Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D12474g7.344ON31231215850.0
SAKL0F11242g7.344ON30930610081e-137
TDEL0C020307.344ON3113079921e-135
ZYRO0F11594g7.344ON3093079801e-133
Ecym_47297.344ON3263039561e-129
KLTH0H01386g7.344ON3073049301e-125
YLR205C (HMX1)7.344ON3173079291e-125
Suva_10.2997.344ON3202819131e-123
Smik_12.2637.344ON3182838991e-121
Kwal_56.246247.344ON3073068981e-120
Skud_12.2687.344ON3183018941e-120
NCAS0E028907.344ON3153158021e-106
Kpol_530.367.344ON3113137582e-99
TPHA0F029207.344ON3203107341e-95
NDAI0E045007.344ON3273147305e-95
ACL154W7.344ON3192856844e-88
CAGL0A03905g7.344ON2822576666e-86
KAFR0L014707.344ON3003075912e-74
KNAG0B026407.344ON3023115478e-68
Skud_7.1048.112ON95032668.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D12474g
         (312 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D12474g Chr4 complement(1058158..1059096) [939 bp, 312 aa] ...   615   0.0  
SAKL0F11242g Chr6 (878709..879638) [930 bp, 309 aa] {ON} similar...   392   e-137
TDEL0C02030 Chr3 complement(351368..352303) [936 bp, 311 aa] {ON...   386   e-135
ZYRO0F11594g Chr6 (951726..952655) [930 bp, 309 aa] {ON} similar...   382   e-133
Ecym_4729 Chr4 complement(1423384..1424364) [981 bp, 326 aa] {ON...   372   e-129
KLTH0H01386g Chr8 complement(128402..129325) [924 bp, 307 aa] {O...   362   e-125
YLR205C Chr12 complement(552724..553677) [954 bp, 317 aa] {ON}  ...   362   e-125
Suva_10.299 Chr10 complement(525524..526486) [963 bp, 320 aa] {O...   356   e-123
Smik_12.263 Chr12 complement(499758..500714) [957 bp, 318 aa] {O...   350   e-121
Kwal_56.24624 s56 (1078618..1079541) [924 bp, 307 aa] {ON} YLR20...   350   e-120
Skud_12.268 Chr12 complement(499347..500303) [957 bp, 318 aa] {O...   348   e-120
NCAS0E02890 Chr5 complement(565154..566101) [948 bp, 315 aa] {ON...   313   e-106
Kpol_530.36 s530 complement(84853..85788) [936 bp, 311 aa] {ON} ...   296   2e-99
TPHA0F02920 Chr6 (645567..646529) [963 bp, 320 aa] {ON} Anc_7.34...   287   1e-95
NDAI0E04500 Chr5 complement(1009814..1010797) [984 bp, 327 aa] {...   285   5e-95
ACL154W Chr3 (83962..84921) [960 bp, 319 aa] {ON} Syntenic homol...   268   4e-88
CAGL0A03905g Chr1 complement(395219..396067) [849 bp, 282 aa] {O...   261   6e-86
KAFR0L01470 Chr12 (272767..273669) [903 bp, 300 aa] {ON} Anc_7.3...   232   2e-74
KNAG0B02640 Chr2 complement(510618..511526) [909 bp, 302 aa] {ON...   215   8e-68
Skud_7.104 Chr7 complement(193144..195996) [2853 bp, 950 aa] {ON...    30   8.4  

>KLLA0D12474g Chr4 complement(1058158..1059096) [939 bp, 312 aa]
           {ON} similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205C HMX1 ER localized, heme-binding peroxidase
           involved in the degradation of heme
          Length = 312

 Score =  615 bits (1585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/312 (95%), Positives = 297/312 (95%)

Query: 1   MSVEHATTIPSPTDVGALANRINFQTRDMHNKINAYMSMKMAFAMRHGFIYRQGIVAYYY 60
           MSVEHATTIPSPTDVGALANRINFQTRDMHNKINAYMSMKMAFAMRHGFIYRQGIVAYYY
Sbjct: 1   MSVEHATTIPSPTDVGALANRINFQTRDMHNKINAYMSMKMAFAMRHGFIYRQGIVAYYY 60

Query: 61  VFHAIEQEIDRLLEHPVTVQDEKVKGILQQFWCEEFRRSDKLVLDLQVLYNDEYPGSEQL 120
           VFHAIEQEIDRLLEHPVTVQDEKVKGILQQFWCEEFRRSDKLVLDLQVLYNDEYPGSEQL
Sbjct: 61  VFHAIEQEIDRLLEHPVTVQDEKVKGILQQFWCEEFRRSDKLVLDLQVLYNDEYPGSEQL 120

