Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D12496g7.343ON70070035420.0
SAKL0F10912g7.343ON69369723050.0
TDEL0C020407.343ON70571522310.0
NCAS0A141107.343ON75364622050.0
ACL155W7.343ON69761121990.0
Kwal_56.246167.343ON71568021990.0
NDAI0A019407.343ON76560821940.0
CAGL0I03410g7.343ON72461721830.0
KNAG0C037407.343ON72761121740.0
KLTH0H01408g7.343ON72360521630.0
KAFR0B008307.343ON71062721570.0
YDL164C (CDC9)7.343ON75561321530.0
Kpol_2001.717.343ON72665321370.0
Suva_4.827.343ON75561321400.0
ZYRO0F11572g7.343ON73170521280.0
Skud_4.937.343ON75561321280.0
Smik_4.747.343ON84561321320.0
TBLA0E020507.343ON72068320020.0
TPHA0D045707.343ON73670019880.0
TPHA0M002606.18ON9664302762e-24
ZYRO0C07854g6.18ON9443942701e-23
YOR005C (DNL4)6.18ON9444142682e-23
Smik_15.1746.18ON9454172673e-23
Skud_15.1666.18ON9474122602e-22
Suva_15.1806.18ON9484122469e-21
KNAG0F028706.18ON9543812469e-21
CAGL0E02695g6.18ON9463982442e-20
TDEL0G045106.18ON9694072414e-20
TBLA0G010406.18ON9722432406e-20
KLLA0D01089g6.18ON9073802371e-19
KAFR0A050506.18ON9484512325e-19
KLTH0C11286g6.18ON9514322291e-18
ACR008W6.18ON9814092253e-18
NCAS0D026506.18ON9502432235e-18
NDAI0I022606.18ON9673012139e-17
Kwal_56.224146.18ON9632602084e-16
Kpol_1032.76.18ON9652301961e-14
KLTH0E11352g8.488ON98575790.70
TBLA0F004907.460ON119593743.3
KLLA0B13816g1.510ON41343724.5
TPHA0H007403.179ON30654707.2
NCAS0G034101.506ON1056188708.8
Kwal_23.29952.201ON143573709.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D12496g
         (700 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]...  1368   0.0  
SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {...   892   0.0  
TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {O...   863   0.0  
NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON} Anc_7...   853   0.0  
ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homo...   851   0.0  
Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL1...   851   0.0  
NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {O...   849   0.0  
CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {...   845   0.0  
KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.3...   842   0.0  
KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {...   837   0.0  
KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.3...   835   0.0  
YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}  ...   833   0.0  
Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON} (1951...   827   0.0  
Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}...   828   0.0  
ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} simila...   824   0.0  
Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}...   824   0.0  
Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}...   825   0.0  
TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.3...   775   0.0  
TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.3...   770   0.0  
TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON...   110   2e-24
ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} simila...   108   1e-23
YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON} ...   107   2e-23
Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {...   107   3e-23
Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {...   104   2e-22
Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {...    99   9e-21
KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.1...    99   9e-21
CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {...    99   2e-20
TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.1...    97   4e-20
TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {O...    97   6e-20
KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {O...    96   1e-19
KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6...    94   5e-19
KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} simila...    93   1e-18
ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic ho...    91   3e-18
NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.1...    91   5e-18
NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {O...    87   9e-17
Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {...    85   4e-16
Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON...    80   1e-14
KLTH0E11352g Chr5 (1014490..1017447) [2958 bp, 985 aa] {ON} simi...    35   0.70 
TBLA0F00490 Chr6 (128506..132093) [3588 bp, 1195 aa] {ON} Anc_7....    33   3.3  
KLLA0B13816g Chr2 complement(1209339..1210580) [1242 bp, 413 aa]...    32   4.5  
TPHA0H00740 Chr8 (149750..150670) [921 bp, 306 aa] {ON} Anc_3.17...    32   7.2  
NCAS0G03410 Chr7 (624153..627323) [3171 bp, 1056 aa] {ON} Anc_1....    32   8.8  
Kwal_23.2995 s23 (107723..112030) [4308 bp, 1435 aa] {ON} YNL088...    32   9.4  

>KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]
           {ON} similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination,
          Length = 700

 Score = 1368 bits (3542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 667/700 (95%), Positives = 667/700 (95%)

Query: 1   MFRLPIIRNWIVQRPVTFKVPSQQMSTKRSKQLTLDGFLRPNKKQKVDEEGDSAMPDETA 60
           MFRLPIIRNWIVQRPVTFKVPSQQMSTKRSKQLTLDGFLRPNKKQKVDEEGDSAMPDETA
Sbjct: 1   MFRLPIIRNWIVQRPVTFKVPSQQMSTKRSKQLTLDGFLRPNKKQKVDEEGDSAMPDETA 60

Query: 61  AAPPVKSESSLSNITPPKSRGETLTPVPSKLKFHSNIPFAELCDTFQAIEVTSSRLAITA 120
           AAPPVKSESSLSNITPPKSRGETLTPVPSKLKFHSNIPFAELCDTFQAIEVTSSRLAITA
Sbjct: 61  AAPPVKSESSLSNITPPKSRGETLTPVPSKLKFHSNIPFAELCDTFQAIEVTSSRLAITA 120

Query: 121 ICSKFLYSVLERDPESLVPITYLFIHKXXXXXXXXXXXXXXXXXXIKTISEACGKSIQQI 180
           ICSKFLYSVLERDPESLVPITYLFIHK                  IKTISEACGKSIQQI
Sbjct: 121 ICSKFLYSVLERDPESLVPITYLFIHKLGPDYEPGLELGLGESLLIKTISEACGKSIQQI 180

Query: 181 RNKYREIGDLGEIAMQARNVQPTMFKPKPLTVGEVFNNLVSIAKSNGKDSQSRKGSLIKK 240
           RNKYREIGDLGEIAMQARNVQPTMFKPKPLTVGEVFNNLVSIAKSNGKDSQSRKGSLIKK
Sbjct: 181 RNKYREIGDLGEIAMQARNVQPTMFKPKPLTVGEVFNNLVSIAKSNGKDSQSRKGSLIKK 240

Query: 241 MLTACKGYEAKFLIRSLESKLRIGLAEKTVLISVSKAILTHEHNGQEPSTEMVEQAESLI 300
           MLTACKGYEAKFLIRSLESKLRIGLAEKTVLISVSKAILTHEHNGQEPSTEMVEQAESLI
Sbjct: 241 MLTACKGYEAKFLIRSLESKLRIGLAEKTVLISVSKAILTHEHNGQEPSTEMVEQAESLI 300

Query: 301 RDAFCQVPNYEMIINVALQYGIMNLNQHIKLRPGIPLQPMLAKPTKSISEVLDRFQGTKF 360
           RDAFCQVPNYEMIINVALQYGIMNLNQHIKLRPGIPLQPMLAKPTKSISEVLDRFQGTKF
Sbjct: 301 RDAFCQVPNYEMIINVALQYGIMNLNQHIKLRPGIPLQPMLAKPTKSISEVLDRFQGTKF 360

Query: 361 TCEYKYDGERAQVHLCRDGSMKIYSRNGEDMTERYPEIDVKHYVKDLGATKSFIVDSEAV 420
           TCEYKYDGERAQVHLCRDGSMKIYSRNGEDMTERYPEIDVKHYVKDLGATKSFIVDSEAV
Sbjct: 361 TCEYKYDGERAQVHLCRDGSMKIYSRNGEDMTERYPEIDVKHYVKDLGATKSFIVDSEAV 420

Query: 421 AWDQEQGKILPFQVLSTRKRKGVELKDVKVRVCLYAFDILCLNDEPLINKSFHERRQILL 480
           AWDQEQGKILPFQVLSTRKRKGVELKDVKVRVCLYAFDILCLNDEPLINKSFHERRQILL
Sbjct: 421 AWDQEQGKILPFQVLSTRKRKGVELKDVKVRVCLYAFDILCLNDEPLINKSFHERRQILL 480

Query: 481 DTFNGTQGQFDFANELTTTNFDELQKYLDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNW 540
           DTFNGTQGQFDFANELTTTNFDELQKYLDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNW
Sbjct: 481 DTFNGTQGQFDFANELTTTNFDELQKYLDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNW 540

Query: 541 LKLKKDYLEGVGDSLDLVVLXXXXXXXXXXXXXXXFLLGCYNLDSEEFETCCKIGTGFSD 600
           LKLKKDYLEGVGDSLDLVVL               FLLGCYNLDSEEFETCCKIGTGFSD
Sbjct: 541 LKLKKDYLEGVGDSLDLVVLGAYYGRGKRTGTYGGFLLGCYNLDSEEFETCCKIGTGFSD 600

Query: 601 EMLQDLYTKLKDTTVEHPSTNVIYDSSAPADVWFEPSMLFEVLTADLSLSPVYKAGFEAF 660
           EMLQDLYTKLKDTTVEHPSTNVIYDSSAPADVWFEPSMLFEVLTADLSLSPVYKAGFEAF
Sbjct: 601 EMLQDLYTKLKDTTVEHPSTNVIYDSSAPADVWFEPSMLFEVLTADLSLSPVYKAGFEAF 660

Query: 661 GKGISLRFPRFVRIRDDKNVTDATSSDQVIEFYESQAHMK 700
           GKGISLRFPRFVRIRDDKNVTDATSSDQVIEFYESQAHMK
Sbjct: 661 GKGISLRFPRFVRIRDDKNVTDATSSDQVIEFYESQAHMK 700

>SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 693

 Score =  892 bits (2305), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/697 (63%), Positives = 531/697 (76%), Gaps = 20/697 (2%)

Query: 18  FKVPSQQMSTKRSKQLTLDGF-------------LRPN-KKQKVDEEGDSAMPDETAAAP 63
            K P + MSTK  KQ+TL  F             L P  K+ KVD    S +    A A 
Sbjct: 2   LKNPLRIMSTK--KQVTLARFFSSAKKGGNKEDKLEPQAKRAKVDPANTSELITNEAVAR 59

Query: 64  PVKSESSLSNITPPKSRGETLTPVPSKLKFHSNIPFAELCDTFQAIEVTSSRLAITAICS 123
            V   + +  + P  S   T TPV + +  HS IP++++C+ F  IE TSSRL+I  ICS
Sbjct: 60  SVSPPTPVVPVAPIIS---TSTPVMAPVH-HSKIPYSDVCNIFSEIESTSSRLSIVKICS 115

Query: 124 KFLYSVLERDPESLVPITYLFIHKXXXXXXXXXXXXXXXXXXIKTISEACGKSIQQIRNK 183
            F YSVL+++P +LVPITYLFI++                  +KTI+E+CGKS+QQ+R K
Sbjct: 116 NFFYSVLKQNPSNLVPITYLFINRLGPDYEPGLELGLGEGLLMKTIAESCGKSLQQVRAK 175

Query: 184 YREIGDLGEIAMQARNVQPTMFKPKPLTVGEVFNNLVSIAKSNGKDSQSRKGSLIKKMLT 243
           YREIGDLGE+A +AR VQPTMFKPKPLTVGEVFNNL SIAKS GKDSQ+RK  LIK+MLT
Sbjct: 176 YREIGDLGEVAQEARAVQPTMFKPKPLTVGEVFNNLKSIAKSQGKDSQTRKIQLIKRMLT 235

Query: 244 ACKGYEAKFLIRSLESKLRIGLAEKTVLISVSKAILTHEHNGQEPSTEMVEQAESLIRDA 303
           AC+G EAKFLIRSLESKLRIGLAEKTVLIS+SKA+L++EH+G+EPS+E+VE AE  +RDA
Sbjct: 236 ACQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLSYEHDGEEPSSELVENAEQRVRDA 295

Query: 304 FCQVPNYEMIINVALQYGIMNLNQHIKLRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCE 363
           FCQVPNYE++IN  L++GIM +N+H  L+PGIPL+PMLAKP+KSI+EVLDRF G KFTCE
Sbjct: 296 FCQVPNYEIVINTCLEHGIMEVNKHCVLKPGIPLKPMLAKPSKSITEVLDRFHGEKFTCE 355

Query: 364 YKYDGERAQVHLCRDGSMKIYSRNGEDMTERYPEIDVKHYVKDLGATKSFIVDSEAVAWD 423
           YKYDGERAQVHL  DGSM IYSRNGE+MTERYPE+ ++ Y+ D   T S I+D EAVAWD
Sbjct: 356 YKYDGERAQVHLLPDGSMNIYSRNGENMTERYPELHIRDYLADPETTHSLILDCEAVAWD 415

Query: 424 QEQGKILPFQVLSTRKRKGVELKDVKVRVCLYAFDILCLNDEPLINKSFHERRQILLDTF 483
            EQGKILPFQ+LSTRKRKGVE KDVKVRVCL+AFD+LC N + LIN S  ERR+ L    
Sbjct: 416 TEQGKILPFQILSTRKRKGVEAKDVKVRVCLFAFDMLCYNGQSLINNSLLERREYLQRVL 475

Query: 484 NGTQGQFDFANELTTTNFDELQKYLDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKL 543
               GQF FANEL ++N +++QKYL+QSVKD+CEGLMVK+LEGEESHYEPSKRSRNWLKL
Sbjct: 476 KPVTGQFQFANELNSSNLEDVQKYLEQSVKDACEGLMVKVLEGEESHYEPSKRSRNWLKL 535

Query: 544 KKDYLEGVGDSLDLVVLXXXXXXXXXXXXXXXFLLGCYNLDSEEFETCCKIGTGFSDEML 603
           KKDYL+GVGDSLDL VL               FLLGCYN D+ EFETCCKIGTGFSDEML
Sbjct: 536 KKDYLQGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEML 595

Query: 604 QDLYTKLKDTTVEHPSTNVIYDSSAPADVWFEPSMLFEVLTADLSLSPVYKAGFEAFGKG 663
             LY KLK +++E P    +YDSSA  DVWFEP+MLFEVLTADLSLSP+YKAG  A+GKG
Sbjct: 596 VSLYEKLKPSSLEQPKAFYVYDSSAEPDVWFEPTMLFEVLTADLSLSPIYKAGNSAYGKG 655

Query: 664 ISLRFPRFVRIRDDKNVTDATSSDQVIEFYESQAHMK 700
           ISLRFPRF+RIRDDK+V DATSS+Q++E YESQ +++
Sbjct: 656 ISLRFPRFIRIRDDKDVEDATSSEQIVELYESQVNLQ 692

>TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {ON}
           Anc_7.343 YDL164C
          Length = 705

 Score =  863 bits (2231), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/715 (60%), Positives = 537/715 (75%), Gaps = 27/715 (3%)

Query: 1   MFRLPIIRNWIVQRPVTFKVPSQQMSTKRSKQLTLDGFL----RPNKKQKVD-------- 48
           MFR       +V RP+   + ++ MS+ + KQ TL  F     + + K+KV+        
Sbjct: 1   MFR-------VVGRPLVELLINKGMSSGK-KQATLARFFSAVQKDDTKEKVNGDVKIIES 52

Query: 49  -EEGDSAMPDETAAAPPVKSESSLSNITPPKSRG--ETLTPVPSKLKFHSNIPFAELCDT 105
            +  D  +  +  ++ PVK ++S  +++P KS G      PV   L ++S +P++++C+ 
Sbjct: 53  RDNQDEPVTKKFKSSSPVKLQTS--SLSPVKSAGVESGDKPVSPDL-YYSKVPYSDVCNV 109

Query: 106 FQAIEVTSSRLAITAICSKFLYSVLERDPESLVPITYLFIHKXXXXXXXXXXXXXXXXXX 165
           FQ IE TSSRL+I  ICS+F   +++ +P++L+P TYLFI++                  
Sbjct: 110 FQEIEGTSSRLSIIKICSEFFSRIMKDNPQNLIPTTYLFINRLGPDYEPGLELGLGEGLL 169

Query: 166 IKTISEACGKSIQQIRNKYREIGDLGEIAMQARNVQPTMFKPKPLTVGEVFNNLVSIAKS 225
           +KTISEACGKS+ Q++N+YRE+GDLG+IA++ARNVQPTMFKPKPLTVGEVF NL +IA S
Sbjct: 170 MKTISEACGKSLVQVKNRYREMGDLGQIALEARNVQPTMFKPKPLTVGEVFENLRAIAHS 229

Query: 226 NGKDSQSRKGSLIKKMLTACKGYEAKFLIRSLESKLRIGLAEKTVLISVSKAILTHE-HN 284
            GKDSQ+RK  LIK+MLTAC+G EAKFLIRSLESKLRIGLAEKTVLIS+SKA+LT+E   
Sbjct: 230 QGKDSQTRKIKLIKRMLTACEGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLTNEGET 289

