFGPLPSECKIKVLRSTHGHFENCASNNIGKWVFDKETPTGTLP 390

Query: 365 SFQG-----GKEYSMAAQLGLPSVSDAEPPKLKRPVQIKFQIPYFTTSGIQVRYLKIEEP 419
             +G      +E   A QL +   +  E P                 SGI+V  + I   
Sbjct: 391 VLRGCLENATREQVRALQLSVSYTNRGELP-----------------SGIKVDSVDILS- 432

Query: 420 KLQYNSYPW--VRYITQSGD 437
            L  N  P+  V+YI ++GD
Sbjct: 433 GLSKNIKPFKGVKYIAKTGD 452

>TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {ON}
           Anc_2.522 YBR288C
          Length = 496

 Score = 63.2 bits (152), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 86/323 (26%), Positives = 131/323 (40%), Gaps = 82/323 (25%)

Query: 164 VSWRPEGIKYKKNEAFLDVIESINMLMTQQGQVLR----------SEILGTVKVRSRLSG 213
           V WR  G+KY  NE ++D+ ESI+++  + G+  R            I G   V+  LSG
Sbjct: 211 VPWRTAGLKYSNNELYVDLTESIHVVYQKAGKRSRRTSSKLEMICGTINGQASVKCYLSG 270

Query: 214 MP--DLKLGL--NDKGIFTTNDQEDSPEPVVSSKKKNSNIELEDLKFHQCVRLSKFENEK 269
            P  DL+L L  ND G+           P                 FH+CV L   +N  
Sbjct: 271 NPTVDLQLDLAGNDLGV-----------PA----------------FHECVELDNHQNPS 303

Query: 270 --IITFIPPDGEFDLMTYR--LSTP----------IKPLIWCDVKVQVHSGS-RIEIHCR 314
              + FIPPDG F+LM Y   L TP             L+  D   Q+ + +   EI   
Sbjct: 304 NCDLRFIPPDGRFNLMQYSIDLDTPRIQQTRRFNHTVGLVTIDFADQLGNKTDEFEITVN 363

Query: 315 AKAQIKKKSVAN----NVEILIPIPEDADSPT-FK-------YSRGNIKWVPEKNAILWK 362
                  + VAN     +++ +    D DS T FK       + R +   VP + +  W 
Sbjct: 364 IS---NSREVANIEDLRIDVQLQSNTDEDSETDFKIKVLRNTHGRFDNSVVPGQGS--WI 418

Query: 363 FSSFQGGKEYSMAAQLGLPSVSDAEPPKLKR--PVQIKFQIPYFTTSGIQVRYLKIEEPK 420
           F      K+        L    ++  P+L R   V   + +     SGI+V+ + I +  
Sbjct: 419 FD-----KDTPTGTLPVLRGCVESTEPRLLRVQRVTASYSLSGQLASGIRVKAINIGQLT 473

Query: 421 LQYNS-YPWVRYITQSGDDYTIR 442
            + N  +  V+Y T++G D+ IR
Sbjct: 474 TKSNRPFKGVKYATKTG-DFEIR 495

>KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {ON}
           Anc_2.522 YBR288C
          Length = 455

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 57/213 (26%), Positives = 94/213 (44%), Gaps = 43/213 (20%)

Query: 104 IRDNYIIIYELLDEMMDKGVPQVTE---TKMLKQYITQKSFK--LTRSAKKQKNVARPPT 158
           I +NY  +  L D ++D G+         K+  Q   +  F   +  +AK  +    P  
Sbjct: 107 IMNNYDRMTILFDLLIDGGIIDGNNFYMNKLRNQIPLKNDFSNFINDAAKSLQKGQAPSK 166

Query: 159 ELTNSVS-WRPEGIKYKKNEAFLDVIESINMLMTQQG------QVLRSEILGTVKVRSRL 211
            + N V  WR + IK  +NE ++DV E++ + + +        ++L   I G+V V S +
Sbjct: 167 TVDNEVVPWRSKEIKTVRNEIYVDVKETLYVTLIKSNRASHRLKLLNGYINGSVSVDSSI 226

Query: 212 SGMPDLKLGLNDKGIFTTNDQEDSPEPVVSSKKKNSNIELEDL--KFHQCVRLSKF--EN 267
            G+P L++                              + +D+  KFH CV +++F   +
Sbjct: 227 GGVPMLEVSF-------------------------GGCDFKDIIPKFHDCVEVNEFLTND 261

Query: 268 EKIITFIPPDGEFDLMTYR--LSTPIKPLIWCD 298
             II FIPPDG+F LM Y   LS+    LI C+
Sbjct: 262 GNIIKFIPPDGKFQLMEYSMALSSFNDNLISCN 294

>SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [1422
           bp, 473 aa] {ON} similar to uniprot|P38153 Saccharomyces
           cerevisiae YBR288C APM3 Mu3-like subunit of the yeast
           AP-3 complex which functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
           clathrin associated protein medium chain
          Length = 473

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 55/214 (25%), Positives = 88/214 (41%), Gaps = 53/214 (24%)

Query: 104 IRDNYIIIYELLDEMMDKGVPQVTETKMLKQYI------------TQKSFKLTRSA---- 147
           I  NY  +  L + M+D G P +T+   LK+ +            T  S   T S     
Sbjct: 120 ITKNYDRVTLLFNSMVDAGEPDITDLNRLKEIVPLKNNFARVINSTASSIGKTISNAEGN 179

Query: 148 ---KKQKNVARPPTELT-----NSVSWRPEGIKYKKNEAFLDVIESINMLMTQQGQV--- 196
               K  + +R  + ++      +V WR  G+KY  NE ++D+ E++N+++ +       
Sbjct: 180 QMFSKHSSNSRIGSSVSYANRDRTVPWRSAGVKYTNNELYVDMAETVNIILAKTRNSTSL 239

Query: 197 --LRSEILGTVKVRSRLSGMPDLKLGLNDKGIFTTNDQEDSPEPVVSSKKKNSNIELEDL 254
             +   I G V  +  LS  P ++L LN  G        D   P                
Sbjct: 240 VPISGSIDGEVGFKCYLSENPLVELDLNTNG-------HDLGIPA--------------- 277

Query: 255 KFHQCVRLSKFE-NEKIITFIPPDGEFDLMTYRL 287
            FH+CVR    + +   + FIPPDG+F LM Y +
Sbjct: 278 -FHRCVRTEGSDFHPGTLRFIPPDGDFCLMEYNI 310

>KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288C APM3
           Mu3-like subunit of the yeast AP-3 complex which
           functions in transport of alkaline phosphatase to the
           vacuole via the alternate pathway clathrin associated
           protein medium chain
          Length = 497

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 80/329 (24%), Positives = 136/329 (41%), Gaps = 72/329 (21%)

Query: 152 NVARPPTELTN------SVSWRPEGIKYKKNEAFLDVIESINMLMTQQGQVLRSEILGTV 205
           +V  P + L +       V WR  GI Y  NE F+D+ E IN ++ ++G++L   I G +
Sbjct: 192 HVGSPGSSLVDHSVDESGVPWRMSGINYANNEIFIDMSEEINAIV-EKGKLLTGHIKGCI 250

Query: 206 KVRSRLSGMP--DLKLGLNDKGIFTTNDQEDSPEPVVSSKKKNSNIELEDLKFHQCVRLS 263
            + + LSG P  ++KLGL D  +   N    +    +   K NS  +L   KF +     
Sbjct: 251 DLNNHLSGQPLVEMKLGLLDHKLSHLN---TTFHRCILEDKANSINDLIAGKFTK----- 302

Query: 264 KFENEKIITFIPPDGEFDLMTYRLSTPIKPLI-------WCDVKVQVHSGSRI---EIHC 313
                  +TF+PPDG   L  Y L     PL+         DV +Q   G R+   E+  
Sbjct: 303 -------LTFVPPDGRTRLCQYTL-----PLVKRDSNLGIIDVNLQSSLGKRLDEFEVRV 350

Query: 314 RAKAQIKKKSVAN---------NVEILIPIPEDADSPT-FKYSRGNIKWVPEKNAILWKF 363
                   K + N         N + ++ +  +         +RG + W  +KN +    
Sbjct: 351 TVGMSTTVKEIENMSMTIRMNRNFKGIVRVMRNTHGGVETNMTRGEVNWHLDKNMVCGSM 410

Query: 364 SSFQGGKEY-----------SMAAQLGLPS---VSDAEPPKLKRPVQIKFQIPYFTTSGI 409
           +  +   E            S ++ +  PS    S  +P  +K   + K Q+P    SGI
Sbjct: 411 AVLRCIAELEPELASNDQTSSRSSVVQPPSSHLTSLLQPSFIKCYYEHKSQLP----SGI 466

Query: 410 QVRYLKIEE--PKLQYNSYPWVRYITQSG 436
           +++ + +    PK     +  V+Y+T++G
Sbjct: 467 KLQSIDVVNGGPK---KPFKGVKYLTKTG 492

>TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {ON}
           Anc_2.522 YBR288C
          Length = 533

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 77/164 (46%), Gaps = 41/164 (25%)