Query: 121 QEFLDGFQLPAKLQEFVDEIHSNVQKEPHTILAYCHVLYLALFAGGRVMKSNLYRHIGLF 180
           QEFLDGFQLPAKLQEFVDEIHSNVQKEPHTILAYCHVLYLALFAGGRVMKSNLYRHIGLF
Sbjct: 121 QEFLDGFQLPAKLQEFVDEIHSNVQKEPHTILAYCHVLYLALFAGGRVMKSNLYRHIGLF 180

Query: 181 PKFGHLSPKELVRRATNFFTFSEEGVDDENRLRWQYKKGYXXXXXXXXXXXXXXXIIEVS 240
           PKFGHLSPKELVRRATNFFTFSEEGVDDENRLRWQYKKGY               IIEVS
Sbjct: 181 PKFGHLSPKELVRRATNFFTFSEEGVDDENRLRWQYKKGYELATRTELTEAEKLRIIEVS 240

Query: 241 QTIFQRNMEVVAEIGEINRAELMGKFSYKLISFLSEEWKYSEKLTPEVKKLIVFALIVFN 300
           QTIFQRNMEVVAEIGEINRAELMGKFSYKLISFLSEEWKYSEKLTPEVKKLIVFALIVFN
Sbjct: 241 QTIFQRNMEVVAEIGEINRAELMGKFSYKLISFLSEEWKYSEKLTPEVKKLIVFALIVFN 300

Query: 301 MVFVYTILRRLI 312
           MVFVYTILRRLI
Sbjct: 301 MVFVYTILRRLI 312

>SAKL0F11242g Chr6 (878709..879638) [930 bp, 309 aa] {ON} similar to
           uniprot|P32339 Saccharomyces cerevisiae YLR205C HMX1 ER
           localized, heme-binding peroxidase involved in the
           degradation of heme
          Length = 309

 Score =  392 bits (1008), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 185/306 (60%), Positives = 231/306 (75%)

Query: 6   ATTIPSPTDVGALANRINFQTRDMHNKINAYMSMKMAFAMRHGFIYRQGIVAYYYVFHAI 65
           ATTIPSPTDVGALANRINF TRD HNKINA MS+K+AFAM+HG IYRQGI+A+YY+F A+
Sbjct: 3   ATTIPSPTDVGALANRINFHTRDSHNKINADMSVKLAFAMKHGHIYRQGILAFYYIFAAV 62

Query: 66  EQEIDRLLEHPVTVQDEKVKGILQQFWCEEFRRSDKLVLDLQVLYNDEYPGSEQLQEFLD 125
           EQEID LL++  T  + + + IL QFWCEEFRRS+ +  DL++LY+ EY    +L  FLD
Sbjct: 63  EQEIDNLLQNASTPLELQTQKILNQFWCEEFRRSNMIFQDLELLYSKEYSTRTELHAFLD 122

Query: 126 GFQLPAKLQEFVDEIHSNVQKEPHTILAYCHVLYLALFAGGRVMKSNLYRHIGLFPKFGH 185
              LP + Q FV+ IH  V+++P+TILAYCHVLYLALFAGG++MKSN+YRH GLFPKF H
Sbjct: 123 DNVLPPQQQAFVEYIHQTVREKPYTILAYCHVLYLALFAGGKLMKSNIYRHTGLFPKFQH 182

Query: 186 LSPKELVRRATNFFTFSEEGVDDENRLRWQYKKGYXXXXXXXXXXXXXXXIIEVSQTIFQ 245
           L+P+++VRR TNFFTFSEEG D E +LRW+YKKGY               II+VS  IF 
Sbjct: 183 LTPEQIVRRGTNFFTFSEEGADAEGKLRWEYKKGYELATRKELTEEQKQEIIKVSSEIFD 242

Query: 246 RNMEVVAEIGEINRAELMGKFSYKLISFLSEEWKYSEKLTPEVKKLIVFALIVFNMVFVY 305
            NM+V+ E+GEINR ELMGKFS+KL+SF+ EEWKYSEKL+ E K  I+    +   +  Y
Sbjct: 243 WNMDVIGELGEINRNELMGKFSFKLVSFILEEWKYSEKLSKENKITILVIFAILQFLLAY 302