Query: 285 GQEPSTEMVEQAESLIRDAFCQVPNYEMIINVALQYGIMNLNQHIKLRPGIPLQPMLAKP 344
           G+EPS E+VEQAE+ IRDAFCQVPNYE++IN  L YGIM L++H +LRPGIPL+PMLAKP
Sbjct: 290 GKEPSMELVEQAEAKIRDAFCQVPNYEIVINACLDYGIMELDKHCRLRPGIPLKPMLAKP 349

Query: 345 TKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDGSMKIYSRNGEDMTERYPEIDVKHYV 404
           TKSI+EVLDRFQG  FT EYKYDGERAQVHL  DG+M+IYSRNGE+MTERYPEI ++ +V
Sbjct: 350 TKSITEVLDRFQGQTFTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEISIRDFV 409

Query: 405 KDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKRKGVELKDVKVRVCLYAFDILCLND 464
            DL  TK+ I+D EAVAWD+ Q KILPFQVLSTRKRK VE KDVKVRVCL+AFDI+C N 
Sbjct: 410 ADLEHTKTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEAKDVKVRVCLFAFDIICHNG 469

Query: 465 EPLINKSFHERRQILLDTFNGTQGQFDFANELTTTNFDELQKYLDQSVKDSCEGLMVKML 524
           E  INKS  ERR++L        G+F +A ELTT++ +ELQK+LDQSVKDSCEGLMVKML
Sbjct: 470 ERQINKSLRERRELLAQVTKPVAGEFQYAVELTTSSVEELQKFLDQSVKDSCEGLMVKML 529

Query: 525 EGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDLVVLXXXXXXXXXXXXXXXFLLGCYNLD 584
           +G ESHYEPSKRSRNWLKLKKDYL+GVGDSLDL VL               FLLGCYN D
Sbjct: 530 DGPESHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQD 589

Query: 585 SEEFETCCKIGTGFSDEMLQDLYTKLKDTTVEHPSTNVIYDSSAPADVWFEPSMLFEVLT 644
           S EFETCCKIGTGFSDEMLQ LY +   TT++ P    ++DSSA  DVWFEP+ LFEVLT
Sbjct: 590 SGEFETCCKIGTGFSDEMLQQLYERFSKTTLDGPKATYVFDSSAEPDVWFEPTTLFEVLT 649

Query: 645 ADLSLSPVYKAGFEAFGKGISLRFPRFVRIRDDKNVTDATSSDQVIEFYESQAHM 699
           ADLSLSPVYKAG   + KG+SLRFPRFVR+RDDK+V DATSS Q++E Y+ Q+H+
Sbjct: 650 ADLSLSPVYKAGASTYDKGVSLRFPRFVRLRDDKSVEDATSSAQIVELYQDQSHV 704

>NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON}
           Anc_7.343 YDL164C
          Length = 753

 Score =  853 bits (2205), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/646 (64%), Positives = 497/646 (76%), Gaps = 3/646 (0%)

Query: 57  DETAAAPPVKSESSLSNITPPKSRG-ETLTPVPSKLKFHSNIPFAELCDTFQAIEVTSSR 115
           DE+      K +   SN+ P K    E +T   +K  F S+IP+ E+C+ FQ IE TSSR
Sbjct: 109 DESTGPDLKKQKLEESNLEPSKEPTIENVTQDSTKPYF-SSIPYREVCNLFQEIESTSSR 167

Query: 116 LAITAICSKFLYSVLERDPESLVPITYLFIHKXXXXXXXXXXXXXXXXXXIKTISEACGK 175
           LAI  +CS F   +++ +P++L+P+TYLFI+K                  +KTISE+CGK
Sbjct: 168 LAIIKLCSDFFIKIMKENPQNLIPVTYLFINKLGPDYEPGLELGLGEGLLMKTISESCGK 227

Query: 176 SIQQIRNKYREIGDLGEIAMQARNVQPTMFKPKPLTVGEVFNNLVSIAKSNGKDSQSRKG 235
           S+ Q+RNKYRE+GDLG+IAM ARNVQPTMFKPKPLTVGEVF NL  IAKS GKDSQ+RK 
Sbjct: 228 SLAQVRNKYRELGDLGQIAMDARNVQPTMFKPKPLTVGEVFENLRLIAKSEGKDSQTRKI 287

Query: 236 SLIKKMLTACKGYEAKFLIRSLESKLRIGLAEKTVLISVSKAILTHE-HNGQEPSTEMVE 294
            LIK+MLTAC+G EAKFLIRSLESKLRIGLAEKTVLIS+SKA+L HE  + ++   E++E
Sbjct: 288 KLIKRMLTACEGTEAKFLIRSLESKLRIGLAEKTVLISLSKALLVHECKDNKDFDMELLE 347

Query: 295 QAESLIRDAFCQVPNYEMIINVALQYGIMNLNQHIKLRPGIPLQPMLAKPTKSISEVLDR 354
            AE  IRDAFCQVPNYE++IN  L+YGIM L  H  LRPGIPL+PMLAKPTK+I+E+LDR
Sbjct: 348 TAEQKIRDAFCQVPNYEIVINSCLKYGIMELETHCSLRPGIPLKPMLAKPTKAINEILDR 407

Query: 355 FQGTKFTCEYKYDGERAQVHLCRDGSMKIYSRNGEDMTERYPEIDVKHYVKDLGATKSFI 414
           FQG  FT EYKYDGERAQVHL  DG+M+IYSRNGE+MTERYPEI ++ ++ D   T + I
Sbjct: 408 FQGEIFTSEYKYDGERAQVHLLSDGTMRIYSRNGENMTERYPEIHIRDFIADPLVTSTLI 467

Query: 415 VDSEAVAWDQEQGKILPFQVLSTRKRKGVELKDVKVRVCLYAFDILCLNDEPLINKSFHE 474
           +D EAVAWD EQ KILPFQVLSTRKRK V+LKDVKV+VCL+AFDILC NDE LINKS  E
Sbjct: 468 LDCEAVAWDNEQNKILPFQVLSTRKRKDVDLKDVKVKVCLFAFDILCHNDEKLINKSLRE 527

Query: 475 RRQILLDTFNGTQGQFDFANELTTTNFDELQKYLDQSVKDSCEGLMVKMLEGEESHYEPS 534
           RRQIL +      G+F +A E+T++N DELQK+LDQSV DSCEGLMVKML+G ESHYEPS
Sbjct: 528 RRQILQEVTKSVTGEFQYATEMTSSNLDELQKFLDQSVHDSCEGLMVKMLDGIESHYEPS 587

Query: 535 KRSRNWLKLKKDYLEGVGDSLDLVVLXXXXXXXXXXXXXXXFLLGCYNLDSEEFETCCKI 594
           KRSRNWLKLKKDYLEG+GDSLDL V+               FLLGCYN D+ EFETCCKI
Sbjct: 588 KRSRNWLKLKKDYLEGIGDSLDLCVIGAYYGRGKRTGMYGGFLLGCYNQDTGEFETCCKI 647

Query: 595 GTGFSDEMLQDLYTKLKDTTVEHPSTNVIYDSSAPADVWFEPSMLFEVLTADLSLSPVYK 654
           GTGFSDEMLQ LYT+L  T ++ P    +YDSSA  DVWFEP++LFEVLTADLSLSP+YK
Sbjct: 648 GTGFSDEMLQQLYTRLTPTVLDGPKATFVYDSSAEPDVWFEPTLLFEVLTADLSLSPIYK 707

Query: 655 AGFEAFGKGISLRFPRFVRIRDDKNVTDATSSDQVIEFYESQAHMK 700
           AG   + KGISLRFPRF+R R+DK V DATSS+Q+IE YE+QAH +
Sbjct: 708 AGSSTYDKGISLRFPRFIRTREDKGVEDATSSEQIIELYENQAHTQ 753

>ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL164C (CDC9)
          Length = 697

 Score =  851 bits (2199), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/611 (66%), Positives = 482/611 (78%)

Query: 88  PSKLKFHSNIPFAELCDTFQAIEVTSSRLAITAICSKFLYSVLERDPESLVPITYLFIHK 147
           P K    +++ +A+LC  F+A+E TSSRL+IT +C+ F+YSVL+ DP  L+P+TYLFI++
Sbjct: 84  PVKPAASTSVMYADLCAVFEAVEATSSRLSITKLCADFMYSVLKCDPGHLIPVTYLFINR 143

Query: 148 XXXXXXXXXXXXXXXXXXIKTISEACGKSIQQIRNKYREIGDLGEIAMQARNVQPTMFKP 207
                             IKTIS+ACGKS  Q+R+ YRE GDLG +A QAR VQPTMFKP
Sbjct: 144 LGPDYEPGLELGLGEGILIKTISDACGKSAAQVRSSYRECGDLGTVAQQARVVQPTMFKP 203

Query: 208 KPLTVGEVFNNLVSIAKSNGKDSQSRKGSLIKKMLTACKGYEAKFLIRSLESKLRIGLAE 267
           KPLTV +VF+ L +IA++ GKDSQ +K  LIKKMLTAC+G EAK+LIRSLESKLRIGLAE
Sbjct: 204 KPLTVRDVFSTLQAIAQAEGKDSQGKKIRLIKKMLTACQGMEAKYLIRSLESKLRIGLAE 263

Query: 268 KTVLISVSKAILTHEHNGQEPSTEMVEQAESLIRDAFCQVPNYEMIINVALQYGIMNLNQ 327
           KTVL+++SKAILTHEH+G+EPS E V+ AE+L+RD FCQVPNYEMIIN ALQYGIMNL Q
Sbjct: 264 KTVLVALSKAILTHEHDGKEPSPEQVDAAEALVRDTFCQVPNYEMIINAALQYGIMNLPQ 323

Query: 328 HIKLRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDGSMKIYSRN 387
           H  L PGIPL+PMLAKPTKSI+EVLDRFQG +FTCEYKYDGERAQVHL  DG+++IYSRN
Sbjct: 324 HCVLTPGIPLKPMLAKPTKSITEVLDRFQGQRFTCEYKYDGERAQVHLMEDGTIRIYSRN 383

Query: 388 GEDMTERYPEIDVKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKRKGVELKD 447
            E+MTERYPEI    ++ +   T+S I+D EAVAWD E+ KILPFQVLSTRKRKGVELKD
Sbjct: 384 SENMTERYPEIQFHQFLANPQTTRSLIIDCEAVAWDNEKQKILPFQVLSTRKRKGVELKD 443

Query: 448 VKVRVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELTTTNFDELQKY 507
           VKVRVCL+AFD+L LN E L+  S  +RR+ L        G+  FANE+TT    ELQ Y
Sbjct: 444 VKVRVCLFAFDLLYLNGESLLKCSLADRRKHLYSVLKVVPGELQFANEITTMELSELQTY 503

Query: 508 LDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDLVVLXXXXXXX 567
           L+QSV  SCEGLMVKML+GEES YEPSKRSRNWLKLKKDYLEGVGDSLDL VL       
Sbjct: 504 LEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLKLKKDYLEGVGDSLDLAVLGAYYGRG 563

Query: 568 XXXXXXXXFLLGCYNLDSEEFETCCKIGTGFSDEMLQDLYTKLKDTTVEHPSTNVIYDSS 627
                   FLLGCYN D EEFETCCKIGTGFS+E+LQ L+ +LKDT +  P  +V YD S
Sbjct: 564 KRTGTYGGFLLGCYNPDLEEFETCCKIGTGFSEEVLQSLHAQLKDTVIAAPRGDVSYDDS 623

Query: 628 APADVWFEPSMLFEVLTADLSLSPVYKAGFEAFGKGISLRFPRFVRIRDDKNVTDATSSD 687
           +P DVWFEP+MLFEVLTADLSLSPVYKAG + +GKGISLRFPRF+RIR+DK+VTDATSSD
Sbjct: 624 SPPDVWFEPAMLFEVLTADLSLSPVYKAGRDVYGKGISLRFPRFLRIREDKSVTDATSSD 683

Query: 688 QVIEFYESQAH 698
           Q++EFY+ QA+
Sbjct: 684 QIVEFYQRQAN 694

>Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL164C
           (CDC9) - DNA ligase [contig 161] FULL
          Length = 715

 Score =  851 bits (2199), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/680 (62%), Positives = 506/680 (74%), Gaps = 5/680 (0%)

Query: 24  QMSTKRSKQLTLDGFLRPNKKQK--VDEEGDSAM--PDETAAAPPVKSESSLSNITPPKS 79
           Q S K+S+   +D     +K  +  VDE     +  P  +AA P  +   + + +   KS
Sbjct: 36  QESAKKSQLNAIDAKPESSKGSQPNVDETNHETLQKPQLSAAEPKTEFAMNPAKLAVEKS 95

Query: 80  RGETLTPVPSKLKFHSNIPFAELCDTFQAIEVTSSRLAITAICSKFLYSVLERDPESLVP 139
            G+      S  K  SN+ ++E+C  F  IE TSSRL I  +CS FLYSVL +  + LVP
Sbjct: 96  HGDVAKIGISAPK-DSNVMYSEMCSVFNEIEGTSSRLQIVKLCSDFLYSVLTKTRKDLVP 154

Query: 140 ITYLFIHKXXXXXXXXXXXXXXXXXXIKTISEACGKSIQQIRNKYREIGDLGEIAMQARN 199
           ITYL I+K                  +KTISE+CGKS+QQ++ +YRE+GDLG IA +AR+
Sbjct: 155 ITYLLINKLGPDYQPGLELGLGEGLLMKTISESCGKSLQQVKARYRELGDLGRIAQEARS 214

Query: 200 VQPTMFKPKPLTVGEVFNNLVSIAKSNGKDSQSRKGSLIKKMLTACKGYEAKFLIRSLES 259
           VQPTMFKPKPLT G VF NL  IA++ GKDSQ RK  LIKKMLTAC+G EAKFLIRSLES
Sbjct: 215 VQPTMFKPKPLTTGMVFANLQDIARAQGKDSQLRKVQLIKKMLTACEGVEAKFLIRSLES 274

Query: 260 KLRIGLAEKTVLISVSKAILTHEHNGQEPSTEMVEQAESLIRDAFCQVPNYEMIINVALQ 319
           KLRIGLAEK+VL+++SKAILTHEH G+EPS+++V+ AE  IRDAFCQVPNYE++IN AL+
Sbjct: 275 KLRIGLAEKSVLVALSKAILTHEHGGKEPSSDLVDAAEQKIRDAFCQVPNYEIVINAALE 334

Query: 320 YGIMNLNQHIKLRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDG 379
           +GIM L +H  L PGIPL+PMLAKP+KSISEVLDRFQG +FTCEYKYDGERAQVHL  DG
Sbjct: 335 HGIMELEKHCVLTPGIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDG 394

Query: 380 SMKIYSRNGEDMTERYPEIDVKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRK 439
           SM+IYSRNGE+MTERYPEI++  +V     T + I+D EAVAWD+++  ILPFQVLSTRK
Sbjct: 395 SMRIYSRNGENMTERYPEINISDFVAHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRK 454

Query: 440 RKGVELKDVKVRVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELTTT 499
           RKGV  +DVKVRVCL+AFDILC NDEPLINKS  ERR  L        G+   A+E+TT 
Sbjct: 455 RKGVVAEDVKVRVCLFAFDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTM 514

Query: 500 NFDELQKYLDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDLVV 559
           + DE+Q YLDQSVKD CEGLMVK+L+GEESHYEPSKRSRNWLKLKKDYL+GVGDSLDL V
Sbjct: 515 SLDEMQLYLDQSVKDCCEGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCV 574

Query: 560 LXXXXXXXXXXXXXXXFLLGCYNLDSEEFETCCKIGTGFSDEMLQDLYTKLKDTTVEHPS 619
           L               FLLGCYN D+ EFETCCKIGTGFSDEMLQ+LY KL  T +  P 
Sbjct: 575 LGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQNLYEKLSPTEIPEPK 634

Query: 620 TNVIYDSSAPADVWFEPSMLFEVLTADLSLSPVYKAGFEAFGKGISLRFPRFVRIRDDKN 679
              +Y  SA  DVW EPSMLFEVLTADLSLSPVYKAG  ++GKGISLRFPRF+RIRDDK+
Sbjct: 635 AFYVYSESAQPDVWLEPSMLFEVLTADLSLSPVYKAGGSSYGKGISLRFPRFIRIRDDKS 694

Query: 680 VTDATSSDQVIEFYESQAHM 699
           V DATSS+QVIEFYESQ+H+
Sbjct: 695 VEDATSSEQVIEFYESQSHI 714

>NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {ON}
           Anc_7.343 YDL164C
          Length = 765