Query: 143 LTRSAKKQKNVARPPTELTNSVS--WRPEGIKYKKNEAFLDVIESINMLMTQQG------ 194
           L +S K+Q N         ++V+  WR   + +  NE +LD++ESI++++  +       
Sbjct: 179 LQKSQKQQSNFPYQDMNFDSNVAVPWRMRNVDHVNNELYLDLVESIHVVLETKKRKSSYA 238

Query: 195 ----QVLRSEILGTVKVRSRLSGMPDLKLGLNDKGIFTTNDQEDSPEPVVSSKKKNSNIE 250
               +++   I+G   V+S L+G P +++ ++  G    ND                   
Sbjct: 239 NSTMKIVTGNIIGKALVKSVLNGNPIVEMKIDMAG----ND------------------- 275

Query: 251 LEDLKFHQCVRL------SKFENEKIITFIPPDGEFDLMTYRLS 288
           LE +  H+CV+        +FEN K+I F+PPDG F L  Y ++
Sbjct: 276 LESIFLHECVKSKDVDKDQEFENTKLIKFLPPDGSFKLFDYNIN 319

>Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {ON}
           YBR288C (APM3) - clathrin associated protein medium
           chain [contig 55] FULL
          Length = 456

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 62/129 (48%), Gaps = 28/129 (21%)

Query: 164 VSWRPEGIKYKKNEAFLDVIESINMLM---TQQGQV--LRSEILGTVKVRSRLSGMPDLK 218
           V WR  G+KY  NE ++DV+E+I++++    + GQ+  +R  I G V  RS L+G P + 
Sbjct: 186 VPWRTAGLKYSNNELYVDVVETIHVILRKTEKSGQLVPVRGLIDGYVDFRSHLTGNPVVA 245

Query: 219 LGLNDKGIFTTNDQEDSPEPVVSSKKKNSNIELEDLKFHQCVRLSKFENEKIITFIPPDG 278
           L LN  G        D   P +                H C +     + + + F+PPDG
Sbjct: 246 LKLNLHG-------HDLGVPAL----------------HPCCQAQYTGSPENLQFVPPDG 282

Query: 279 EFDLMTYRL 287
           +F LM Y +
Sbjct: 283 KFRLMQYTI 291

>TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {ON}
           Anc_2.522 YBR288C
          Length = 609

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 72/146 (49%), Gaps = 29/146 (19%)

Query: 164 VSWRPEGIKYKKNEAFLDVIESINMLMTQQG------------------QVLRSEILGTV 205
           V WR   +KY  NE ++DVIE I+++  ++                   +++R++I+G +
Sbjct: 256 VPWRSGNVKYTNNEIYIDVIEEIHVVYQRRNSKRYHKINQFNRNDNSPMKLIRADIIGEL 315

Query: 206 KVRSRLSGMPDLKLGLNDKGIFTTNDQEDSPEPVVSSKKKNSNIELEDLKFHQCVRLS-- 263
            VRS LS  P +++ L D+     +DQ+         K+ N  + +    FH CV +   
Sbjct: 316 NVRSYLSDNPMVEVTLVDR---NYSDQKTGWSENDLFKQLNLGLPM----FHDCVEIDYE 368

Query: 264 KFENEKI--ITFIPPDGEFDLMTYRL 287
           K  N+    I FIPPDG+F LM Y +
Sbjct: 369 KGINQDFRHIKFIPPDGKFSLMKYNI 394

>Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON}
           (137162..138889) [1728 nt, 576 aa]
          Length = 575

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 55/222 (24%), Positives = 98/222 (44%), Gaps = 60/222 (27%)

Query: 104 IRDNYIIIYELLDEMMDKGVPQV--TETKMLKQYI-------------TQKSFKLTRSAK 148
           I +NY  I  +   M++ G P V  T T  +K+ +              Q   K  +S++
Sbjct: 124 ISNNYDQISLIFYWMINGGEPNVGKTSTNFIKENVPMKVDLSKVFTSTAQNIQKAIQSSQ 183

Query: 149 KQKNVARPPTELTNSVS--WRPEGIKYKKNEAFLDVIESINML----------MTQQGQ- 195
            QK + +  +   N  +  WR + +K+  NE ++D++ES++++          +T+  Q 
Sbjct: 184 AQKPIFQDFSFQENKANAPWRSQNVKHNNNEIYIDLVESVHVVYQTKIRRSNELTRSKQS 243

Query: 196 ---VLRSEILGTVKVRSRLSGMPDLKLGLNDKGIFTTNDQEDSPEPVVSSKKKNSNIELE 252
              ++   + GT  V+S L+G P ++L L   G        D   P              
Sbjct: 244 IKKIVNGYLKGTAYVQSFLNGNPLVELQLELSG-------NDIGHP-------------- 282