Query: 306 TILRRL 311
            +LR+L
Sbjct: 303 WLLRKL 308

>TDEL0C02030 Chr3 complement(351368..352303) [936 bp, 311 aa] {ON}
           Anc_7.344 YLR205C
          Length = 311

 Score =  386 bits (992), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 178/307 (57%), Positives = 233/307 (75%)

Query: 6   ATTIPSPTDVGALANRINFQTRDMHNKINAYMSMKMAFAMRHGFIYRQGIVAYYYVFHAI 65
           A TIP+PTDVGALANRINF TRD HNK+NAYMS+++AFA++HGFIYRQGI+A+Y++F A+
Sbjct: 5   AKTIPAPTDVGALANRINFHTRDAHNKVNAYMSVRLAFALKHGFIYRQGILAFYHIFDAV 64

Query: 66  EQEIDRLLEHPVTVQDEKVKGILQQFWCEEFRRSDKLVLDLQVLYNDEYPGSEQLQEFLD 125
           EQE+DRLL  P   ++ +++ +L+QFW EEFRR++++  DL+VLY+ EY  SE L+ F++
Sbjct: 65  EQELDRLLNDPQNDEERQMQHVLRQFWLEEFRRTNRIFKDLEVLYSPEYSDSESLRNFVE 124

Query: 126 GFQLPAKLQEFVDEIHSNVQKEPHTILAYCHVLYLALFAGGRVMKSNLYRHIGLFPKFGH 185
              L  +LQ FVD IHS VQ++  TILAYCHVLYLALFAGG+VM+SNLYRH GLFPKF +
Sbjct: 125 HQPLAPQLQSFVDSIHSTVQQDSCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFEY 184

Query: 186 LSPKELVRRATNFFTFSEEGVDDENRLRWQYKKGYXXXXXXXXXXXXXXXIIEVSQTIFQ 245
           L+PKELV R TNFFTFS+EG D EN+LRW+YK+GY               I++VS  IF 
Sbjct: 185 LTPKELVIRGTNFFTFSDEGSDAENKLRWKYKEGYELATRQELSESQKTRILQVSSQIFD 244

Query: 246 RNMEVVAEIGEINRAELMGKFSYKLISFLSEEWKYSEKLTPEVKKLIVFALIVFNMVFVY 305
            NM+V+ EIGE+NR ELM KFS+KL+++LSEEWKYS  L+   K  I+   I+   +  Y
Sbjct: 245 WNMDVIGEIGEMNRNELMSKFSFKLLTYLSEEWKYSTILSKRSKDSIIVMAILIQFLVAY 304

Query: 306 TILRRLI 312
            +LR+ I
Sbjct: 305 IVLRKFI 311

>ZYRO0F11594g Chr6 (951726..952655) [930 bp, 309 aa] {ON} similar to
           uniprot|P32339 Saccharomyces cerevisiae YLR205C HMX1 ER
           localized, heme-binding peroxidase involved in the
           degradation of heme
          Length = 309

 Score =  382 bits (980), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 179/307 (58%), Positives = 236/307 (76%), Gaps = 1/307 (0%)

Query: 7   TTIPSPTDVGALANRINFQTRDMHNKINAYMSMKMAFAMRHGFIYRQGIVAYYYVFHAIE 66
            TIP+PTDVGALANRINF TRD HNKINAYMS+++AFA++HG+I+RQGI+AYYY+F AIE
Sbjct: 2   ATIPAPTDVGALANRINFHTRDAHNKINAYMSVRLAFALKHGWIFRQGILAYYYIFQAIE 61

Query: 67  QEIDRLLEHPVTVQDEKVKGILQQFWCEEFRRSDKLVLDLQVLYNDEYPGSEQLQEFL-D 125
           QE+DR+++H    ++ +++ +L +FW  +FRR+D++  DL +LY+ E+P    L++FL  
Sbjct: 62  QELDRIMDHARNEKEMQMQNVLGKFWMNDFRRTDRIFQDLTLLYSPEFPTESSLEQFLTS 121

Query: 126 GFQLPAKLQEFVDEIHSNVQKEPHTILAYCHVLYLALFAGGRVMKSNLYRHIGLFPKFGH 185
           G  L   LQ FVD IH NVQ+EP TILAYCHVLYLALFAGG+VM+SNLYRH GLFPKF H
Sbjct: 122 GNHLAPTLQAFVDSIHKNVQEEPCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFQH 181