 Score =  849 bits (2194), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/608 (67%), Positives = 481/608 (79%), Gaps = 2/608 (0%)

Query: 93  FHSNIPFAELCDTFQAIEVTSSRLAITAICSKFLYSVLERDPESLVPITYLFIHKXXXXX 152
           F   IP+ E+C  FQ IE TSSRL+I  +CS FL  ++++DP++L+P+TYLFI+K     
Sbjct: 155 FLCAIPYKEVCQLFQEIETTSSRLSIIKLCSDFLIKIMKQDPQNLIPVTYLFINKLGPDY 214

Query: 153 XXXXXXXXXXXXXIKTISEACGKSIQQIRNKYREIGDLGEIAMQARNVQPTMFKPKPLTV 212
                        +KTISE+CGKS+ QIR +YRE+GDLG+IA++ARNVQPTMFKPKPLTV
Sbjct: 215 EPGLELGLGEGLLMKTISESCGKSLTQIRAQYRELGDLGQIALEARNVQPTMFKPKPLTV 274

Query: 213 GEVFNNLVSIAKSNGKDSQSRKGSLIKKMLTACK-GYEAKFLIRSLESKLRIGLAEKTVL 271
           GEVFNNL  IAK+ GKDSQ++K  LIK+MLTAC+ G EAKFLIRSLESKLRIGLAEKTVL
Sbjct: 275 GEVFNNLKMIAKAAGKDSQTKKIKLIKRMLTACEDGVEAKFLIRSLESKLRIGLAEKTVL 334

Query: 272 ISVSKAILTHEHNGQEP-STEMVEQAESLIRDAFCQVPNYEMIINVALQYGIMNLNQHIK 330
           IS+SKA+L  E +  +    E++E AE  IRDAFCQVPNYE++IN  LQYGIMNLN+H  
Sbjct: 335 ISLSKALLVKEFDANKDFDMELLETAEGKIRDAFCQVPNYEIVINSCLQYGIMNLNEHCS 394

Query: 331 LRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDGSMKIYSRNGED 390
           LRPGIPL+PMLAKPTK+I+E+LDRFQG  FT EYKYDGERAQVHL  DG+M+IYSRNGE+
Sbjct: 395 LRPGIPLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDGTMRIYSRNGEN 454

Query: 391 MTERYPEIDVKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKRKGVELKDVKV 450
           MTERYPEI +  +VKD   TK+ I+D EAVAWD+EQ KILPFQVLSTRKRK V  KDVKV
Sbjct: 455 MTERYPEIHIGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKRKDVLAKDVKV 514

Query: 451 RVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELTTTNFDELQKYLDQ 510
           RVCL+AFDILC N   LIN S  ERR+IL        G+F +A ELTT+N DELQK+LDQ
Sbjct: 515 RVCLFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATELTTSNLDELQKFLDQ 574

Query: 511 SVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDLVVLXXXXXXXXXX 570
           SV DSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEG+GDSLDL VL          
Sbjct: 575 SVNDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVLGAYYGRGKRT 634

Query: 571 XXXXXFLLGCYNLDSEEFETCCKIGTGFSDEMLQDLYTKLKDTTVEHPSTNVIYDSSAPA 630
                FLLGCYN ++ EFETCCKIGTGFSDEMLQ L+ KLK T ++ P    IYDSSA  
Sbjct: 635 GTYGGFLLGCYNDNTGEFETCCKIGTGFSDEMLQQLHEKLKATVIDGPKATYIYDSSAEP 694

Query: 631 DVWFEPSMLFEVLTADLSLSPVYKAGFEAFGKGISLRFPRFVRIRDDKNVTDATSSDQVI 690
           DVWFEPS+LFEVLTADLSLSP+YKAG  A+ KG+SLRFPRF+RIR+DK V DATSS+Q+I
Sbjct: 695 DVWFEPSLLFEVLTADLSLSPIYKAGSSAYDKGVSLRFPRFIRIREDKGVEDATSSEQII 754

Query: 691 EFYESQAH 698
           E YE+Q+H
Sbjct: 755 ELYENQSH 762

>CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {ON}
           highly similar to uniprot|P04819 Saccharomyces
           cerevisiae YDL164c CDC9 DNA ligase
          Length = 724

 Score =  845 bits (2183), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/617 (64%), Positives = 493/617 (79%), Gaps = 2/617 (0%)

Query: 85  TPVPSKLKFHSNIPFAELCDTFQAIEVTSSRLAITAICSKFLYSVLERDPESLVPITYLF 144
           TP     KF   +P+++LC+ F+ IE TSSRLAI  +CS F   +++ DP++L+P+TYLF
Sbjct: 106 TPRQVDSKFFCKVPYSDLCNLFEEIEGTSSRLAIIKLCSDFFIKIMKEDPQNLIPVTYLF 165

Query: 145 IHKXXXXXXXXXXXXXXXXXXIKTISEACGKSIQQIRNKYREIGDLGEIAMQARNVQPTM 204
           I+K                  +KTISE+CGKS+QQI+N+YREIGDLG+IA++ARNVQPTM
Sbjct: 166 INKLGPDYEPGLELGLGENLLMKTISESCGKSMQQIKNQYREIGDLGQIALEARNVQPTM 225

Query: 205 FKPKPLTVGEVFNNLVSIAKSNGKDSQSRKGSLIKKMLTACKGYEAKFLIRSLESKLRIG 264
           FKPKPL VGEVF NL +IAKS GKDSQ++K  LIK+MLTAC+G EAKFLIRSLESKLRIG
Sbjct: 226 FKPKPLVVGEVFENLKTIAKSQGKDSQTKKMKLIKRMLTACQGTEAKFLIRSLESKLRIG 285

Query: 265 LAEKTVLISVSKAILTHE--HNGQEPSTEMVEQAESLIRDAFCQVPNYEMIINVALQYGI 322
           LAEKTVLI++SKA+L H+  ++ +EPS ++VEQAE  IRDAFCQVPNYE++IN  L YGI
Sbjct: 286 LAEKTVLIALSKALLIHDEKYSNKEPSMDVVEQAEQKIRDAFCQVPNYELVINACLDYGI 345

Query: 323 MNLNQHIKLRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDGSMK 382
           M L++H  ++PGIPL+PMLAKPTK+I+EVLDRFQG  FT EYKYDGERAQVHL +DG+M+
Sbjct: 346 MKLDEHCTIQPGIPLKPMLAKPTKAINEVLDRFQGQTFTSEYKYDGERAQVHLLKDGTMR 405

Query: 383 IYSRNGEDMTERYPEIDVKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKRKG 442
           IYSRNGE+MTERYPEI +K ++ D  +T S I+D EAVAWD+EQ KILPFQVL+TRKRK 
Sbjct: 406 IYSRNGENMTERYPEIQIKDFLADPASTTSLILDCEAVAWDKEQNKILPFQVLTTRKRKD 465

Query: 443 VELKDVKVRVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELTTTNFD 502
           V + +VKVRVCL+AFDIL  ND  LIN+   +RR++L +     +G+F +A ++TT+N D
Sbjct: 466 VNINEVKVRVCLFAFDILLHNDMRLINEPLSKRREVLHEVTKPVEGEFQYATQMTTSNLD 525

Query: 503 ELQKYLDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDLVVLXX 562
           ELQK+LD+SVK+SCEGLMVKM++G ES+YEPSKRSRNWLKLKKDYLEGVGDSLDL VL  
Sbjct: 526 ELQKFLDESVKNSCEGLMVKMMDGVESYYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGA 585

Query: 563 XXXXXXXXXXXXXFLLGCYNLDSEEFETCCKIGTGFSDEMLQDLYTKLKDTTVEHPSTNV 622
                        FLLGCYN DSE+FETCCKIGTGFS+EMLQ LY KL  T ++ P    
Sbjct: 586 YFGRGKRTGTYGGFLLGCYNADSEDFETCCKIGTGFSEEMLQTLYEKLSPTVIDGPKGTY 645

Query: 623 IYDSSAPADVWFEPSMLFEVLTADLSLSPVYKAGFEAFGKGISLRFPRFVRIRDDKNVTD 682
           ++DSSA  DVWFEP+MLFEVLTADLSLSP+YKAG   + KGISLRFPRF+RIRDDK+V D
Sbjct: 646 VFDSSAEPDVWFEPTMLFEVLTADLSLSPIYKAGSSVYDKGISLRFPRFLRIRDDKSVED 705

Query: 683 ATSSDQVIEFYESQAHM 699
           ATSS+Q+IE Y++Q+H+
Sbjct: 706 ATSSEQIIEMYQNQSHV 722

>KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.343
           YDL164C
          Length = 727

 Score =  842 bits (2174), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/611 (65%), Positives = 483/611 (79%), Gaps = 2/611 (0%)

Query: 92  KFHSNIPFAELCDTFQAIEVTSSRLAITAICSKFLYSVLERDPESLVPITYLFIHKXXXX 151
           +F+S +P+A+LC+ FQ IE  SSRLAI  +CS FL SV++ DP +L+P+TYLFI+K    
Sbjct: 116 EFYSTVPYADLCNLFQEIEGISSRLAIIKLCSSFLISVMKLDPRNLIPMTYLFINKLGPD 175

Query: 152 XXXXXXXXXXXXXXIKTISEACGKSIQQIRNKYREIGDLGEIAMQARNVQPTMFKPKPLT 211
                         IKTI+E+CG+S+QQI+ KY EIGDLG+IA++AR VQPTMFKPKPLT
Sbjct: 176 YMPGLELGLGENLLIKTIAESCGRSLQQIKTKYHEIGDLGQIALEARKVQPTMFKPKPLT 235

Query: 212 VGEVFNNLVSIAKSNGKDSQSRKGSLIKKMLTACKGYEAKFLIRSLESKLRIGLAEKTVL 271
           VGEVF NL SIA S GKDSQ++K  LIK+MLT+C+G EAKFLIRSLESKLRIGLAEKTVL
Sbjct: 236 VGEVFQNLKSIASSQGKDSQTKKIKLIKRMLTSCQGVEAKFLIRSLESKLRIGLAEKTVL 295

Query: 272 ISVSKAILTHEHNGQEPSTEM--VEQAESLIRDAFCQVPNYEMIINVALQYGIMNLNQHI 329
           IS+SKA+L +E+   +   +M  VE AE  IRDAFCQVPNYE++I+  L++GIMNL+QH 
Sbjct: 296 ISLSKALLVYEYGESDKDIDMETVENAEQKIRDAFCQVPNYEVVIDSCLKHGIMNLDQHC 355

Query: 330 KLRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDGSMKIYSRNGE 389
            LRP IPL+PMLAKPTKSISE+ DRFQ  KFTCEYKYDGERAQVHL  DG+M+IYSRNGE
Sbjct: 356 SLRPAIPLKPMLAKPTKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDGTMRIYSRNGE 415

Query: 390 DMTERYPEIDVKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKRKGVELKDVK 449
           +MTERYPEI ++ +V DL  TKS I+D EAVAWD+EQ KILPFQVLSTRKRK V++ ++K
Sbjct: 416 NMTERYPEIHIRDFVTDLSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDVDINEIK 475

Query: 450 VRVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELTTTNFDELQKYLD 509
           VRVCL+AFDIL  NDE LINKS  ERR IL        G+F FA E+TTTN +ELQ +LD
Sbjct: 476 VRVCLFAFDILLHNDEKLINKSLQERRDILHSITKEVTGEFQFATEMTTTNLEELQSFLD 535

Query: 510 QSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDLVVLXXXXXXXXX 569
           QSVK+SCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYL GVGDSLDL VL         
Sbjct: 536 QSVKNSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFGRGKR 595

Query: 570 XXXXXXFLLGCYNLDSEEFETCCKIGTGFSDEMLQDLYTKLKDTTVEHPSTNVIYDSSAP 629
                 FLLGCYN D+ EFET CKIGTGFSDE+LQ L+ +LK T ++ P    ++D SA 
Sbjct: 596 TGNYGGFLLGCYNQDTGEFETACKIGTGFSDEVLQQLHERLKSTVIDLPKATYVFDPSAE 655

Query: 630 ADVWFEPSMLFEVLTADLSLSPVYKAGFEAFGKGISLRFPRFVRIRDDKNVTDATSSDQV 689
            DVWFEP++LFEVLTADLSLSPVYKAG   + KG+SLRFPRF+R+R+DK V DATSS+Q+
Sbjct: 656 PDVWFEPTLLFEVLTADLSLSPVYKAGSSTYDKGVSLRFPRFLRLREDKGVEDATSSEQI 715

Query: 690 IEFYESQAHMK 700
           +E YE+QA+++
Sbjct: 716 VEMYENQANLQ 726

>KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 723

 Score =  837 bits (2163), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/605 (65%), Positives = 476/605 (78%)

Query: 95  SNIPFAELCDTFQAIEVTSSRLAITAICSKFLYSVLERDPESLVPITYLFIHKXXXXXXX 154
           S I +AE+C+ F  IE TSSRL I  +C  FLYSVL +  + +VPITYL I+K       
Sbjct: 118 SKILYAEMCNVFNEIEGTSSRLQIVKLCGDFLYSVLLKARKDIVPITYLLINKLGPDYQP 177

Query: 155 XXXXXXXXXXXIKTISEACGKSIQQIRNKYREIGDLGEIAMQARNVQPTMFKPKPLTVGE 214
                      +KTISE+CGKS+QQI+ +YRE+GDLG IA +AR VQPTMFKPKPLT GE
Sbjct: 178 GLELGLGEGLLMKTISESCGKSLQQIKARYRELGDLGRIAQEARAVQPTMFKPKPLTTGE 237

Query: 215 VFNNLVSIAKSNGKDSQSRKGSLIKKMLTACKGYEAKFLIRSLESKLRIGLAEKTVLISV 274
           VF+NL +IA+S GKDSQ RK  LIK+MLTAC+G EAKFLIRSLESKLRIGLAEK+VL+++
Sbjct: 238 VFSNLQAIARSQGKDSQLRKVQLIKRMLTACQGLEAKFLIRSLESKLRIGLAEKSVLVAL 297

Query: 275 SKAILTHEHNGQEPSTEMVEQAESLIRDAFCQVPNYEMIINVALQYGIMNLNQHIKLRPG 334
           SKA+LT+EHNG+EPS+E+V+ AE  IRDAFCQVPNY+++I  AL++GIM L++H  L PG
Sbjct: 298 SKALLTYEHNGKEPSSELVDTAEQKIRDAFCQVPNYQIVIETALEHGIMELDKHCVLTPG 357

Query: 335 IPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDGSMKIYSRNGEDMTER 394
           IPL+PMLAKP+KSISEVLDRFQG +FTCEYKYDGERAQVHL  DGSM+IYSRNGE+MTER
Sbjct: 358 IPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTER 417

Query: 395 YPEIDVKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKRKGVELKDVKVRVCL 454
           YPEI +  ++ D   T + I+D EAVAWD+E+  ILPFQVLSTRKRKGV ++DVKVRVCL
Sbjct: 418 YPEIRISDFIADPARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVAVEDVKVRVCL 477

Query: 455 YAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELTTTNFDELQKYLDQSVKD 514
           +AFDILC NDEPLI +   ERR  L        G+   A+E+TT + DELQ YLDQ+V+D
Sbjct: 478 FAFDILCYNDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDELQHYLDQAVRD 537

Query: 515 SCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDLVVLXXXXXXXXXXXXXX 574
            CEGLMVK+LEGEESHYEPSKRSRNWLKLKKDYL+GVGDSLDL VL              
Sbjct: 538 CCEGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKRTGTYG 597

Query: 575 XFLLGCYNLDSEEFETCCKIGTGFSDEMLQDLYTKLKDTTVEHPSTNVIYDSSAPADVWF 634
            FLLGCYN DS E+ETCCKIGTGFS+EMLQ L+ +L  T +  P    ++  SAP DVWF
Sbjct: 598 GFLLGCYNQDSGEYETCCKIGTGFSEEMLQTLFDRLSPTAIPTPKAFYVHSESAPPDVWF 657

Query: 635 EPSMLFEVLTADLSLSPVYKAGFEAFGKGISLRFPRFVRIRDDKNVTDATSSDQVIEFYE 694
           EP++LFEVLTADLSLSPVYKAG  ++GKGISLRFPRF+R+RDDK   +ATSS+QV+EFYE
Sbjct: 658 EPTLLFEVLTADLSLSPVYKAGTSSYGKGISLRFPRFIRLRDDKTPEEATSSEQVVEFYE 717

Query: 695 SQAHM 699
           SQ+H+
Sbjct: 718 SQSHV 722

>KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.343
           YDL164C
          Length = 710