Query: 253 DLKFHQCVRLSKF----ENEKI--ITFIPPDGEFDLMTYRLS 288
              FH+CV + ++    +N  I  + FIPPDG+F LM Y ++
Sbjct: 283 --SFHECVDIDEYLKNIDNSSISSLKFIPPDGKFTLMDYTIT 322

>ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 492

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 76/171 (44%), Gaps = 33/171 (19%)

Query: 132 LKQYITQKSFKLTRSAK--KQKNVARPPTELTNS--VSWRPEGIKYKKNEAFLDVIESIN 187
           L + I   +  L R+ +  +Q  +A  P  L +   V WR   +KY  +E ++D+IE+++
Sbjct: 156 LSKMINNTAHTLQRAVRQPRQGILAATPEILESEEVVPWRSGHLKYTSDEIYVDIIETVH 215

Query: 188 MLMTQQG-----QVLRSEILGTVKVRSRLSGMPDLKLGLNDKGIFTTNDQEDSPEPVVSS 242
           ++          Q++   I G V V+S LSG P +++ ++  G                 
Sbjct: 216 VIYQTHHRNNSVQMVSGTINGQVNVKSYLSGNPTVEMDMDLAG----------------- 258

Query: 243 KKKNSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMTYRLSTPIKP 293
                  E+     HQCV + +  +   + FIPPDG  +L+ Y +   + P
Sbjct: 259 ------NEMYAPSMHQCVEMPQ-GSPSSLCFIPPDGNCNLLNYTIDLDMNP 302

>Skud_2.419 Chr2 complement(746943..748397) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 69/145 (47%), Gaps = 34/145 (23%)

Query: 153 VARPPTELTNS---VSWR-PEGIKYKKNEAFLDVIESINMLMTQQGQVLR---SEILGTV 205
           ++R  T L  +   V WR  +  K++ NE ++D++E+ +++   +   LR     I GTV
Sbjct: 185 ISRGSTSLVENEEVVPWRTSKASKHENNELYVDLLETFHVVFETKKSRLRLVNGNIHGTV 244

Query: 206 KVRSRLSGMPDLKLGLNDKGIFTTNDQEDSPEPVVSSKKKNSNIELEDLKFHQCVRLSKF 265
            VRS L+  P + + LN  G        D   P +                H+CV + K 
Sbjct: 245 DVRSYLNNNPLVSVKLNTMG-------NDIGVPTL----------------HECVEI-KD 280

Query: 266 ENEKI---ITFIPPDGEFDLMTYRL 287
           + E +   ITFIPPDG+F L+ Y +
Sbjct: 281 DGEFLPSNITFIPPDGKFRLLEYSV 305

>Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 63/132 (47%), Gaps = 31/132 (23%)

Query: 164 VSWRPEGI-KYKKNEAFLDVIESINMLMTQQGQVLR---SEILGTVKVRSRLSGMPDLKL 219
           V WR     K++ NE ++D++E+ ++++ ++   LR    +I G V VRS L        
Sbjct: 199 VPWRTSKTSKHENNELYVDLLETFHVVLEKKKTRLRLVNGDICGAVDVRSYL-------- 250

Query: 220 GLNDKGIFTTNDQEDSPEPVVSSKKKNSNIELEDLKFHQCVRLSKFENE---KIITFIPP 276
                     ND      P+VS K      E+     H+CV ++  + E     ITFIPP
Sbjct: 251 ----------NDN-----PLVSVKLNTMGNEIGIPSLHECVEIND-DGEFTPSNITFIPP 294

Query: 277 DGEFDLMTYRLS 288
           DG+F L+ Y ++
Sbjct: 295 DGKFRLLEYSIN 306

>Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 59/128 (46%), Gaps = 29/128 (22%)

Query: 164 VSWR-PEGIKYKKNEAFLDVIESINMLMTQQGQVLR---SEILGTVKVRSRLSGMPDLKL 219
           V WR     K++ NE +LD++E+ +++  ++   +R     I GT+ VRS L+  P + +
Sbjct: 199 VPWRTSRASKHENNELYLDLLETFHVVFEKKKSHIRLVNGNIHGTLDVRSYLNDTPLVLV 258

Query: 220 GLNDKGIFTTNDQEDSPEPVVSSKKKNSNIELEDLKFHQCVRLSKFE--NEKIITFIPPD 277
            LN  G        D   P                  H+CV ++     +   ITFIPPD
Sbjct: 259 KLNTMG-------NDIGIP----------------SLHECVEINDGGVFSPSNITFIPPD 295