Query: 186 LSPKELVRRATNFFTFSEEGVDDENRLRWQYKKGYXXXXXXXXXXXXXXXIIEVSQTIFQ 245
           LSP+ELV+R TNFFTFSEEG + EN+LRW+YK+GY               II VS  IFQ
Sbjct: 182 LSPRELVQRGTNFFTFSEEGSEAENKLRWRYKRGYELATRDELTEEQKQKIISVSSEIFQ 241

Query: 246 RNMEVVAEIGEINRAELMGKFSYKLISFLSEEWKYSEKLTPEVKKLIVFALIVFNMVFVY 305
            NME +AEIGE+NR ELMG  S++L+++L EEWK+++KL+   K L+V A++V   + VY
Sbjct: 242 WNMETIAEIGELNRQELMGSVSFRLLTYLHEEWKHTDKLSKNQKDLLVLAVLVVQFLIVY 301

Query: 306 TILRRLI 312
            +LRR++
Sbjct: 302 LVLRRIL 308

>Ecym_4729 Chr4 complement(1423384..1424364) [981 bp, 326 aa] {ON}
           similar to Ashbya gossypii ACL154W
          Length = 326

 Score =  372 bits (956), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 174/303 (57%), Positives = 223/303 (73%)

Query: 9   IPSPTDVGALANRINFQTRDMHNKINAYMSMKMAFAMRHGFIYRQGIVAYYYVFHAIEQE 68
           IPSPTDVGALANRINF TRDMH K +A++  KMA AMRHGFIYRQGI+A+YY+FHA+EQ+
Sbjct: 22  IPSPTDVGALANRINFCTRDMHTKADAFVMGKMALAMRHGFIYRQGILAFYYIFHAVEQQ 81

Query: 69  IDRLLEHPVTVQDEKVKGILQQFWCEEFRRSDKLVLDLQVLYNDEYPGSEQLQEFLDGFQ 128
           IDRLLE P T ++ ++  IL+QFWCEEFRRS +L+ DL+  Y+ EYP   +LQ+FL+ F+
Sbjct: 82  IDRLLETPSTKEELQISAILRQFWCEEFRRSGRLLRDLEFFYHHEYPTQNELQQFLNDFE 141

Query: 129 LPAKLQEFVDEIHSNVQKEPHTILAYCHVLYLALFAGGRVMKSNLYRHIGLFPKFGHLSP 188
           LP KLQ FVD I     + P TILAYCHVLY ALFAGG+VM+SN+YR+IGLFPK   +S 
Sbjct: 142 LPPKLQRFVDFIRDKTMENPSTILAYCHVLYNALFAGGKVMRSNIYRNIGLFPKPKGISA 201

Query: 189 KELVRRATNFFTFSEEGVDDENRLRWQYKKGYXXXXXXXXXXXXXXXIIEVSQTIFQRNM 248
            E  R  TNFFTFS++GVD+EN+LRWQYKK Y               II+VS   FQ  M
Sbjct: 202 AESSRNGTNFFTFSDDGVDEENKLRWQYKKNYELATREGLDENQKLEIIDVSIANFQAVM 261

Query: 249 EVVAEIGEINRAELMGKFSYKLISFLSEEWKYSEKLTPEVKKLIVFALIVFNMVFVYTIL 308
           +++ EIGE N+ ELM  FS+KL++FLS EW+Y++KL+ EVK+ +  A+   N + +Y  L
Sbjct: 262 DILGEIGETNKKELMNIFSFKLLTFLSNEWRYNQKLSSEVKQALAIAVFFINFLMIYFTL 321

Query: 309 RRL 311
           R +
Sbjct: 322 RTI 324

>KLTH0H01386g Chr8 complement(128402..129325) [924 bp, 307 aa] {ON}
           similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205C HMX1 ER localized, heme-binding peroxidase
           involved in the degradation of heme
          Length = 307

 Score =  362 bits (930), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 169/304 (55%), Positives = 224/304 (73%)

Query: 7   TTIPSPTDVGALANRINFQTRDMHNKINAYMSMKMAFAMRHGFIYRQGIVAYYYVFHAIE 66
           TTIPSPTDVGALANRINF TRD HNKI+  MS K AFAM+HGFIYRQG++A++YVF AIE
Sbjct: 2   TTIPSPTDVGALANRINFHTRDQHNKIDKQMSAKFAFAMKHGFIYRQGVLAFFYVFQAIE 61