 Score =  835 bits (2157), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/627 (63%), Positives = 490/627 (78%), Gaps = 1/627 (0%)

Query: 74  ITPPKSRGETLTPVPSKLKFHSNIPFAELCDTFQAIEVTSSRLAITAICSKFLYSVLERD 133
           ++P +S     +    K +F  +IP+A++C  FQ IE  SSRL I  +CS+F    ++++
Sbjct: 82  LSPIESSKTDSSETTVKQEFVCDIPYADVCVLFQEIENISSRLQIIKLCSEFFTKAMKQN 141

Query: 134 PESLVPITYLFIHKXXXXXXXXXXXXXXXXXXIKTISEACGKSIQQIRNKYREIGDLGEI 193
             +L+P+TYLFI+K                  +KTISE+CGKS+QQ++  Y++IGDLG I
Sbjct: 142 TANLIPLTYLFINKLGPDYEMGLELGLGENLLMKTISESCGKSLQQVKLDYKDIGDLGTI 201

Query: 194 AMQARNVQPTMFKPKPLTVGEVFNNLVSIAKSNGKDSQSRKGSLIKKMLTACKGYEAKFL 253
           AM ARNVQPTMFKPKPLTVG VF NL  IAKS+GKDSQ +K  LIKK+LTACKG EAK+L
Sbjct: 202 AMNARNVQPTMFKPKPLTVGYVFQNLKLIAKSSGKDSQLKKIRLIKKLLTACKGIEAKYL 261

Query: 254 IRSLESKLRIGLAEKTVLISVSKAILTHEHNGQ-EPSTEMVEQAESLIRDAFCQVPNYEM 312
           IRSLESKLRIGLAEK+VLIS+SKA+L +E+N   +P  E++E+AE  IRDAFCQ+PNYE+
Sbjct: 262 IRSLESKLRIGLAEKSVLISLSKALLINEYNNTLDPDMELIEKAEQKIRDAFCQIPNYEI 321

Query: 313 IINVALQYGIMNLNQHIKLRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQ 372
           +IN  L+YGIMNL++H  LRPGIPL+PMLAKPTK+I EV DRFQ   FT EYKYDGERAQ
Sbjct: 322 VINSCLKYGIMNLDEHCSLRPGIPLKPMLAKPTKTIMEVFDRFQNIHFTSEYKYDGERAQ 381

Query: 373 VHLCRDGSMKIYSRNGEDMTERYPEIDVKHYVKDLGATKSFIVDSEAVAWDQEQGKILPF 432
           VHL  DGSM+IYSRNGE+MTERYPEI+V  ++KDL  TKS I+D EAVAWD+E+ KILPF
Sbjct: 382 VHLMNDGSMRIYSRNGENMTERYPEINVTDFIKDLNLTKSLIIDCEAVAWDREEKKILPF 441

Query: 433 QVLSTRKRKGVELKDVKVRVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDF 492
           QVLSTRKRK V++KD+KVR+CL+AFDILC NDE LINKS  ERR+IL        G+F +
Sbjct: 442 QVLSTRKRKDVDIKDIKVRICLFAFDILCHNDEKLINKSLRERREILHSVTREVHGEFTY 501

Query: 493 ANELTTTNFDELQKYLDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVG 552
           A EL+T N DELQ +LDQSVKDSCEGLMVK+L+GE+SHYEPSKRSRNWLKLKKDYL+GVG
Sbjct: 502 AKELSTNNLDELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLKKDYLDGVG 561

Query: 553 DSLDLVVLXXXXXXXXXXXXXXXFLLGCYNLDSEEFETCCKIGTGFSDEMLQDLYTKLKD 612
           DSLDL VL               FLLGCYN D+ EFET CKIGTGFSDE+LQ LY +LK 
Sbjct: 562 DSLDLCVLGAFYGRGKRTGTYGGFLLGCYNQDTGEFETACKIGTGFSDEVLQSLYDRLKS 621

Query: 613 TTVEHPSTNVIYDSSAPADVWFEPSMLFEVLTADLSLSPVYKAGFEAFGKGISLRFPRFV 672
           TT++ P    IYDSSA  DVWFEP++LFEVLTADLS+SP+YKAG   + KGISLRFPRF+
Sbjct: 622 TTIDGPKATYIYDSSAQPDVWFEPTLLFEVLTADLSMSPIYKAGASTYSKGISLRFPRFI 681

Query: 673 RIRDDKNVTDATSSDQVIEFYESQAHM 699
           R+R+DK+V +ATSS+Q+IE YE+Q+H+
Sbjct: 682 RLREDKSVEEATSSEQIIELYENQSHV 708

>YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}
           CDC9DNA ligase found in the nucleus and mitochondria, an
           essential enzyme that joins Okazaki fragments during DNA
           replication; also acts in nucleotide excision repair,
           base excision repair, and recombination
          Length = 755

 Score =  833 bits (2153), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/613 (65%), Positives = 479/613 (78%), Gaps = 5/613 (0%)

Query: 93  FHSNIPFAELCDTFQAIEVTSSRLAITAICSKFLYSVLERDPESLVPITYLFIHKXXXXX 152
           + SNIP++E+C+ F  IE  SSRL I  ICS F   ++++  ++L+P TYLFI++     
Sbjct: 142 YSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRLGPDY 201

Query: 153 XXXXXXXXXXXXXIKTISEACGKSIQQIRNKYREIGDLGEIAMQARNVQPTMFKPKPLTV 212
                        +KTISE CGKS+ QI+ KY++IGDLGEIAM ARNVQPTMFKPKPLTV
Sbjct: 202 EAGLELGLGENLLMKTISETCGKSMSQIKLKYKDIGDLGEIAMGARNVQPTMFKPKPLTV 261

Query: 213 GEVFNNLVSIAKSNGKDSQSRKGSLIKKMLTACKGYEAKFLIRSLESKLRIGLAEKTVLI 272
           GEVF NL +IAK+ GKDSQ +K  LIK+MLTACKG EAKFLIRSLESKLRIGLAEKTVLI
Sbjct: 262 GEVFKNLRAIAKTQGKDSQLKKMKLIKRMLTACKGIEAKFLIRSLESKLRIGLAEKTVLI 321

Query: 273 SVSKAILTHEHNGQEPS-----TEMVEQAESLIRDAFCQVPNYEMIINVALQYGIMNLNQ 327
           S+SKA+L H+ N ++        +++E A+  IRDAFCQVPNYE++IN  L++GIMNL++
Sbjct: 322 SLSKALLLHDENREDSPDKDVPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDK 381

Query: 328 HIKLRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDGSMKIYSRN 387
           +  LRPGIPL+PMLAKPTK+I+EVLDRFQG  FT EYKYDGERAQVHL  DG+M+IYSRN
Sbjct: 382 YCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRN 441

Query: 388 GEDMTERYPEIDVKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKRKGVELKD 447
           GE+MTERYPEI++  +++DL  TK+ I+D EAVAWD++QGKILPFQVLSTRKRK VEL D
Sbjct: 442 GENMTERYPEINITDFIQDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDVELND 501

Query: 448 VKVRVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELTTTNFDELQKY 507
           VKV+VCL+AFDILC NDE LINKS  ERR+ L        G+F +A ++TT N DELQK+
Sbjct: 502 VKVKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITTNNLDELQKF 561

Query: 508 LDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDLVVLXXXXXXX 567
           LD+SV  SCEGLMVKMLEG ESHYEPSKRSRNWLKLKKDYLEGVGDSLDL VL       
Sbjct: 562 LDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRG 621

Query: 568 XXXXXXXXFLLGCYNLDSEEFETCCKIGTGFSDEMLQDLYTKLKDTTVEHPSTNVIYDSS 627
                   FLLGCYN D+ EFETCCKIGTGFSDEMLQ L+ +L  T ++ P    ++DSS
Sbjct: 622 KRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHDRLTPTIIDGPKATFVFDSS 681

Query: 628 APADVWFEPSMLFEVLTADLSLSPVYKAGFEAFGKGISLRFPRFVRIRDDKNVTDATSSD 687
           A  DVWFEP+ LFEVLTADLSLSP+YKAG   F KG+SLRFPRF+RIR+DK V DATSSD
Sbjct: 682 AEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSD 741

Query: 688 QVIEFYESQAHMK 700
           Q++E YE+Q+HM+
Sbjct: 742 QIVELYENQSHMQ 754

>Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON}
           (195103..197283) [2181 nt, 727 aa]
          Length = 726

 Score =  827 bits (2137), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/653 (63%), Positives = 494/653 (75%), Gaps = 10/653 (1%)

Query: 56  PDETAAAPPVKSESSLSNITPPKSRGETLTPVPSK---LKFHSNIPFAELCDTFQAIEVT 112
           P  +A +   K E SL+  + P+    T   VPS    +KF S +P+A+LC+ FQ +E T
Sbjct: 75  PTTSAGSVTSKDEPSLT--SSPQKPIVTPAKVPSNTKPVKFFSTVPYADLCEVFQEVEST 132

Query: 113 SSRLAITAICSKFLYSVLERDPESLVPITYLFIHKXXXXXXXXXXXXXXXXXXIKTISEA 172
           SSRL+I  ICS FL  V+++DP++LVPITYLFI+K                  +KTISE+
Sbjct: 133 SSRLSIIKICSDFLIKVMKQDPQNLVPITYLFINKLGPDYEPGLELGLGEGLLMKTISES 192

Query: 173 CGKSIQQIRNKYREIGDLGEIAMQARNVQPTMFKPKPLTVGEVFNNLVSIAKSNGKDSQS 232
           CGKS+QQ++N+YREIGDLG+IA  ARNVQPTMFKPKPLTVGEVF NL  IA+S GKDSQ 
Sbjct: 193 CGKSMQQLKNQYREIGDLGQIAQDARNVQPTMFKPKPLTVGEVFQNLKDIAQSQGKDSQQ 252

Query: 233 RKGSLIKKMLTACKGYEAKFLIRSLESKLRIGLAEKTVLISVSKAILTHEH-NGQEPSTE 291
           RK  LIK+MLTACKG EAKFLIRSLESKLRIGLAEKTVLIS+SKA+L +E+   ++PS E
Sbjct: 253 RKMRLIKRMLTACKGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLNEYETSKDPSME 312

Query: 292 MVEQAESLIRDAFCQVPNYEMIINVALQYGIMNLNQHIKLRPGIPLQPMLAKPTKSISEV 351
           ++E AE  IRDAFCQVPNYE+II   L  GIM L+ + KLRPGIPL+PMLAKPTK+I+EV
Sbjct: 313 LIETAEEKIRDAFCQVPNYEIIIQSCLNDGIMELDNNCKLRPGIPLKPMLAKPTKAINEV 372

Query: 352 LDRFQGTKFTCEYKYDGERAQVHLCRDGSMKIYSRNGEDMTERYPEIDVKHY-VKDLGAT 410
           LD FQG +FTCEYKYDGER QVHL  +G M+IYSRNGE+MTERYPE+ ++ + VKD   T
Sbjct: 373 LDAFQGEEFTCEYKYDGERGQVHLLSNGEMRIYSRNGENMTERYPELHIEDFLVKDESNT 432

Query: 411 K---SFIVDSEAVAWDQEQGKILPFQVLSTRKRKGVELKDVKVRVCLYAFDILCLNDEPL 467
               S I+D E VAWD EQ KILPFQVLSTRKRKGVELKDVKVRVCL+AFDIL  N E L
Sbjct: 433 DKEVSLILDCEVVAWDNEQNKILPFQVLSTRKRKGVELKDVKVRVCLFAFDILYYNGEGL 492

Query: 468 INKSFHERRQILLDTFNGTQGQFDFANELTTTNFDELQKYLDQSVKDSCEGLMVKMLEGE 527
           I K+  ERR+IL +      G+F +A  L T   DE+QK+LDQ++KDSCEGLMVK+L+GE
Sbjct: 493 ITKTLRERRKILHEVTKCVPGEFQYATSLITAELDEIQKFLDQAIKDSCEGLMVKILDGE 552

Query: 528 ESHYEPSKRSRNWLKLKKDYLEGVGDSLDLVVLXXXXXXXXXXXXXXXFLLGCYNLDSEE 587
           ES YEPSKRSRNWLKLKKDYL GVGDSLDL V+               FLLGCYN DS E
Sbjct: 553 ESRYEPSKRSRNWLKLKKDYLAGVGDSLDLCVMGAYYGKGKRTGTYGGFLLGCYNQDSGE 612

Query: 588 FETCCKIGTGFSDEMLQDLYTKLKDTTVEHPSTNVIYDSSAPADVWFEPSMLFEVLTADL 647
           +ETCCKIGTGFSDEML  LY   ++  +E P +   +DSSA  D+WFEP +LFEVLTADL
Sbjct: 613 YETCCKIGTGFSDEMLTKLYELFREEEIEVPKSFYNFDSSAEPDIWFEPKVLFEVLTADL 672

Query: 648 SLSPVYKAGFEAFGKGISLRFPRFVRIRDDKNVTDATSSDQVIEFYESQAHMK 700
           SLSP+YKAG   + KGISLRFPRF+RIRDDK+V DATSSDQ+IE YE+Q+H++
Sbjct: 673 SLSPIYKAGSATYDKGISLRFPRFLRIRDDKSVEDATSSDQIIEMYENQSHIQ 725

>Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score =  828 bits (2140), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/613 (64%), Positives = 475/613 (77%), Gaps = 5/613 (0%)

Query: 93  FHSNIPFAELCDTFQAIEVTSSRLAITAICSKFLYSVLERDPESLVPITYLFIHKXXXXX 152
           + SNIP++E+C+ F  IE  SSRL I  ICS F   ++++  ++L+P TYLFI++     
Sbjct: 142 YSSNIPYSEVCEVFNEIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRLGPDY 201

Query: 153 XXXXXXXXXXXXXIKTISEACGKSIQQIRNKYREIGDLGEIAMQARNVQPTMFKPKPLTV 212
                        +KTISE+CGKS+ QI+ KY+EIGDLGEIAM ARNVQPTMFKPKPLTV
Sbjct: 202 EPGLELGLGENLLMKTISESCGKSMNQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPLTV 261

Query: 213 GEVFNNLVSIAKSNGKDSQSRKGSLIKKMLTACKGYEAKFLIRSLESKLRIGLAEKTVLI 272
           GEVF NL SIAK+ GKDSQ RK  LIK+MLTAC+G EAKFLIRSLESKLRIGLAEKTVLI
Sbjct: 262 GEVFKNLRSIAKTQGKDSQLRKMKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLI 321

Query: 273 SVSKAILTHEHNGQEPST-----EMVEQAESLIRDAFCQVPNYEMIINVALQYGIMNLNQ 327
           S+SKA+L H  NG+         +++E A+  IRDAFCQVPNYE++IN  L++GIMNL++
Sbjct: 322 SLSKALLLHGGNGENSHVNDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDK 381

Query: 328 HIKLRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDGSMKIYSRN 387
              L+PGIPL+PMLAKPTK+I+EVLDRFQG  FT EYKYDGERAQVHL  DG+M+IYSRN
Sbjct: 382 FCTLKPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLDDGTMRIYSRN 441

Query: 388 GEDMTERYPEIDVKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKRKGVELKD 447
           GE+MTERYPEI +  +++DL ATK+ I+D EAVAWD+EQGKILPFQVLSTRKRK VEL D
Sbjct: 442 GENMTERYPEIKITDFIQDLDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRKDVELSD 501

Query: 448 VKVRVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELTTTNFDELQKY 507
           VKVRVCL+AFD+LC N E LINKS  ERR+ L        G+F +A ++ T N DELQK+
Sbjct: 502 VKVRVCLFAFDVLCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTDNLDELQKF 561

Query: 508 LDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDLVVLXXXXXXX 567
           LD+SV  SCEGLMVKMLEG ESHYEPSKRSRNWLKLKKDYLEGVGDSLDL VL       
Sbjct: 562 LDESVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRG 621

Query: 568 XXXXXXXXFLLGCYNLDSEEFETCCKIGTGFSDEMLQDLYTKLKDTTVEHPSTNVIYDSS 627
                   FLLGCYN D+ EFETCCKIGTGFSDE LQ L+ +L  T ++ P    ++DSS
Sbjct: 622 KRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDESLQQLHERLTPTIIDGPKATFVFDSS 681

Query: 628 APADVWFEPSMLFEVLTADLSLSPVYKAGFEAFGKGISLRFPRFVRIRDDKNVTDATSSD 687
           A  DVWFEP+ LFEVLTADLSLSP+YKAG   F KG+SLRFPRF+RIR+DK V DATSS+
Sbjct: 682 AEPDVWFEPTTLFEVLTADLSLSPIYKAGSTTFAKGVSLRFPRFLRIREDKGVEDATSSE 741