Query: 278 GEFDLMTY 285
           G+F L+ Y
Sbjct: 296 GKFRLLEY 303

>YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}
           APM3Mu3-like subunit of the clathrin associated protein
           complex (AP-3); functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
          Length = 483

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 66/140 (47%), Gaps = 38/140 (27%)

Query: 164 VSWR-PEGIKYKKNEAFLDVIESINMLMTQQGQVLR---SEILGTVKVRSRLSGMPDLKL 219
           V WR     K++ NE ++D++E+ +++  ++   LR     I G V VRS L+  P + +
Sbjct: 199 VPWRTSRASKHENNELYVDLLETFHVVFEKKKSHLRLLTGSIHGIVDVRSYLNDNPLVAV 258

Query: 220 GLNDKGIFTTNDQEDSPEPVVSSKKKNSNIELEDLKFHQCVRLSKFENEKI-----ITFI 274
            LN  G                     ++I +  L  H CV +    N+ +     ITFI
Sbjct: 259 KLNTMG---------------------NDIGIPSL--HDCVEI----NDGVFSPSNITFI 291

Query: 275 PPDGEFDLMTYR--LSTPIK 292
           PPDG+F L+ Y   LS+ +K
Sbjct: 292 PPDGKFRLLEYSVDLSSQVK 311

>CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288c APM3
           AP-3 complex subunit mu3 subunit
          Length = 543

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/136 (28%), Positives = 61/136 (44%), Gaps = 26/136 (19%)

Query: 166 WR-PEGIKYKKNEAFLDVIESINMLM----TQQGQVLRSEILGTVK-----VRSRLSGMP 215
           WR  + I   +NE + DV E I ++     + +    R +I G        VR  +SG  
Sbjct: 227 WRNGKNIHNDRNELYADVREVIQVVYQKKYSSKKNDSRRKIFGRRSGHLEYVRGNISGSV 286

Query: 216 DLKLGLNDKGIFTTNDQEDSPEPVVSSKKKNSNIELEDLKFHQCV-RLSKFENEKI--IT 272
           D++  L             +  P+V    K   +++    FH CV + S  + EKI  ++
Sbjct: 287 DMRCFL-------------TGNPLVEIALKQGGLDIGIPGFHDCVDKTSLLKQEKISKLS 333

Query: 273 FIPPDGEFDLMTYRLS 288
           FIPPDG F LM Y ++
Sbjct: 334 FIPPDGRFTLMQYNIN 349

>NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2.522
           YBR288C
          Length = 612

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 60/152 (39%), Gaps = 53/152 (34%)

Query: 164 VSWRPEGIKYKKNEAFLDVIESI-----NMLMTQQG-------------------QVLRS 199
           V WR   IK  KNE ++D+ E I     N +  ++G                   +++  
Sbjct: 259 VPWRNGNIKNAKNELYIDMKEDIHVNFRNQIKNRKGRTYDNNNSNGIRVNNPSCMKLMNG 318

Query: 200 EILGTVKVRSRLSGMPDLKLGLNDKGIFTTNDQEDSPEPVVSSKKKNSNIELEDLKFHQC 259
            I G + VRS L+G P +++ LN  G        D   P                  H C
Sbjct: 319 YITGVIDVRSYLNGNPIVEMKLNTCG-------NDMGTP----------------SLHPC 355

Query: 260 VRLS---KFENEKI---ITFIPPDGEFDLMTY 285
           V L      +++K+   + FIPPDG+F L  Y
Sbjct: 356 VELEGDMNGDDDKVMDSLKFIPPDGKFCLARY 387

>NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.522
           YBR288C
          Length = 489

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 67/326 (20%), Positives = 120/326 (36%), Gaps = 88/326 (26%)

Query: 164 VSWRPEGIKYKKNEAFLDVIESINMLMTQQG---------------QVLRSEILGTVKVR 208
           V WR  GIK  K E ++D+ E + +   +                 +++   I GT+ VR
Sbjct: 189 VPWRRNGIKDAKEELYVDLKEEVYVTYRKSDRHHGRDGIRTSNPSMELVSGHIKGTIDVR 248

Query: 209 SRLSGMPDLKLGLNDKGIFTTNDQEDSPEPVVSSKKKNSNIELEDLKFHQCVRLS----- 263
             L+G P + L  +  G    ND                   L    FH CV        
Sbjct: 249 CYLNGNPTVSLMFDTMG----ND-------------------LGIPSFHACVEQEDQVQE 285