Query: 67  QEIDRLLEHPVTVQDEKVKGILQQFWCEEFRRSDKLVLDLQVLYNDEYPGSEQLQEFLDG 126
           QE+DRL +   T ++E+ + IL QFW EEFRR+ +++ DL++LY  E+P S  L+ FL+ 
Sbjct: 62  QELDRLRQEAQTPEEEQTRDILNQFWTEEFRRAPRILQDLELLYAKEFPTSASLRTFLEE 121

Query: 127 FQLPAKLQEFVDEIHSNVQKEPHTILAYCHVLYLALFAGGRVMKSNLYRHIGLFPKFGHL 186
             L  +LQ FVD +H++++  P  ILAYCHVLYLALFAGGRVM+S +YR  GLFPKF +L
Sbjct: 122 TTLAPELQGFVDYVHASIRSRPTAILAYCHVLYLALFAGGRVMRSTIYRSTGLFPKFPNL 181

Query: 187 SPKELVRRATNFFTFSEEGVDDENRLRWQYKKGYXXXXXXXXXXXXXXXIIEVSQTIFQR 246
           + +E+VRR TNFFTFS+ GV  EN+LR  YK+GY               I++VS  IF+ 
Sbjct: 182 TTEEVVRRGTNFFTFSDAGVQAENQLRKNYKRGYELATRQGLTEEQKLNILDVSNAIFEW 241

Query: 247 NMEVVAEIGEINRAELMGKFSYKLISFLSEEWKYSEKLTPEVKKLIVFALIVFNMVFVYT 306
           N  VV EIGEINR ELMGK S++L++F+ EEW+YS+KLT + K L++   +V  ++ +Y 
Sbjct: 242 NTRVVTEIGEINRQELMGKLSFRLLTFVIEEWQYSDKLTRKQKSLVLATGVVLQILMMYW 301

Query: 307 ILRR 310
           +LR+
Sbjct: 302 VLRK 305

>YLR205C Chr12 complement(552724..553677) [954 bp, 317 aa] {ON}
           HMX1ER localized heme oxygenase, involved in heme
           degradation during iron starvation and in the oxidative
           stress response; expression is regulated by AFT1 and
           oxidative stress; relocates to the perinuclear region in
           the presence of oxidants
          Length = 317

 Score =  362 bits (929), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 172/307 (56%), Positives = 222/307 (72%), Gaps = 1/307 (0%)

Query: 1   MSVEHATTIPSPTDVGALANRINFQTRDMHNKINAYMSMKMAFAMRHGFIYRQGIVAYYY 60
           M     T IPSPTDVGALANRINFQTRD HNKIN +M +KMA AMRHGFIYRQGI+AYYY
Sbjct: 1   MEDSSNTIIPSPTDVGALANRINFQTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYY 60

Query: 61  VFHAIEQEIDRLLEHPVTVQDEKVKGILQQFWCEEFRRSDKLVLDLQVLYNDEYPGSEQL 120
           VF AIEQEIDRLL  PVT ++ +   IL+QFW E+FRRS ++  DL++LY++ +  +E L
Sbjct: 61  VFDAIEQEIDRLLNDPVTEEELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESL 120

Query: 121 QEFLDGFQLPAKLQEFVDEIHSNVQKEPHTILAYCHVLYLALFAGGRVMKSNLYRHIGLF 180
            EFL  FQ P  LQ+F++ IH N+ KEP TIL+YCHVLYLALFAGG++++SNLYR +GLF
Sbjct: 121 NEFLATFQKPPLLQQFINNIHENIHKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLF 180

Query: 181 PKFGHLSPKELVRRATNFFTFSEEGVDDENRLRWQYKKGYXXXXXXXXXXXXXXXIIEVS 240
           P F  LS KELV++ TNFFTFS+ G  +E RL+W+YKK Y               II V+
Sbjct: 181 PNFEKLSQKELVKKGTNFFTFSDLGPTEETRLKWEYKKNYELATRTELTEAQKLQIISVA 240

Query: 241 QTIFQRNMEVVAEIGEINRAELMGKFSYKLISFLSEEWKYSEKLTPEVKKLIVFALIVFN 300
           + IF  N  +VAEIGE+NR ELMGKFS+K I++L EEW ++ K +   + L    L+V +
Sbjct: 241 EGIFDWNFNIVAEIGELNRRELMGKFSFKCITYLYEEWMFN-KDSATRRALHTVMLLVLS 299

Query: 301 MVFVYTI 307
           ++ ++ +
Sbjct: 300 IIAIWVL 306

>Suva_10.299 Chr10 complement(525524..526486) [963 bp, 320 aa] {ON}
           YLR205C (REAL)
          Length = 320