Query: 688 QVIEFYESQAHMK 700
           Q++E YE+Q+H++
Sbjct: 742 QIVELYENQSHVQ 754

>ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} similar
           to uniprot|P04819 Saccharomyces cerevisiae YDL164C CDC9
           DNA ligase found in the nucleus and mitochondria an
           essential enzyme that joins Okazaki fragments during DNA
           replication also acts in nucleotide excision repair base
           excision repair and recombination
          Length = 731

 Score =  824 bits (2128), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/705 (59%), Positives = 509/705 (72%), Gaps = 34/705 (4%)

Query: 28  KRSKQLTLDGFLRP--NKKQKVDEEGDSAMPDETAAA--PPVKSESSLSNITP--PKSRG 81
           K++KQ TL  F     ++     +    A P  T      PV+S S+    +P    S G
Sbjct: 27  KQAKQATLAKFFSSVKDRNSPTKKNATPAFPTTTNVKRESPVRSNSNEKESSPMFDDSNG 86

Query: 82  ETLT-----------PVPSKLKFHSN---------------IPFAELCDTFQAIEVTSSR 115
            +             P P KLK  S+               +P+A++C+ FQ IE TSSR
Sbjct: 87  RSSACSSAGLEMESAPAPKKLKMESDSNSTSKNNQDDHFSTVPYADVCNIFQEIESTSSR 146

Query: 116 LAITAICSKFLYSVLERDPESLVPITYLFIHKXXXXXXXXXXXXXXXXXXIKTISEACGK 175
           L+I  ICS F   +++ D  +LVP TYLFI+K                  +KTISE+CGK
Sbjct: 147 LSIIKICSDFFTQIVKEDSRNLVPTTYLFINKLGPDYEPGMELGLGEGLLMKTISESCGK 206

Query: 176 SIQQIRNKYREIGDLGEIAMQARNVQPTMFKPKPLTVGEVFNNLVSIAKSNGKDSQSRKG 235
           S+ Q++N+YRE+GDLG+IAM+ARNVQPTMFKPKPLTVGEVF NL +IA + GKDSQ++K 
Sbjct: 207 SLAQVKNRYREMGDLGQIAMEARNVQPTMFKPKPLTVGEVFVNLRNIANAQGKDSQNKKI 266

Query: 236 SLIKKMLTACKGYEAKFLIRSLESKLRIGLAEKTVLISVSKAILTHEHN-GQEPSTEMVE 294
            LIK+MLTAC+G EAKFLIRSLESKLRIGLAEKTVLIS+S A+L HE     EPS E V+
Sbjct: 267 KLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSNALLRHEQGLDVEPSDEAVD 326

Query: 295 QAESLIRDAFCQVPNYEMIINVALQYGIMNLNQHIKLRPGIPLQPMLAKPTKSISEVLDR 354
           +AE  IRDAFCQVPNYE++IN  L++GI  L++H +L PGIPL+PMLAKPTK+I+EVLDR
Sbjct: 327 KAEQSIRDAFCQVPNYEIVINTCLEHGISQLHKHCQLTPGIPLKPMLAKPTKAITEVLDR 386

Query: 355 FQGTKFTCEYKYDGERAQVHLCRDGSMKIYSRNGEDMTERYPEIDVKHYVKDLGATKSFI 414
           FQG  F  EYKYDGERAQ+HL  DG+M+IYSRNGE+MTERYPEID++ ++ D  +T+S I
Sbjct: 387 FQGQLFVSEYKYDGERAQLHLLPDGTMRIYSRNGENMTERYPEIDIRDFLSD-PSTESLI 445

Query: 415 VDSEAVAWDQEQGKILPFQVLSTRKRKGVELKDVKVRVCLYAFDILCLNDEPLINKSFHE 474
           +D EAVAWD+EQGKILPFQVLSTRKRK V+ KDVKVRVCL+AFD+LC N EPLINKS  E
Sbjct: 446 LDCEAVAWDKEQGKILPFQVLSTRKRKDVDAKDVKVRVCLFAFDLLCHNGEPLINKSLRE 505

Query: 475 RRQILLDTFNGTQGQFDFANELTTTNFDELQKYLDQSVKDSCEGLMVKMLEGEESHYEPS 534
           R+  L        G+F +AN+L T N +ELQ +LDQSVKDSCEGLMVKML+G ESHYEPS
Sbjct: 506 RQDDLQKVTKPVDGEFRYANKLITANIEELQHFLDQSVKDSCEGLMVKMLDGPESHYEPS 565

Query: 535 KRSRNWLKLKKDYLEGVGDSLDLVVLXXXXXXXXXXXXXXXFLLGCYNLDSEEFETCCKI 594
           KRSRNWLKLKKDYL GVGDSLDL VL               FLLGCYN D+ E+ETCCKI
Sbjct: 566 KRSRNWLKLKKDYLNGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEYETCCKI 625

Query: 595 GTGFSDEMLQDLYTKLKDTTVEHPSTNVIYDSSAPADVWFEPSMLFEVLTADLSLSPVYK 654
           GTGFS+E+LQ LY +LK T +E P+   +YDS+   DVWFEP++LFEVL ADLSLSPVYK
Sbjct: 626 GTGFSEELLQQLYDRLKPTAMEAPAAFYVYDSAQQPDVWFEPTLLFEVLAADLSLSPVYK 685

Query: 655 AGFEAFGKGISLRFPRFVRIRDDKNVTDATSSDQVIEFYESQAHM 699
           AG   + KGISLRFPRF+RIRDDK+V +ATSS+QV++ YE+QAH+
Sbjct: 686 AGSAQYDKGISLRFPRFLRIRDDKSVEEATSSEQVVDLYEAQAHL 730

>Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score =  824 bits (2128), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/613 (64%), Positives = 476/613 (77%), Gaps = 5/613 (0%)

Query: 93  FHSNIPFAELCDTFQAIEVTSSRLAITAICSKFLYSVLERDPESLVPITYLFIHKXXXXX 152
           + SNIP++E+C+ F  IE  SSRL I  ICS F   ++ +  ++L+P TYLFI++     
Sbjct: 142 YSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMNQSSKNLIPTTYLFINRLGPDY 201

Query: 153 XXXXXXXXXXXXXIKTISEACGKSIQQIRNKYREIGDLGEIAMQARNVQPTMFKPKPLTV 212
                        +KTISE+CGKS+ QI+ KY+E+GDLGEIAM ARNVQPTMFKPK LTV
Sbjct: 202 EAGLELGLGENLLMKTISESCGKSMSQIKLKYKEMGDLGEIAMGARNVQPTMFKPKALTV 261

Query: 213 GEVFNNLVSIAKSNGKDSQSRKGSLIKKMLTACKGYEAKFLIRSLESKLRIGLAEKTVLI 272
           GEVF NL +IAK+ GKDSQ RK  LIK+MLTAC+G EAKFLIRSLESKLRIGLAEKTVLI
Sbjct: 262 GEVFKNLRTIAKTQGKDSQLRKMKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLI 321

Query: 273 SVSKAILTHEHNGQ-----EPSTEMVEQAESLIRDAFCQVPNYEMIINVALQYGIMNLNQ 327
           S+SKA+L H+ N +     E   +++E A+  IRDAFCQVPNYE++IN  L +GIMNL++
Sbjct: 322 SLSKALLLHDENKENSPDKEIPMDVLESAQQRIRDAFCQVPNYEIVINSCLNHGIMNLDK 381

Query: 328 HIKLRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDGSMKIYSRN 387
           +  LRPGIPL+PMLAKPTK+I+EVLDRFQG  FT EYKYDGERAQVHL  DG+M+IYSRN
Sbjct: 382 YCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRN 441

Query: 388 GEDMTERYPEIDVKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKRKGVELKD 447
           GE+MTERYPEI +  +++DL +TK+ I+D EAVAWD+EQ KILPFQ+LSTRKRK VEL D
Sbjct: 442 GENMTERYPEIKITDFIQDLNSTKNLILDCEAVAWDKEQKKILPFQILSTRKRKDVELHD 501

Query: 448 VKVRVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELTTTNFDELQKY 507
           VKV+VCL+AFDILC NDE LINKS  ERR+ L        G+F +A ++ T N DELQK+
Sbjct: 502 VKVKVCLFAFDILCYNDERLINKSLRERREHLAKVTKVVPGEFQYATQIITNNLDELQKF 561

Query: 508 LDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDLVVLXXXXXXX 567
           LD+SV +SCEGLMVKML+G ESHYEPSKRSRNWLKLKKDYLEGVGDSLDL VL       
Sbjct: 562 LDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRG 621

Query: 568 XXXXXXXXFLLGCYNLDSEEFETCCKIGTGFSDEMLQDLYTKLKDTTVEHPSTNVIYDSS 627
                   FLLGCYN D+ EFETCCKIGTGFSDEMLQ L+ +L  T ++ P    ++D+S
Sbjct: 622 KRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHERLTPTIIDGPKATFVFDAS 681

Query: 628 APADVWFEPSMLFEVLTADLSLSPVYKAGFEAFGKGISLRFPRFVRIRDDKNVTDATSSD 687
           A  DVWFEP+ LFEVLTADLSLSP+YKAG   F KG+SLRFPRF+RIR+DK V DATSSD
Sbjct: 682 AEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSD 741

Query: 688 QVIEFYESQAHMK 700
           Q+IE YE+Q+H++
Sbjct: 742 QIIELYENQSHVQ 754

>Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}
           YDL164C (REAL)
          Length = 845

 Score =  825 bits (2132), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/613 (64%), Positives = 476/613 (77%), Gaps = 5/613 (0%)

Query: 93  FHSNIPFAELCDTFQAIEVTSSRLAITAICSKFLYSVLERDPESLVPITYLFIHKXXXXX 152
           + SNIP++++C+ F  IE  SSRL I  ICS F   V+++  ++L+P TYLFI++     
Sbjct: 232 YSSNIPYSDVCEVFNQIEAISSRLEIIRICSDFFIKVMKQSSKNLIPTTYLFINRLGPDY 291

Query: 153 XXXXXXXXXXXXXIKTISEACGKSIQQIRNKYREIGDLGEIAMQARNVQPTMFKPKPLTV 212
                        +KTISE+CGKS+ QI+ KY+EIGDLGEIAM ARNVQPTMFKPKPLTV
Sbjct: 292 EAGLELGLGENLLMKTISESCGKSMSQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPLTV 351

Query: 213 GEVFNNLVSIAKSNGKDSQSRKGSLIKKMLTACKGYEAKFLIRSLESKLRIGLAEKTVLI 272
           GEVF NL +IAK+ GKDSQ RK  LIK+MLTAC+G EAKFLIRSLESKLRIGLAEKTVLI
Sbjct: 352 GEVFKNLRTIAKTQGKDSQLRKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLI 411

Query: 273 SVSKAILTHEHNGQEPS-----TEMVEQAESLIRDAFCQVPNYEMIINVALQYGIMNLNQ 327
           S+SKA+L H+ N +  +      +++E A+  IRDAFCQVPNYE++IN  L++GIMNL++
Sbjct: 412 SLSKALLLHDENRENSADKDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDK 471

Query: 328 HIKLRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDGSMKIYSRN 387
           +  LRPGIPL+PMLAKPTK+I+EVLDRFQG  FT EYKYDGERAQVHL  DG+M+IYSRN
Sbjct: 472 YCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRN 531

Query: 388 GEDMTERYPEIDVKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKRKGVELKD 447
           GE+MTERYPEI +  +++DL  TK+ I+D EAVAWD++Q KILPFQVLSTRKRK VEL D
Sbjct: 532 GENMTERYPEIKITDFIQDLDITKNLILDCEAVAWDKDQAKILPFQVLSTRKRKDVELND 591

Query: 448 VKVRVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELTTTNFDELQKY 507
           VKVRVCL+AFDILC NDE LIN S  ERR+ L        G+F +A ++ T N DELQK+
Sbjct: 592 VKVRVCLFAFDILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNNLDELQKF 651

Query: 508 LDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDLVVLXXXXXXX 567
           LD+SV  SCEGLMVKML+G ESHYEPSKRSRNWLKLKKDYLEGVGDSLDL VL       
Sbjct: 652 LDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRG 711

Query: 568 XXXXXXXXFLLGCYNLDSEEFETCCKIGTGFSDEMLQDLYTKLKDTTVEHPSTNVIYDSS 627
                   FLLGCYN D+ EFETCCKIGTGFSDEMLQ L+ +L  T ++ P    ++DSS
Sbjct: 712 KRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHARLTPTIIDGPKATYVFDSS 771

Query: 628 APADVWFEPSMLFEVLTADLSLSPVYKAGFEAFGKGISLRFPRFVRIRDDKNVTDATSSD 687
           A  DVWFEP+ LFEVLTADLSLSP+YKAG   F KG+SLRFPRF+RIR+DK V DATSSD
Sbjct: 772 AEPDVWFEPTTLFEVLTADLSLSPIYKAGSTTFDKGVSLRFPRFLRIREDKGVEDATSSD 831

Query: 688 QVIEFYESQAHMK 700
           Q++E YE+Q+H++
Sbjct: 832 QIVELYENQSHVQ 844

>TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.343
           YDL164C
          Length = 720

 Score =  775 bits (2002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/683 (56%), Positives = 484/683 (70%), Gaps = 16/683 (2%)

Query: 31  KQLTLDGFLRPNKKQKVDEEGDSAMP---------DETAAAPPVKSESSLSNITPPKSRG 81
           KQ+TL  F    K++  DEE  S+ P                 ++ +     + P +   
Sbjct: 40  KQVTLARFF--AKREPKDEEKQSSSPVKEQVQIQGQPQQEQVKIQPQEQKQIVVPQEVTT 97

Query: 82  ETLTPVPSKLK--FHSNIPFAELCDTFQAIEVTSSRLAITAICSKFLYSVLERDPESLVP 139
            T TP P+K      S++P+A+LC  F+ IE  SSRL IT +C+ F    L+ DP  LVP
Sbjct: 98  STQTPRPTKKSKPATSSLPYADLCQLFETIESESSRLTITNLCTAFFSRTLQLDPSLLVP 157

Query: 140 ITYLFIHKXXXXXXXXXXXXXXXXXXIKTISEACGKSIQQIRNKYREIGDLGEIAMQARN 199
           +TYL I+K                   K I  ACG S QQ++ +YR++GDLG++AM  R 
Sbjct: 158 VTYLCINKLGPDYSGVELGLGEGLLL-KAIGSACGVSQQQLKLQYRKLGDLGQLAMSTRV 216

Query: 200 VQPT--MFKPKPLTVGEVFNNLVSIAKSNGKDSQSRKGSLIKKMLTACKGYEAKFLIRSL 257
           +QPT  MFK +PLT+ +VF+ L  IA S GKDSQ++K ++IK++LT+C+G EAKFLIRSL
Sbjct: 217 LQPTITMFKLEPLTITKVFDTLAKIAASQGKDSQNQKINMIKRLLTSCQGVEAKFLIRSL 276

Query: 258 ESKLRIGLAEKTVLISVSKAILTHEHNGQEPSTEMVEQAESLIRDAFCQVPNYEMIINVA 317
           ESKLRIGLAEKTVL S+++A++ HE        +    AE +I+D+FCQ+PNYE+II  +
Sbjct: 277 ESKLRIGLAEKTVLTSLARALVIHEKGNDNIQDDDYSNAEQIIKDSFCQIPNYEIIITTS 336

Query: 318 LQYGIMNLNQHIKLRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQVHLCR 377
           LQYG+  L  HIKL PGIPL+PMLAKPTKSISEVLD FQ  +FT EYKYDGERAQVHL  
Sbjct: 337 LQYGVSQLASHIKLTPGIPLKPMLAKPTKSISEVLDTFQNIQFTSEYKYDGERAQVHLLP 396

Query: 378 DGSMKIYSRNGEDMTERYPEIDVKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLST 437
           DGSM+IYSRNGEDMT+RYPE++++ Y+ D   T   I+D EAVAWD E  KILPFQVLST
Sbjct: 397 DGSMRIYSRNGEDMTQRYPELNIQDYLVDSTTTTQLILDCEAVAWDVELQKILPFQVLST 456

Query: 438 RKRKGVELKDVKVRVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELT 497
           RKRK V+LKD+KVRVCL+AFDIL  N++ LIN +  ERR IL        GQF FA ELT
Sbjct: 457 RKRKSVDLKDIKVRVCLFAFDILRHNNDSLINNTLRERRDILHSITKPCPGQFQFATELT 516