Query: 264 --------KFENEKIITFIPPDGEFDLMTYRLS----TPIKPLIWCDVKVQVH------- 304
                    F+ ++++ F+PPDG+F L  Y +       +   +  D  +QV        
Sbjct: 286 QKQEQEPESFQGKRLLRFLPPDGKFRLAQYVIDLDGQGGMSRRMDRDGLIQVSFEDGLGL 345

Query: 305 SGSRIEIHCRAKAQIKKKSVANNVEILIPIPE-----DADSPTFKYSRGNIKWVPEKNAI 359
           +    E+    +  I   +V + VE L+   +     D++    + + G      E    
Sbjct: 346 NKDEFEVRLHVRESI---AVVDPVEDLVVTLQFSNGNDSNVKMLRATHGTFVGQDEDRQC 402

Query: 360 LWKFSSFQGGKEYSMAAQLGLP----SVSDAEPPKLKR-----PVQIKFQIPYFTTSGIQ 410
            W+F S     E S      LP     + D++  + K+      V +++  P    SG +
Sbjct: 403 SWRFDS----DEISAGT---LPVLRGCIDDSKHVQQKKRSCLTSVAVRYGYPGELASGCR 455

Query: 411 VRYLKIE--EPKLQYNSYPWVRYITQ 434
           V  L ++   P+++   +  VR +T+
Sbjct: 456 VTRLDVDVASPRVRGKVFKGVRCVTR 481

>KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa]
           {ON} Anc_2.522 YBR288C
          Length = 505

 Score = 38.5 bits (88), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 4/58 (6%)

Query: 235 SPEPVVSSKKKNSNIELEDLKFHQCVRLSKF----ENEKIITFIPPDGEFDLMTYRLS 288
           S +P+V     N   +L     H CV L        +   + FIPPDG+F LM Y ++
Sbjct: 266 SRDPIVEVTFNNHGCDLGTPALHDCVELDGVPEGPADHTTLKFIPPDGKFRLMEYSVT 323

>Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]
           {ON} similar to Ashbya gossypii AGL061W
          Length = 517

 Score = 38.5 bits (88), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 28/129 (21%), Positives = 52/129 (40%), Gaps = 28/129 (21%)

Query: 164 VSWRPEGIKYKKNEAFLDVIESINMLMTQQG----QVLRSEILGTVKVRSRLSGMPDLKL 219
           V WR   +    NE ++D++E++ + + Q       V    I G + ++  L G P +++
Sbjct: 195 VPWRIPNLSNVNNEIYVDMVETLTLNLKQSRPNSFHVFHGVISGKIDLKCYLRGNPTMQI 254

Query: 220 GLNDKGIFTTNDQEDSPEPVVSSKKKNSNIELEDLKFHQCVR-LSKFENEKIITFIPPDG 278
            L+  G                          +    H+C+   S   +   + FIPPDG
Sbjct: 255 NLHSAGH-----------------------AFKPSALHRCLDPSSSSFDSSSLRFIPPDG 291

Query: 279 EFDLMTYRL 287
           +F L+ Y +
Sbjct: 292 KFTLLEYTI 300

>Ecym_6007 Chr6 (17110..18723) [1614 bp, 537 aa] {ON} similar to
          Ashbya gossypii AFR274C
          Length = 537

 Score = 37.7 bits (86), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 38/70 (54%), Gaps = 7/70 (10%)

Query: 5  VAFCDSKGKPLLSRRYQDDVSQSAVE---SFQHLLLEREQESSVMPPCFHHNGIHYMYVQ 61
          V+     GKPLLSR+++D      +E   +FQ+L+    +E + +        + Y+Y+ 
Sbjct: 6  VSITTKSGKPLLSRQFRDITKDRVMELLSNFQNLVASSSREHTFV----EEEHVRYIYIP 61

Query: 62 YNDVYVLALT 71
          ++D Y++ +T
Sbjct: 62 FDDYYIILIT 71

>TDEL0D06430 Chr4 complement(1151544..1153154) [1611 bp, 536 aa]
           {ON} Anc_3.575 YFR051C
          Length = 536

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 40/85 (47%)

Query: 139 KSFKLTRSAKKQKNVARPPTELTNSVSWRPEGIKYKKNEAFLDVIESINMLMTQQGQVLR 198
           +  KLT  +K+    +   +  T +    PE  K   N   + + E++N  +T+ G +  
Sbjct: 243 RGMKLTGQSKRNIGTSARSSTATRASQQEPEEEKPANNGILISIKETVNAEITRDGAISS 302

Query: 199 SEILGTVKVRSRLSGMPDLKLGLND 223
           SE+ G +++R     +   KL L+D
Sbjct: 303 SELKGVLELRVNDRSLAHAKLTLDD 327

>KAFR0C04900 Chr3 (973774..975384) [1611 bp, 536 aa] {ON} Anc_7.8
           YOR372C
          Length = 536