Query: 498 TTNFDELQKYLDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDL 557
           T+N DELQ +LD+++KDSCEGLMVK L+G +SHYEPSKRSRNWLKLKKDYL+G+GDSLDL
Sbjct: 517 TSNLDELQTFLDKAIKDSCEGLMVKSLDGTDSHYEPSKRSRNWLKLKKDYLQGMGDSLDL 576

Query: 558 VVLXXXXXXXXXXXXXXXFLLGCYNLDSEEFETCCKIGTGFSDEMLQDLYTKLKDTTVEH 617
            VL               FLL CYN D+EEFETCCKIGTGFSDEMLQ LY  LK+T +E 
Sbjct: 577 CVLGAYYGRGKRTGTYGGFLLACYNQDTEEFETCCKIGTGFSDEMLQTLYNGLKETAIES 636

Query: 618 PSTNVIYDSSAPADVWFEPSMLFEVLTADLSLSPVYKAGFEAFGKGISLRFPRFVRIRDD 677
           P  N ++DSSA  DVWF P+M+FEVLTADLSLSP+YKAG   +GKGISLRFPRF+RIR D
Sbjct: 637 PRANFVFDSSAEPDVWFNPTMVFEVLTADLSLSPIYKAGSTVYGKGISLRFPRFIRIRTD 696

Query: 678 KNVTDATSSDQVIEFYESQAHMK 700
           K+V DATSS+QVI+FYE+Q+H++
Sbjct: 697 KSVNDATSSEQVIDFYENQSHLQ 719

>TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.343
           YDL164C
          Length = 736

 Score =  770 bits (1988), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/700 (56%), Positives = 499/700 (71%), Gaps = 33/700 (4%)

Query: 34  TLDGFLRPNKKQKVDEEGDSAMPDETAAAPPV--KSESSLSNIT--------PPKSRGET 83
           T+   L P+KKQ       ++M  +T  A  V  K ES  +++         P +S G +
Sbjct: 36  TMSNSLEPSKKQATLARFFTSMGKKTPPAVEVATKQESPENHVDKKRKVEVHPSQSVGAS 95

Query: 84  LTPVPSKLKFHSNIPFAELCDTFQAIEVTSSRLAITAICSKFLYSVLERDPESLVPITYL 143
                   +  S + ++E+C+ FQ IE TSSRLAI  +CS+F   V++ +P  ++ + YL
Sbjct: 96  EKAESPPDQTKSTVLYSEVCNLFQQIEETSSRLAIIKLCSEFFIRVIKNNPSDIIIVAYL 155

Query: 144 FIHKXXXXXXXXXXXXXXXXXXIKTISEACGKSIQQIRNKYREIGDLGEIAMQARNVQPT 203
           FI++                  IKTISEA GKSI+QI+ + +E GDLG IA  ARN+QPT
Sbjct: 156 FINRLGPDYEPGLELGLGENLLIKTISEAYGKSIKQIKLELKETGDLGTIARDARNIQPT 215

Query: 204 MFKPKPLTVGEVFNNLVSIAKSNGKDSQSRKGSLIKKMLTACKGYEAKFLIRSLESKLRI 263
           MFKPKPLT+ +VFNNL  IA + GKDSQ RK  LIK+ML+A KG EAKFLIRSLESKLRI
Sbjct: 216 MFKPKPLTISDVFNNLKKIASATGKDSQLRKIKLIKQMLSASKGLEAKFLIRSLESKLRI 275

Query: 264 GLAEKTVLISVSKAILTHEHNGQE----------PSTEMVEQAESLIRDAFCQVPNYEMI 313
           GLAEKTVLIS+SKA+L HEH  ++           S +++EQAE+ +R+A CQVPNYE++
Sbjct: 276 GLAEKTVLISLSKALLLHEHWKEKGESKFDEEDVESMDLIEQAEAKLREAHCQVPNYEIV 335

Query: 314 INVALQYGIMNLNQHIKLRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQV 373
           IN+ LQ GI+N+++   LRPGIPL+PMLAKPTK+I+EVL+ FQG +F  EYKYDGERAQV
Sbjct: 336 INLCLQDGILNIDKTCTLRPGIPLKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQV 395

Query: 374 HLCRDGSMKIYSRNGEDMTERYPEIDVKHYVKDLGA-------------TKSFIVDSEAV 420
           HL   G M+IYSRNGE+MTERYPE+DVK ++  + A              K  I+D E V
Sbjct: 396 HLLEGGEMRIYSRNGENMTERYPELDVKDFLCVVKAITNDQEGENAIQPVKDIILDCEVV 455

Query: 421 AWDQEQGKILPFQVLSTRKRKGVELKDVKVRVCLYAFDILCLNDEPLINKSFHERRQILL 480
           AWD EQ KILPFQVL+TRKRK V+LKDVKVRVCL+AFD+L LN+E +INKS  ER++IL 
Sbjct: 456 AWDVEQKKILPFQVLTTRKRKNVDLKDVKVRVCLFAFDLLYLNNEGMINKSLRERQEILR 515

Query: 481 DTFNGTQGQFDFANELTTTNFDELQKYLDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNW 540
                  G+F +A  L T++ DELQ +LDQ+VK+SCEGLMVKML+GEESHYEPSKRSRNW
Sbjct: 516 KVTVLVPGEFQYATSLITSDMDELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNW 575

Query: 541 LKLKKDYLEGVGDSLDLVVLXXXXXXXXXXXXXXXFLLGCYNLDSEEFETCCKIGTGFSD 600
           LKLKKDYL+GVGDSLDLVV+               FLLGCYN D++EFETCCKIGTGFSD
Sbjct: 576 LKLKKDYLDGVGDSLDLVVMGAYFGKGKRTGSYGGFLLGCYNEDTQEFETCCKIGTGFSD 635

Query: 601 EMLQDLYTKLKDTTVEHPSTNVIYDSSAPADVWFEPSMLFEVLTADLSLSPVYKAGFEAF 660
           EML +L+T L+ T +++P    IYDSSA  DVWF+  +LFEVLTADLSLSPVYKAG   +
Sbjct: 636 EMLGNLHTLLQPTEIDNPPMTYIYDSSAEPDVWFQAKVLFEVLTADLSLSPVYKAGNSRY 695

Query: 661 GKGISLRFPRFVRIRDDKNVTDATSSDQVIEFYESQAHMK 700
            KGISLRFPRF+RIR+DK+VTD T+S+ +IEFYESQ+H++
Sbjct: 696 DKGISLRFPRFLRIREDKDVTDGTTSEDIIEFYESQSHIQ 735

>TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON}
           Anc_6.18 YOR005C
          Length = 966

 Score =  110 bits (276), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 109/430 (25%), Positives = 184/430 (42%), Gaps = 83/430 (19%)

Query: 337 LQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDG-SMKIYSRNGEDMTERY 395
            +P LAK      EVL R    KFT E K DGER Q+H    G  +K +SR G D T  Y
Sbjct: 264 FEPQLAKKVNLSYEVLSRRMNNKFTIEEKMDGERIQIHYMDYGHQIKYFSRRGNDYTYLY 323

Query: 396 PE----IDVKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKRKGVELKDVKVR 451
            +      +  Y++     K  I+D E V++D+ +  ILPF ++ +     +++  ++  
Sbjct: 324 GKDKSTATISKYLQLNEDVKECILDGEMVSYDKSRNCILPFGMVKSGAANSLKIDGLEND 383

Query: 452 VC---LYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELTTTNFDELQKYL 508
           +C      FD+L LN  PL N   ++R++ L +     +   +        + + ++  L
Sbjct: 384 LCSPLFIVFDVLFLNGSPLTNLPLYQRKEYLSNILTPKKSHIEILKFSIAHDSESIRSAL 443

Query: 509 DQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDLVVLXXXXXXXX 568
             ++    EG+++K     +S Y    R+ +W+K+K +YLE  G++LDL+V+        
Sbjct: 444 QAAISVGSEGIVLKKY---DSLYSVGDRNNDWIKVKPEYLEQFGENLDLIVI------GR 494

Query: 569 XXXXXXXFLLGCYNLDSEE-------------------------------------FETC 591
                   + G   L++EE                                     F + 
Sbjct: 495 DPGKKDSLMCGVAVLENEESYEKILQEEVITLTSDDDDSQNNIPEDKPIRTKRITKFISF 554

Query: 592 CKIGTGFSDEMLQDLYTK----LKDTTVEHPSTNVI-YDSSAPADVWFEP--SMLFEV-- 642
           C I  G S+E  +++  K     K  + E P T+ + + +  P + W  P  S++ EV  
Sbjct: 555 CVIANGISNEEFKEIDRKTFGCWKKFSDEAPPTDYLEFGTRLPVE-WINPHDSVVLEVKA 613

Query: 643 --LTADLSLSPVYKAGFEAFGKGISLRFPRFVRIRDDKNVTDA-TSSDQVI--------- 690
             L  + +L   +K G+  +G      + R  RIR DK+  D  T SD VI         
Sbjct: 614 RSLENNEALRDKFKTGYTLYGA-----YCR--RIRTDKDFNDCYTFSDLVIATNKKRSSS 666

Query: 691 EFYESQAHMK 700
           E Y + +H+K
Sbjct: 667 ELYGNHSHIK 676

>ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 944

 Score =  108 bits (270), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 108/394 (27%), Positives = 169/394 (42%), Gaps = 44/394 (11%)

Query: 326 NQHIKLRPGIPLQPMLAKPTK-SISEVLDRFQGTKFTCEYKYDGERAQVHLCRDG-SMKI 383
           N  + +  G+P  P LAK    S  +V  R + + F  E K DGER Q+H    G  +K 
Sbjct: 245 NDDLGVNLGLPFAPFLAKRLYISYDKVALRLK-SDFYIEEKMDGERIQLHYMDYGRKLKW 303

Query: 384 YSRNGEDMTERYPEI----DVKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRK 439
           +SR G D T  Y E      V  Y++     +  ++D E +++D E+  +LPF ++ +  
Sbjct: 304 FSRRGNDYTYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVKSSA 363

Query: 440 RKGVELKDV---KVRVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANEL 496
           R  +  + +     R      D L LN   LIN   + R+Q L    N      +    +
Sbjct: 364 RDSLTAEGILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSM 423

Query: 497 TTTNFDELQKYLDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLD 556
              +   ++  L++++    EG+++K  +   S YE   R+ NW+K+K +YLE  G++LD
Sbjct: 424 HCYDDTSIKSSLEKAIMMGSEGIILKHFK---SKYEIGARTDNWIKIKPEYLEQFGENLD 480

Query: 557 LVVLXXXXXXXXXXXXXXXFLLG-----------CYNLDSEE----------FETCCKIG 595
           L+V+                L G             NLDSEE          F + C I 
Sbjct: 481 LLVIGRDPGKKDSLMCGLAVLEGDEEPGAQSDKQVVNLDSEEEEEPRKAVKKFISFCTIA 540

Query: 596 TGFSDEMLQDL----YTKLKDTTVEHPSTNVIYDSSAPADVWFEP--SMLFEVLTADLSL 649
            G S E  + +      K K+T    P   + + S  P + W  P  S++ EV     SL
Sbjct: 541 NGISQEEFKQIERKTAGKWKNTEDHKPPKILEFGSKLPEE-WIYPEDSVVLEVKAR--SL 597

Query: 650 SPVYKAGFEAFGKGISLRFPRFVRIRDDKNVTDA 683
                +G   F  G +L      RIR+DKN T+ 
Sbjct: 598 DNTESSG-RKFKVGCTLHGGYCRRIREDKNWTEC 630

>YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON}
           DNL4DNA ligase required for nonhomologous end-joining
           (NHEJ), forms stable heterodimer with required cofactor
           Lif1p, interacts with Nej1p; involved in meiosis, not
           essential for vegetative growth
          Length = 944

 Score =  107 bits (268), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 100/414 (24%), Positives = 175/414 (42%), Gaps = 61/414 (14%)

Query: 329 IKLRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDG-SMKIYSRN 387
           + ++ G    P LAK      E + R     F  E K DGER QVH    G S+K +SR 
Sbjct: 246 LSIKVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIKFFSRR 305

Query: 388 GEDMTERY----PEIDVKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKRKGV 443
           G D T  Y        +  +++   + K  ++D E V +D ++  ILPF ++    ++ +
Sbjct: 306 GIDYTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGSAKEAL 365

Query: 444 E---LKDVKVRVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELTTTN 500
               + +V        FD+L LN   L     H+R+Q L    +  +   +         
Sbjct: 366 SFNSINNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRSSRCYG 425

Query: 501 FDELQKYLDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDLVVL 560
            + ++K L+ ++    EG+++K      S Y  + R+ NW+K+K +YLE  G++LDL+V+
Sbjct: 426 VESIKKSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKVKPEYLEEFGENLDLIVI 482

Query: 561 XXXXXXXXXXXXXXXFLLGCYNLDSEEFE------------------------------T 590
                          F+LG   LD EE++                              +
Sbjct: 483 ------GRDSGKKDSFMLGLLVLDEEEYKKHQGDSSEIVDHSSQEKHIQNSRRRVKKILS 536

Query: 591 CCKIGTGFSDEMLQDLYTKLKD-----TTVEHPSTNVIYDSSAPADVWFEP--SMLFEVL 643
            C I  G S E  +++  K +      + V  P++ + + S  PA+ W +P  S++ E+ 
Sbjct: 537 FCSIANGISQEEFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAE-WIDPSESIVLEIK 595

Query: 644 TADLSLSPVYKAGFEAFGKGISLRFPRFVRIRDDKNVTDATSSDQVIEFYESQA 697
           +  L  +   +   + +    +L      RIR DK  TD  + +   + YES+ 
Sbjct: 596 SRSLDNT---ETNMQKYATNCTLYGGYCKRIRYDKEWTDCYTLN---DLYESRT 643

>Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {ON}
           YOR005C (REAL)
          Length = 945

 Score =  107 bits (267), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 100/417 (23%), Positives = 173/417 (41%), Gaps = 61/417 (14%)

Query: 326 NQHIKLRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDG-SMKIY 384
           N  + ++ G    P LAK      E + R     F  E K DGER QVH    G S++ Y
Sbjct: 243 NDDLTIKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFY 302

Query: 385 SRNGEDMTERY----PEIDVKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKR 440
           SR G D T  Y        + H++      +  ++D E V +D  +  ILPF ++    +
Sbjct: 303 SRRGIDYTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGSAK 362

Query: 441 KGVE---LKDVKVRVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELT 497
             +    + +V        FD+L LN   L     H+R++ L       +   +      
Sbjct: 363 DALSFNSINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSR 422

Query: 498 TTNFDELQKYLDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDL 557
             N + ++K L+ ++    EG+++K      S Y  + R+ NW+K+K +YLE  G++LDL
Sbjct: 423 CYNVESIKKSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKVKPEYLEEFGENLDL 479

Query: 558 VVLXXXXXXXXXXXXXXXFLLGCYNLDSEEFE---------------------------- 589
           V++               F+LG   L+ +E +                            
Sbjct: 480 VII------GRDPGKKDSFMLGLLLLNEKEMDKRDQEVSSGIANNSKNENILYSQKKVKK 533

Query: 590 --TCCKIGTGFSDEMLQDLYTKL-----KDTTVEHPSTNVIYDSSAPADVWFEP--SMLF 640
             + C +  G S E  +++  K      K + V  P++   + S  PA+ W EP  S++ 
Sbjct: 534 ILSFCSVANGISQEEFKEIDRKTRGCWKKTSEVAPPASIFEFGSKIPAE-WIEPNESIVL 592

Query: 641 EVLTADLSLSPVYKAGFEAFGKGISLRFPRFVRIRDDKNVTDATSSDQVIEFYESQA 697
           E+ +  L  +   +   + +    +L      RIR DK+ TD  + +   E Y+S++
Sbjct: 593 EIKSRSLDNT---ETNMQKYATSCTLYGGYCKRIRFDKDWTDCFTLN---ELYDSRS 643

>Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {ON}
           YOR005C (REAL)
          Length = 947

 Score =  104 bits (260), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 99/412 (24%), Positives = 166/412 (40%), Gaps = 59/412 (14%)

Query: 326 NQHIKLRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDG-SMKIY 384
           N  + ++ G    P LAK      E + R     F  E K DGER QVH    G S+K +
Sbjct: 243 NDDLSIKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFF 302

Query: 385 SRNGEDMTERY----PEIDVKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKR 440
           SR G D T  Y        +  Y+K     K  ++D E V +D  +  ILPF ++    +
Sbjct: 303 SRRGIDYTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAK 362

Query: 441 KGVELKDVK---VRVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELT 497
             +   D+     R     FD+L LN+  L     H+R++ L       +   +      
Sbjct: 363 GVLSCSDINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTR 422

Query: 498 TTNFDELQKYLDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDL 557
             +   ++  L+ ++    EG+++K      S Y  + R+ NW+K+K +YLE  G++LDL
Sbjct: 423 CYDVQSVKNSLEVAISLGSEGVVLKYYN---SSYNIASRNYNWIKVKPEYLEEFGENLDL 479

Query: 558 VVLXXXXXXXXXXXXXXXFLLGCYNLDSEEFE---------------------------- 589
           +++               F+LG   +D  E E                            
Sbjct: 480 III------GRDSGKKDSFMLGLLVIDEREMEERDQELSSSEVVNDSKIEQDVINSKKKV 533

Query: 590 ----TCCKIGTGFSDEMLQDLYTK----LKDTTVEHPSTNVIYDSSAPADVWFEP--SML 639
               + C +  G S E  +++  +     K T+   P + + + S  PA+ W EP  S++
Sbjct: 534 KKVLSFCSVANGISHEEFKEINRRTRGHWKRTSDFSPPSILQFGSRIPAE-WIEPSDSIV 592

Query: 640 FEVLTADLSLSPVYKAGFEAFGKGISLRFPRFVRIRDDKNVTDATSSDQVIE 691
            E+ +  L  +   +     +    +L      RIR DK+ TD  +  Q+ E
Sbjct: 593 LEIKSRSLDNT---ETSIRRYATSCTLYGGYCRRIRYDKDWTDCYTLAQLYE 641

>Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {ON}
           YOR005C (REAL)
          Length = 948

 Score = 99.4 bits (246), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 96/412 (23%), Positives = 170/412 (41%), Gaps = 59/412 (14%)

Query: 326 NQHIKLRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDG-SMKIY 384
           N  + ++ G    P LAK      E +       F  E K DGER QVH    G S+K +
Sbjct: 243 NDDLSIKVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFF 302

Query: 385 SRNGEDMTERYP----EIDVKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKR 440
           SR G D T  Y        +  Y+K   + K  ++D E V +D  +  ILPF ++    +
Sbjct: 303 SRRGIDYTYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAK 362

Query: 441 KGVELKDVK---VRVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELT 497
           + +   D+           FD+L LN   L     ++R++ L      ++   +      
Sbjct: 363 EALSFNDINNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSR 422

Query: 498 TTNFDELQKYLDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDL 557
             + + ++K L+ ++    EG+++K      S Y  + R+ NW+K+K +YLE  G++LDL
Sbjct: 423 CYDAESVKKSLEVAISLGSEGVVLKHYS---SSYNVASRNNNWIKVKPEYLEEFGENLDL 479

Query: 558 VVLXXXXXXXXXXXXXXXFLLGCYNLDSEE------------------------------ 587
           +++               F+LG   +D +E                              
Sbjct: 480 III------GRDSGKKDSFMLGLLVVDEQETGKTDQEGPSEILNDSSTERRATNPKKRVR 533

Query: 588 -FETCCKIGTGFSDEMLQDLYTKL-----KDTTVEHPSTNVIYDSSAPADVWFEP--SML 639
              + C I  G S E  +++  K      K + +  P + + + S  PA+ W EP  S++
Sbjct: 534 KVLSFCSIANGISQEEFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAE-WIEPSESIV 592

Query: 640 FEVLTADLSLSPVYKAGFEAFGKGISLRFPRFVRIRDDKNVTDATSSDQVIE 691
            E+ +  L  +   +   + +    +L      RIR DK+ T+  + D++ E
Sbjct: 593 LEIKSRSLDNT---ETNMQKYATNCTLYGGYCRRIRYDKDWTECYTLDELYE 641

>KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.18
           YOR005C
          Length = 954

 Score = 99.4 bits (246), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 93/381 (24%), Positives = 162/381 (42%), Gaps = 49/381 (12%)

Query: 326 NQHIKLRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDGS-MKIY 384
           N+ + L+ G    P LAK      E + +  G+ F+ E K DGER Q+H    G+ +K  
Sbjct: 244 NEDLTLKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEIKFL 303

Query: 385 SRNGEDMTERY----PEIDVKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKR 440
           SR G D T  Y        +  Y+K     K  I+D E V +DQE+  ILPF ++ +  +
Sbjct: 304 SRRGTDYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKSSAK 363

Query: 441 KGVELKDV---KVRVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELT 497
             +  + +          AFD++ LN   L++   ++R+  L        G  D  +   
Sbjct: 364 NFLSKESISNGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVSFAR 423

Query: 498 TTNFDELQKYLDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDL 557
             N + + K L  ++    EG+++K L    S Y  + R+ +W+K+K  YL+  G+++DL
Sbjct: 424 CNNLESITKSLAAAISVGSEGIILKKL---NSRYMVASRNDSWIKIKPQYLKQFGENMDL 480

Query: 558 VVLXXXXXXXXXXXXXXXFLLG-------------CYNLDSEE-------------FETC 591
           +++                 +                +LD+E+             F + 
Sbjct: 481 IIIGRDPGKKDAFMCALGVTIDDPQPRVLQQEENVNLDLDTEDSEPETPKASRIVKFVSF 540

Query: 592 CKIGTGFSDEMLQDLYTKLKD-----TTVEHPSTNVIYDSSAPADVWFEP--SMLFEVLT 644
           C I  G S+   +++  K +        V+ PS  + + +  P + W +P  S++ EV +
Sbjct: 541 CTIANGISNAEFKEIDQKTRGLWRRFDQVKPPSEYLQFGTKKPVE-WIDPKESLVLEVKS 599

Query: 645 ADL----SLSPVYKAGFEAFG 661
             L    S    Y+AG   FG
Sbjct: 600 RSLDNTESNVKKYRAGVTLFG 620

>CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005c DNL4 DNA ligase IV
          Length = 946

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 100/398 (25%), Positives = 170/398 (42%), Gaps = 66/398 (16%)

Query: 326 NQHIKLRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDGS-MKIY 384
           NQ +K+  G+   P LA       + +    G  F  E K DGER Q+H    GS +K Y
Sbjct: 258 NQDLKINIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFY 317

Query: 385 SRNGEDMTERYPE----------IDVKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQV 434
           SR   D T  Y            I++   VKD       ++D E V +D     +LPF +
Sbjct: 318 SRRATDYTYLYGNNLKTGTLANFINLNKNVKDC------VLDCEVVTFDSNNKIVLPFGM 371

Query: 435 LSTRKRKGVELKDVKVRV---CLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFD 491
           + +  +  +    +  +     L  FD+L LN   L++  +++RR+ L      T  + +
Sbjct: 372 VKSSAKNMLSQDGIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIE 431

Query: 492 FANELTTTNFDELQKYLDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGV 551
               +   +   ++K L++++    EG+++K  +   S Y  + RS +W+K+K +YLE  
Sbjct: 432 IIKSIRANDEQMIKKSLEKALSVGSEGIILKRYD---SRYVIASRSDDWIKIKPEYLEQF 488

Query: 552 GDSLDLVVLXXXXXXXXXXXXXXXFLLGCYNLDSEE-----------------------F 588
           G+++DLV++                +LG   LD EE                       F
Sbjct: 489 GENMDLVLM------GRDPSKKDSLMLGL--LDYEEVIQDSPIMVNSQSSEENSQRFRGF 540

Query: 589 ETCCKIGTGFSDEMLQDLYTKLK----DTTVEHPSTNVIYDSSAPADVWFEP--SMLFEV 642
            + C I  G S+E  +++  K K    D+    P   + + S  P   W +P  S++ E+
Sbjct: 541 VSLCIIANGISNEEYKEIDRKTKGLWNDSEKIPPLEYMKFGSKVPRQ-WIDPKKSLILEI 599

Query: 643 LTADLSLSPVYKAGFEAFGKGISLRFPRFVR-IRDDKN 679
               L  +   ++    F  G +L F  + R IR+DKN
Sbjct: 600 KARSLDNT---RSSERKFAAGCTL-FGGYCRQIREDKN 633

>TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.18
           YOR005C
          Length = 969

 Score = 97.4 bits (241), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 99/407 (24%), Positives = 168/407 (41%), Gaps = 51/407 (12%)

Query: 334 GIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDGS-MKIYSRNGEDMT 392
           G    P LAK      E +       F  E K DGER QVH    G+ ++  SR G D T
Sbjct: 268 GYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRGVDYT 327

Query: 393 ERYPEI----DVKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKRKGVELKDV 448
           + Y E      V +Y+      +  ++D E + +D ++  +LPF ++ +  R+ +  + +
Sbjct: 328 QLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQALSTEGI 387

Query: 449 ---KVRVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELTTTNFDELQ 505
                R  L   D++ LN   LI    ++R++ L           +    +  +    ++
Sbjct: 388 CSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSEHTAIR 447

Query: 506 KYLDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDLVVLXXXXX 565
           K L++S+    EG+++K     ++ YE   R+  W+K+K +YLE  G++LDLV++     
Sbjct: 448 KSLEKSISMGSEGIVLK---SYKARYEIGARNDYWIKVKPEYLEQFGENLDLVIIGRTPG 504

Query: 566 XXXXXXXXXXFLLG--------------CYNLDSEE--------------FETCCKIGTG 597
                        G                NLDSE               F + C I  G
Sbjct: 505 KKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFISFCVIANG 564

Query: 598 FSDEMLQDLYTKLKDTTVEH----PSTNVIYDSSAPADVWFEP--SMLFEVLTADLSLSP 651
            S +  +++  K +   V+     PS +++   S   + W +P  S++ EV    L  + 
Sbjct: 565 ISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVKARSLDNTE 624

Query: 652 VYKAGFEAFGKGISLRFPRFVRIRDDKNVTDATSSDQVIEFYESQAH 698
             K  F A   G +L      RIRDDK+ T   S     E ++ + H
Sbjct: 625 SSKKKFAA---GCTLHGGYCRRIRDDKDWTGCYSFS---ELWQERLH 665

>TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {ON}
           Anc_6.18 YOR005C
          Length = 972

 Score = 97.1 bits (240), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 66/243 (27%), Positives = 115/243 (47%), Gaps = 11/243 (4%)

Query: 326 NQHIKLRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDG-SMKIY 384
           N  + ++ G    P LAK      + +       F  E K DGER Q+H    G ++K +
Sbjct: 264 NSDLSIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGETVKFF 323

Query: 385 SRNGEDMTERYPEID----VKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKR 440
           SR+G D T  Y        +  +++     K  ++D E V +D    K+LPF ++ +   
Sbjct: 324 SRHGTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSAS 383

Query: 441 KGVELKDV---KVRVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELT 497
             +  KD+           FDIL LN   LI+    +R++ L       +   +  + + 
Sbjct: 384 SQLNKKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSIR 443

Query: 498 TTNFDELQKYLDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDL 557
            T+  +++K LD ++    EG+++K      S Y P+ R  NW+K+K +YLE  G+++DL
Sbjct: 444 CTDSIQIKKGLDAAISVGSEGIVLKQYI---SKYIPNARHNNWIKVKPEYLEEFGENMDL 500

Query: 558 VVL 560
           +V+
Sbjct: 501 IVI 503

>KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005C DNL4 DNA ligase required for nonhomologous end-
           joining (NHEJ) forms stable heterodimer with required
           cofactor Lif1p catalyzes DNA ligation as part of a
           complex with Lif1p and Nej1p involved in meiosis not
           essential for vegetative growth
          Length = 907

 Score = 95.9 bits (237), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 96/380 (25%), Positives = 162/380 (42%), Gaps = 51/380 (13%)

Query: 337 LQPMLAKPTK-SISEVLDRFQGTKFTCEYKYDGERAQVHLCRDG-SMKIYSRNGEDMTER 394
            +P LAK T  S   V  + Q   F  E K DGER Q+H    G  +K  SR G D +  
Sbjct: 247 FEPQLAKRTHLSYERVASKLQH-DFIIEEKMDGERLQIHYINYGEQIKYLSRRGVDFSYL 305

Query: 395 Y----------PEIDVKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKRKGV- 443
           Y          P + +   VKD       I+D E + +D E+  +LPF ++ +     + 
Sbjct: 306 YGENSSSGPISPSLKLHFNVKDC------ILDGEMITYDTEKDIVLPFGLVKSSAMNQIQ 359

Query: 444 -ELKDV----KVRVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELTT 498
            EL  +      +    AFD++ LN + L N +   R+  L       +   +    +  
Sbjct: 360 SELAGIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKA 419

Query: 499 TNFDELQKYLDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDLV 558
            N + ++  L+Q++    EG+++K L    S Y    R+ +W+K+K +YLE  G+++DL+
Sbjct: 420 INAEAIKDSLEQAISMGSEGIVLKHLH---SKYFVGSRNTDWIKIKPEYLEQFGENMDLL 476

Query: 559 VLXXXXXXXXXXXXXXXFLLGCYNLDSEE------FETCCKIGTGFSDEMLQDL----YT 608
           ++               F  G    D  E      F + C I  G S+E  +D+    + 
Sbjct: 477 II------GREQGKKDSFFCGLSISDPNEVAEKPRFISFCTIANGLSNEEFKDIERKTWG 530

Query: 609 KLKDTTVEHPSTNVI-YDSSAPADVWFEP--SMLFEVLTADLSLSPVYKAGFEAFGKGIS 665
           K    + + PS N++ + +  P + W  P  S++ EV    +      K  + +   G +
Sbjct: 531 KWHIFSEDPPSPNLLGFGTKVPYE-WIHPEDSVVLEVKARAIDTKESEKRKYRS---GCT 586

Query: 666 LRFPRFVRIRDDKNVTDATS 685
           L F    +IR DK+     S
Sbjct: 587 LHFGYCKQIRYDKDWKTVAS 606

>KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6.18
           YOR005C
          Length = 948

 Score = 94.0 bits (232), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 106/451 (23%), Positives = 184/451 (40%), Gaps = 61/451 (13%)

Query: 271 LISVSKAILTHEH---NGQEPSTEMVEQAESLIRDAFCQVPNYEMIINVALQYGIMNLNQ 327
           +I  ++ I  HEH   N   P  E      S ++    ++ N     N+ L++  +++N 
Sbjct: 195 IILKARVIGPHEHKLLNAWHPDAEDYLSVVSDLKTVCTRLWN----PNIRLRHDELSINI 250

Query: 328 HIKLRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDGS-MKIYSR 386
                 G    P LAK      + + +     F  E K DGER Q+H    G+ +K  SR
Sbjct: 251 ------GYAFAPHLAKKLSISYDKICKKLKNDFFIEEKMDGERIQIHYMDYGNDIKFLSR 304

Query: 387 NGEDMTERYPEI----DVKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKRKG 442
            G D T  Y E      +  Y+K     K  ++D E V +D++Q  +LPF ++ +     
Sbjct: 305 RGVDYTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMNA 364

Query: 443 V---ELKDVKVRVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELTTT 499
           +   E+        L  FD++ LN   L+    ++R+  L       + +    N    +
Sbjct: 365 LTKEEISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRCS 424

Query: 500 NFDELQKYLDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDLVV 559
           N + ++K L+ ++    EG+++K      S Y    R+ +W+K+K +YLE  G+++DL+V
Sbjct: 425 NENIIRKSLEHAISVGSEGIVLK---NYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIV 481

Query: 560 LXXXXXXXXXXXXXXXFL------------LGCYNLDSEEFE--------------TCCK 593
           +                L             G  NL S+E +              + C 
Sbjct: 482 IGRDSAKKDSFYCGLTVLDEEEEKLVEEIDKGVVNLVSDESDYENPENNRHIKKVVSFCM 541

Query: 594 IGTGFSDEMLQDLYTKL-----KDTTVEHPSTNVIYDSSAPADVWFEP--SMLFEVLTAD 646
           I  G S    +++Y K      K   V  P   + + +  P + W EP  S++ E+    
Sbjct: 542 IANGISQNEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPME-WIEPEHSVVLEIKARS 600

Query: 647 LSLSPVYKAGFEAFGKGISLRFPRFVRIRDD 677
           L  +   ++  + F  G +L      RIRDD
Sbjct: 601 LDNT---ESSCKRFKAGCTLYGGYCRRIRDD 628

>KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 951

 Score = 92.8 bits (229), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 102/432 (23%), Positives = 180/432 (41%), Gaps = 63/432 (14%)

Query: 305 CQVPNYEMIINVALQYGIMN---LNQHIKLRP-------GIPLQPMLAKPTKSISEVLDR 354
           C  P+ ++ + V     I++    N  ++L         G    P LAK      E +  
Sbjct: 223 CWHPDAQIYLGVVTDLKILSKKLWNPSVRLDKRDLSINIGHAFAPHLAKRLHVSYERICS 282