 Score = 35.0 bits (79), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 86/199 (43%), Gaps = 26/199 (13%)

Query: 221 LNDKGIFTTNDQEDSPEPVVSSKKKNSNIELED----LKFHQCVRLSKFENEKIITFIPP 276
           LND G    + +  +   +V  +K   NIE       L+F +   L+K  N+K+ T +  
Sbjct: 271 LNDMGTPFNSSKLHNGNALVDFQKAKKNIEQSSPENLLRFTKNTILTKTPNKKLKTKMIN 330

Query: 277 DGEFDLMTYRLSTPIKPLIW-----CDVKVQVHSGSRIEIHC-------RAKAQIKKKSV 324
           D +     Y+  TP K   +      D  V   S + I+++        +  A+I   +V
Sbjct: 331 DNDNIQNNYKKDTPAKKTSYKSNELNDDIVYGSSPTTIQLNSSVTKSVSKLDAKIPNLTV 390

Query: 325 ANNVEILIPIPEDADSPTFKYSRGNIKWVPEKNAI--LWKFSSFQGGKEYSMAAQLGLPS 382
            NN+   +P+     SPT    + NI  + E   +  L K  SF+  +  S+++ L +P+
Sbjct: 391 ENNLLRRLPL-----SPT---PKSNISLISEGLTVPELPKMGSFKSERTLSISSNLSMPN 442

Query: 383 VSDAEPPKLKRPVQIKFQI 401
                 PK  +  Q KFQ+
Sbjct: 443 TIKTVKPKKNKAKQPKFQV 461

>KLLA0D11396g Chr4 complement(976408..978018) [1611 bp, 536 aa]
          {ON} similar to uniprot|P43621 Saccharomyces cerevisiae
          YFR051C RET2 Delta subunit of the coatomer complex
          (COPI) which coats Golgi-derived transport vesicles
          involved in retrograde transport between Golgi and ER
          Length = 536

 Score = 33.9 bits (76), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 37/70 (52%), Gaps = 7/70 (10%)

Query: 5  VAFCDSKGKPLLSRRYQDDVSQSAVE---SFQHLLLEREQESSVMPPCFHHNGIHYMYVQ 61
          V+    KGKPLLSR+++D      +E   +FQ L+    ++ + +        + Y+Y  
Sbjct: 6  VSITTRKGKPLLSRQFRDITKDRVMELLSNFQTLVANSSKQHTFV----EDEHVRYVYKP 61

Query: 62 YNDVYVLALT 71
          ++D Y++ +T
Sbjct: 62 FDDYYIILIT 71

>KAFR0J00130 Chr10 (23191..24822) [1632 bp, 543 aa] {ON} Anc_3.575
          YFR051C
          Length = 543

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 36/70 (51%), Gaps = 6/70 (8%)

Query: 5  VAFCDSKGKPLLSRRYQD---DVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYVQ 61
           +   S GKPLLSR+++D   D     + +FQ+L+  +   +       H   + Y+Y  
Sbjct: 6  ASITTSNGKPLLSRQFKDLSRDRVLELLSNFQNLVSLKHSSNHTFVEDDH---VRYVYKP 62

Query: 62 YNDVYVLALT 71
          ++D Y++ +T
Sbjct: 63 FDDFYIILIT 72

>ZYRO0E09746g Chr5 complement(772264..773880) [1617 bp, 538 aa] {ON}
           similar to uniprot|P43621 Saccharomyces cerevisiae
           YFR051C RET2 Delta subunit of the coatomer complex
           (COPI) which coats Golgi-derived transport vesicles
           involved in retrograde transport between Golgi and ER
          Length = 538

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 30/134 (22%), Positives = 57/134 (42%), Gaps = 8/134 (5%)

Query: 12  GKPLLSRRYQDDVSQSAVE---SFQHLLLEREQESSVMPPCFHHNGIHYMYVQYNDVYVL 68
           GKPLLSR++++      +E   +FQ L+     E + +      N + Y+Y  ++D Y++
Sbjct: 13  GKPLLSRQFRELTKDRVLELLSNFQSLVTNLSSEHTFV----EGNHVRYVYRPFDDYYII 68

Query: 69  ALTRSVSVNATTMFAFMYKLINXXXXXXXXXXXXSIRDNYIIIYELLDEMMDKGVPQVTE 128
            +T   S N     + +  L               I D+   I    DE++  G  +   
Sbjct: 69  LITNRQS-NIIEDLSTLNLLSQTVNNCLSSYDENEIYDSAFEILTAFDEVVIMGYKENLS 127