Query: 355 FQGTKFTCEYKYDGERAQVHLCRDGS-MKIYSRNGEDMTERY-PEID---VKHYVKDLGA 409
                F  E K DGER Q+H    GS +K  SR G D +  Y  E+    +  Y+K    
Sbjct: 283 KLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRRGIDFSHLYGQEVARGVISQYLKLKSD 342

Query: 410 TKSFIVDSEAVAWDQEQGKILPFQVLSTRKRKGVELKDVKV-------RVCLYAFDILCL 462
            +  ++D E V++D+++  ILPF ++ +      EL + +V       R     FD++ L
Sbjct: 343 VRDCVLDGEMVSYDKKRKIILPFGIVKSAAVD--ELINSEVGNENDGYRPLYMVFDLVYL 400

Query: 463 NDEPLINKSFHERRQILLDTFNGTQGQFDFANELTTTNFDELQKYLDQSVKDSCEGLMVK 522
           N   L     H R++ L +  +      +    +   +   ++ ++ ++++   EG++VK
Sbjct: 401 NGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRACDAKAIKNFMQRAIEMGSEGVIVK 460

Query: 523 MLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDLVVLXXXXXXXXXXXXXXXFLLGCYN 582
                 S YE   R+ +W+K+K +Y E +G+++DLVV+                + G   
Sbjct: 461 Q---ASSTYEVGARNDHWVKIKPEYFEDLGETMDLVVI------GRDPGKKDSLMCGLLV 511

Query: 583 LDSEEF-------------------ETCCKIGTGFSDEMLQDLYTKLKDTTVEH-----P 618
            DSE                      + C +  G SDE  +++  K + + V +     P
Sbjct: 512 SDSEHILENFGPIEHGKEGDPIIKCVSFCNVANGVSDEEFKEINRKTRGSWVSYKEKPPP 571

Query: 619 STNVIYDSSAPADVWFEP--SMLFEVLTADLSLSPVYKAGFEAFGKGISLRFPRFVRIRD 676
            + + + S  P + W +P  S++ EV    +  S      + A   G +L      RIR+
Sbjct: 572 LSLLEFGSKIPVE-WIDPKNSVVIEVKARSVENSEYSSKRYRA---GSTLHSAYCRRIRN 627

Query: 677 DKNVTDATSSDQ 688
           DK+ T  TS  Q
Sbjct: 628 DKDWTTCTSVAQ 639

>ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR005C (DNL4)
          Length = 981

 Score = 91.3 bits (225), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 100/409 (24%), Positives = 169/409 (41%), Gaps = 72/409 (17%)

Query: 329 IKLRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDG-SMKIYSRN 387
           + +R G    P +A+  K   E +    G  F  E K DG+R QVH    G S+  +SRN
Sbjct: 286 LSVRIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRN 345

Query: 388 GEDMTERYPEIDVK----HYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKRKGV 443
           G + T  Y E   K    +++K +   K  I+D E V++D+E   ILPF +  +     V
Sbjct: 346 GINYTYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQV 405

Query: 444 ELKDV-----KVRVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELTT 498
             +         R     FD+L LN + L N+   +R++ L      ++      +    
Sbjct: 406 NFETTGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRC 465

Query: 499 TNFDELQKYLDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDLV 558
           ++ + +   L  +V    EG+++K      S Y   KR  +W+K+K +YLE  G+++DLV
Sbjct: 466 SDAEAITAALGAAVAHGSEGIVLKK---ARSKYSVGKRDDSWIKIKPEYLENFGENMDLV 522

Query: 559 VLXXXXXXXXXXXXXXXFLLGCYNLDS----------------------------EEFET 590
           V+               F+      D                             E+F +
Sbjct: 523 VI------GRDKGRKDSFICALAVTDDSEKNNPSSYESGSDSDSDSEPIIVQPKIEKFIS 576

Query: 591 CCKIGTGFSDEMLQDLYTKLKDTTVEH-----PSTNVIYDSSAPADVWFEP--SMLFEV- 642
            C I  G S+E  +++    +     +     P+  V + +  P + W +P  S++ EV 
Sbjct: 577 FCSIANGISNEEFKEIDRLTRGNWFPYDERKPPTDWVEFGTKTPRE-WIDPKNSVVLEVK 635

Query: 643 ---LTADLSLSPVYKAG---FEAFGKGISLRFPRFVRIRDDKNVTDATS 685
              +  + S S +YK G   + A+ K          RIR DKN + A++
Sbjct: 636 ARSIDNEESKSDLYKTGSTLYNAYCK----------RIRHDKNWSTAST 674

>NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.18
           YOR005C
          Length = 950

 Score = 90.5 bits (223), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 66/243 (27%), Positives = 114/243 (46%), Gaps = 11/243 (4%)

Query: 326 NQHIKLRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDGS-MKIY 384
           N  + + PG    P LAK      E +       F  E K DGER Q+H    G  +K +
Sbjct: 251 NNDLVINPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFF 310

Query: 385 SRNGEDMTERYPEID----VKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKR 440
           SR G D T  Y E      +  ++K     K  I+D E + +D+ Q  ILPF ++ +  R
Sbjct: 311 SRRGTDYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSAR 370

Query: 441 KGVE---LKDVKVRVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELT 497
             +    + +   +     FD++ +N   L N   + R++ L   F       +  +   
Sbjct: 371 SMLTKDGIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSYH 430

Query: 498 TTNFDELQKYLDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDL 557
             N D ++K L+ ++    EG+++K  +   S Y  + R+ +W+K+K +YLE  G+++DL
Sbjct: 431 RFNEDSIRKSLELAISMGSEGIVLKRYD---SRYTVASRNDDWIKVKPEYLEQFGENMDL 487

Query: 558 VVL 560
           +V+
Sbjct: 488 IVI 490

>NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {ON}
           Anc_6.18 YOR005C
          Length = 967

 Score = 86.7 bits (213), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 75/301 (24%), Positives = 131/301 (43%), Gaps = 24/301 (7%)

Query: 271 LISVSKAILTHEH---NGQEPSTEMVEQAESLIRDAFCQVPNYEMIINVALQYGIMNLNQ 327
           +I  S+ I  HEH   N   P  +          D    V + + + N      +   N 
Sbjct: 211 IILKSRVIGGHEHKFLNVWHPDAQ----------DYLSVVSDLKTVANKLWDPAVHLKND 260

Query: 328 HIKLRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDGS-MKIYSR 386
            + +  G P  P  AK      E +       F  E K DGER Q+H    G+ +   SR
Sbjct: 261 DLTINVGSPFAPQSAKKLSISYEKICAKLKHDFFIEEKMDGERIQLHYQDYGNKLSFLSR 320

Query: 387 NGEDMTERYPEI----DVKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKRKG 442
            G D T  Y E      V  Y+      ++ ++D E V +D+E+  +LPF ++ +  R  
Sbjct: 321 RGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVLDGEMVTFDKERNALLPFGLVKSSARSI 380

Query: 443 VELKDVK---VRVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELTTT 499
           +  + V     R  L  FD++ LN   L+N   ++R+  L   F   +   +       +
Sbjct: 381 ITQEGVANEGYRPLLMVFDLVYLNGVSLVNIPLYQRKLYLEKIFTPERHIVELLRSKRCS 440

Query: 500 NFDELQKYLDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDLVV 559
           +   ++  L+ ++    EG+++K      S Y  + R+ +W+K+K +YLE  G+++DL+V
Sbjct: 441 DERSIKNALEHAISIGSEGVVLKHYN---SRYTVASRNDDWIKVKPEYLEQFGENMDLIV 497

Query: 560 L 560
           +
Sbjct: 498 I 498

>Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {ON}
           YOR005C (DNL4) - ATP dependent DNA ligase [contig 185]
           FULL
          Length = 963

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 66/260 (25%), Positives = 123/260 (47%), Gaps = 17/260 (6%)

Query: 311 EMIINVALQYGIMNLNQHIKLRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGER 370
           E + N  ++ G   L+ +I    G    P LAK      E +       F  E K DGER
Sbjct: 257 ETLWNPTMRLGKNELSINI----GRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGER 312

Query: 371 AQVHLCRDGS-MKIYSRNGEDMTERYPEI----DVKHYVKDLGATKSFIVDSEAVAWDQE 425
            Q+H    G+ ++  SR G D T  Y +      +  ++K     +  ++D E V++D+E
Sbjct: 313 IQLHYIERGAKIRFLSRRGTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKE 372

Query: 426 QGKILPFQVLSTRKRKGVELKDVKV-----RVCLYAFDILCLNDEPLINKSFHERRQILL 480
           +  +LPF ++ +   + +   D KV     R     FD++ LN   L     H R+  L 
Sbjct: 373 KNVVLPFGIVKSTAMEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLR 432

Query: 481 DTFNGTQGQFDFANELTTTNFDELQKYLDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNW 540
              +      +  +++  +  + ++  L+++++   EG+++K      S YE   R+ +W
Sbjct: 433 SILSPVANIVEILSDVRASEPNAIKVSLERAIEMGSEGIILKQFS---SPYEIGARNDSW 489

Query: 541 LKLKKDYLEGVGDSLDLVVL 560
           +K+K +Y E +G+++DLVV+
Sbjct: 490 IKIKPEYFEELGETMDLVVI 509

>Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON}
           complement(12295..15192) [2898 nt, 966 aa]
          Length = 965

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 108/230 (46%), Gaps = 11/230 (4%)

Query: 339 PMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDGS-MKIYSRNGEDMTERYPE 397
           P  AK      + + R     F  E K DGER Q+H    G+ +K  SR G D +  Y +
Sbjct: 278 PETAKRLTYSYDTIARRLKNDFFIEEKMDGERIQLHYMNYGAKLKFLSRRGLDYSYLYGD 337

Query: 398 ID----VKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKRKGVELKDVK---V 450
                 +  Y+      K  I+D E V +D  +  ILPF ++ +   + + + D++    
Sbjct: 338 NRNNGAIGRYLNFHKDVKECILDGEMVTYDSVKNCILPFGLVKSSAMQSLSVSDIEPDGY 397

Query: 451 RVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELTTTNFDELQKYLDQ 510
                AFD++ LN   L     H+R+  L           +    L   +   ++  L++
Sbjct: 398 HPLYMAFDLVYLNGSSLSTLPLHQRKNYLDKLLIPCPDFVEILPALHCNDSSLIKSSLEK 457

Query: 511 SVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDLVVL 560
           +++   EG+++K  +   S Y  +KRS +W+K+K +YLE  G+++DL+V+
Sbjct: 458 AIELGSEGIILKRFD---SQYLVAKRSDDWIKIKPEYLEQFGENMDLIVI 504

>KLTH0E11352g Chr5 (1014490..1017447) [2958 bp, 985 aa] {ON} similar
           to uniprot|P48526 Saccharomyces cerevisiae YPL040C ISM1
           Mitochondrial isoleucyl-tRNA synthetase null mutant is
           deficient in respiratory growth
          Length = 985

 Score = 35.0 bits (79), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 41/75 (54%), Gaps = 4/75 (5%)

Query: 596 TGFSDEMLQDLYT-KLKDTTVEHPSTNVIYDSSAPADVWFEPSMLFEVLTADLSLSP--- 651
           +G +  +L+D YT +LK T + +P  +V  + S     WF+ S+L ++ T++ + +P   
Sbjct: 578 SGSTWNVLEDFYTQRLKLTEMPYPLADVYLEGSDQHRGWFQSSLLTKIATSEQAAAPYGT 637

Query: 652 VYKAGFEAFGKGISL 666
           V   GF    +GI +
Sbjct: 638 VITHGFTLDERGIKM 652

>TBLA0F00490 Chr6 (128506..132093) [3588 bp, 1195 aa] {ON} Anc_7.460
           YJR089W
          Length = 1195

 Score = 33.1 bits (74), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 44/93 (47%), Gaps = 12/93 (12%)

Query: 233 RKGSLIKKMLTACKGYEAKFLIRSLESKLRIGLAEKTVLISVSKAILTHEHNGQEPSTEM 292
           R  S+    L+  K ++ K L R+       G  +   L  + +  L+HE +      E+
Sbjct: 446 RDNSINSSNLSQEKQHQCKQLARA-------GQTQDIELKHIQEHALSHEIDN----PEI 494

Query: 293 VEQAESLIRDAFCQVPNYEMIINVALQYGIMNL 325
           V   ES+ RD +C+  +YEM  N A+  G+ N+
Sbjct: 495 VTTRESIKRDNYCKNNDYEM-ENYAIMSGVCNI 526

>KLLA0B13816g Chr2 complement(1209339..1210580) [1242 bp, 413 aa]
           {ON} similar to uniprot|P40354 Saccharomyces cerevisiae
           YJR062C NTA1 Amidase removes the amide group from N-
           terminal asparagine and glutamine residues to generate
           proteins with N-terminal aspartate and glutamate
           residues that are targets of ubiquitin-mediated
           degradation
          Length = 413

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 24/43 (55%), Gaps = 1/43 (2%)

Query: 458 DILCLNDEPLINKSFHERRQILLDTFNGTQG-QFDFANELTTT 499
           DIL   +  L   SFH+R  IL  T   T+G  FDFA E++ T
Sbjct: 49  DILVFPEFALTGYSFHDRNHILPYTCKPTEGPTFDFAKEVSKT 91

>TPHA0H00740 Chr8 (149750..150670) [921 bp, 306 aa] {ON} Anc_3.179
           YAR015W
          Length = 306

 Score = 31.6 bits (70), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (51%)

Query: 227 GKDSQSRKGSLIKKMLTACKGYEAKFLIRSLESKLRIGLAEKTVLISVSKAILT 280
           GKD  +R   L  K+ + C+ Y AK  I   ++K   G+ EKT  I +   +LT
Sbjct: 184 GKDLVNRVDELAVKLYSKCRDYAAKKGILIADTKFEFGIDEKTNEIILVDEVLT 237

>NCAS0G03410 Chr7 (624153..627323) [3171 bp, 1056 aa] {ON} Anc_1.506
           YKL197C
          Length = 1056

 Score = 31.6 bits (70), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 42/188 (22%), Positives = 76/188 (40%), Gaps = 47/188 (25%)

Query: 168 TISEACGKSIQQIR-----NKYREIG----DLGEIAMQARNVQPTMFKPKPLTVGEVFNN 218
            I++ CG +   ++     NKY  IG    ++ E+  +A++V+P +           F+ 
Sbjct: 752 AIAQQCGLNFLSVKGPEILNKY--IGASEQNVRELFEKAQSVKPCIL---------FFDE 800

Query: 219 LVSIAKSNGKDSQSRKGSLIKKMLTACKGYEAKFLIRSLESKLRIGLAEKTVLISVSKAI 278
             SIA   G DS      ++ ++LT   G E    +  L +  R  L +  +L       
Sbjct: 801 FDSIAPKRGHDSSGVTDRVVNQLLTQMDGAEGLDGVYVLAATSRPDLIDSALL------- 853

Query: 279 LTHEHNGQEPSTEMVEQAESLIRDAFCQVPNYEM---IINVALQYGIMNLNQHIKLRPGI 335
                           +   L +   C +PN +    II     +G  + ++ +KL PG+
Sbjct: 854 ----------------RPGRLDKSILCNIPNEDERHDIICAITGHGRTSKSK-LKLAPGV 896

Query: 336 PLQPMLAK 343
            LQP++ K
Sbjct: 897 ILQPIIKK 904

>Kwal_23.2995 s23 (107723..112030) [4308 bp, 1435 aa] {ON} YNL088W
            (TOP2) - topoisomerase II, Top2p localizes to axial cores
            in meiosis [contig 248] FULL
          Length = 1435

 Score = 31.6 bits (70), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 36/73 (49%), Gaps = 11/73 (15%)

Query: 2    FRLPIIRNWIVQRPV-TFKVPSQQMSTKRSKQLTLDGFLRPNKKQKVDEE---GDSAMPD 57
            F+  +I   I+++P  T KV  +Q       Q TLDG +   K+   +E      SA PD
Sbjct: 1216 FQPSLIEQKIIEKPKRTPKVKDEQ-------QTTLDGLIGKGKRNVAEESTLVSASATPD 1268

Query: 58   ETAAAPPVKSESS 70
             +A  P +KSE S
Sbjct: 1269 PSAPPPLIKSEDS 1281

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 69,454,748
Number of extensions: 2957936
Number of successful extensions: 9793
Number of sequences better than 10.0: 53
Number of HSP's gapped: 10016
Number of HSP's successfully gapped: 54
Length of query: 700
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 583
Effective length of database: 40,065,477
Effective search space: 23358173091
Effective search space used: 23358173091
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)