Query: 129 TKMLKQYITQKSFK 142
           +  +  Y+T +S +
Sbjct: 128 STQVTTYLTMESHE 141

>SAKL0F00594g Chr6 (54485..56122) [1638 bp, 545 aa] {ON} similar
          to uniprot|P43621 Saccharomyces cerevisiae YFR051C RET2
          Delta subunit of the coatomer complex (COPI) which
          coats Golgi-derived transport vesicles involved in
          retrograde transport between Golgi and ER
          Length = 545

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 34/70 (48%), Gaps = 7/70 (10%)

Query: 5  VAFCDSKGKPLLSRRYQD---DVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYVQ 61
          V+     GKPLLSR+++D   D     + +FQ L+      SS          + Y+Y  
Sbjct: 6  VSITTRSGKPLLSRQFRDISKDRVTELLSNFQGLVA----NSSSQHTFVEDEHVRYVYKP 61

Query: 62 YNDVYVLALT 71
          ++D Y++ +T
Sbjct: 62 FDDYYIILIT 71

>KLTH0G00528g Chr7 (36584..38485) [1902 bp, 633 aa] {ON} similar to
           uniprot|P43621 Saccharomyces cerevisiae YFR051C RET2
           Delta subunit of the coatomer complex (COPI) which coats
           Golgi-derived transport vesicles involved in retrograde
           transport between Golgi and ER
          Length = 633

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 36/70 (51%), Gaps = 7/70 (10%)

Query: 5   VAFCDSKGKPLLSRRYQD---DVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYVQ 61
           V+    +GKPLLSR+++D   D     + +FQ L+     +SS          + Y+Y  
Sbjct: 102 VSIVTRQGKPLLSRQFRDISKDRVTELLSNFQGLV----AKSSSQHTFVEDEHVRYVYKP 157

Query: 62  YNDVYVLALT 71
           ++D Y++ +T
Sbjct: 158 FDDYYIILIT 167

>Kpol_507.7 s507 (49309..50910) [1602 bp, 533 aa] {ON}
           (49309..50910) [1602 nt, 534 aa]
          Length = 533

 Score = 31.2 bits (69), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 36/74 (48%), Gaps = 7/74 (9%)

Query: 150 QKNVARPPTELTNSVSWRPEGIKYKKNEAFLDVIESINMLMTQQGQVLRSEILGTVKVRS 209
           + NV RP           PE IK + N   + + E+IN  +++ G V  +E+ G +++R 
Sbjct: 258 RSNVERPSRS-------EPEEIKPENNGILISIKETINAEISRDGAVRSTELKGVMELRI 310

Query: 210 RLSGMPDLKLGLND 223
               +   K+ L+D
Sbjct: 311 NDESLAHSKVTLSD 324

>TPHA0G03700 Chr7 complement(783421..785040) [1620 bp, 539 aa] {ON}
           Anc_3.575 YFR051C
          Length = 539

 Score = 30.8 bits (68), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 37/78 (47%), Gaps = 7/78 (8%)

Query: 146 SAKKQKNVARPPTELTNSVSWRPEGIKYKKNEAFLDVIESINMLMTQQGQVLRSEILGTV 205
           S+ +  N ARP  +        PE  K   N   + + E++N  +++ G +  SE+ G +
Sbjct: 260 SSIRSSNAARPAYQ-------EPEEEKPVNNGILITIKETVNAEISRDGAITSSELKGVM 312

Query: 206 KVRSRLSGMPDLKLGLND 223
           ++R   + +   KL L D
Sbjct: 313 ELRINKAELGHAKLTLTD 330

>Kwal_47.19292 s47 complement(1174899..1176515) [1617 bp, 538 aa]
          {ON} YFR051C (RET2) - vesicle coat component [contig
          344] FULL
          Length = 538

 Score = 30.4 bits (67), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 36/70 (51%), Gaps = 7/70 (10%)

Query: 5  VAFCDSKGKPLLSRRYQD---DVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYVQ 61
          V+    +GKPLLSR++++   D     + +FQ L+     +SS          + Y+Y  
Sbjct: 6  VSIVTRQGKPLLSRQFREISKDRVTELLSNFQGLV----AKSSSQHTFVEDEHVRYVYKP 61

Query: 62 YNDVYVLALT 71
          ++D Y++ +T
Sbjct: 62 FDDYYIILIT 71

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 46,712,175
Number of extensions: 2046089
Number of successful extensions: 6375
Number of sequences better than 10.0: 107
Number of HSP's gapped: 6356
Number of HSP's successfully gapped: 144
Length of query: 443
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 330
Effective length of database: 40,524,141
Effective search space: 13372966530
Effective search space used: 13372966530
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)