 Score =  356 bits (913), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 163/281 (58%), Positives = 211/281 (75%)

Query: 2   SVEHATTIPSPTDVGALANRINFQTRDMHNKINAYMSMKMAFAMRHGFIYRQGIVAYYYV 61
           S   +T IPSPTD+GALANRINF TRD HNKIN +M +KMA AMRHGFIYRQGI+AYYYV
Sbjct: 4   STSTSTIIPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYV 63

Query: 62  FHAIEQEIDRLLEHPVTVQDEKVKGILQQFWCEEFRRSDKLVLDLQVLYNDEYPGSEQLQ 121
           F AIEQEIDRLL   V+ ++ +  GIL+QFW E+FRRS ++  DL++LY++ +  +E L 
Sbjct: 64  FDAIEQEIDRLLNDAVSEKELQACGILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLN 123

Query: 122 EFLDGFQLPAKLQEFVDEIHSNVQKEPHTILAYCHVLYLALFAGGRVMKSNLYRHIGLFP 181
           EFL  F+ P  LQ+FVD+IH N+++EP TIL+YCHVLYLALFAGG++++SNLYR +GLFP
Sbjct: 124 EFLATFEKPPLLQQFVDDIHDNIRQEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFP 183

Query: 182 KFGHLSPKELVRRATNFFTFSEEGVDDENRLRWQYKKGYXXXXXXXXXXXXXXXIIEVSQ 241
            F  L+ KELV++ TNFFTFSE G  +E RL+W+YKK Y               II V++
Sbjct: 184 NFEKLTQKELVKKGTNFFTFSELGPTEETRLKWEYKKNYELATRTELTEAQKLKIISVAE 243

Query: 242 TIFQRNMEVVAEIGEINRAELMGKFSYKLISFLSEEWKYSE 282
            IF  N  +VAEIGE+NR ELM KFS+K ++++ EEW +S+
Sbjct: 244 GIFDWNFNIVAEIGELNRRELMSKFSFKCVTYVYEEWMFSK 284

>Smik_12.263 Chr12 complement(499758..500714) [957 bp, 318 aa] {ON}
           YLR205C (REAL)
          Length = 318

 Score =  350 bits (899), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 163/283 (57%), Positives = 210/283 (74%)

Query: 1   MSVEHATTIPSPTDVGALANRINFQTRDMHNKINAYMSMKMAFAMRHGFIYRQGIVAYYY 60
           M   +   IPSPTD+GALANRINF TRD HNKIN +M +KMA AMRHGFIYRQGI+AYYY
Sbjct: 1   MEDSNNKIIPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYY 60

Query: 61  VFHAIEQEIDRLLEHPVTVQDEKVKGILQQFWCEEFRRSDKLVLDLQVLYNDEYPGSEQL 120
           VF AIEQEIDRLL  PVT ++ +   IL+QFW E+FRRS ++  DL++LY++ +  +E L
Sbjct: 61  VFDAIEQEIDRLLNDPVTGKELQTSAILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESL 120

Query: 121 QEFLDGFQLPAKLQEFVDEIHSNVQKEPHTILAYCHVLYLALFAGGRVMKSNLYRHIGLF 180
            EFL  F+ P  LQ+FV+ IH N+QKEP TIL+YCHVLYLALFAGG++++SNLYR +GLF
Sbjct: 121 NEFLATFEKPPVLQQFVNNIHENIQKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLF 180

Query: 181 PKFGHLSPKELVRRATNFFTFSEEGVDDENRLRWQYKKGYXXXXXXXXXXXXXXXIIEVS 240
           P F  LS KELV++ TNFFTFS+ G  +E RL+ +YKK Y               II V+
Sbjct: 181 PNFEKLSQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVA 240

Query: 241 QTIFQRNMEVVAEIGEINRAELMGKFSYKLISFLSEEWKYSEK 283
           + IF  N  +VAEIGE+NR ELMGKFS+K ++++ EEW ++++
Sbjct: 241 EGIFDWNFNIVAEIGELNRRELMGKFSFKCVTYVYEEWMFNKE 283

>Kwal_56.24624 s56 (1078618..1079541) [924 bp, 307 aa] {ON} YLR205C
           (HMX1) - Putative heme oxygenase [contig 161] FULL
          Length = 307

 Score =  350 bits (898), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 165/306 (53%), Positives = 221/306 (72%)

Query: 7   TTIPSPTDVGALANRINFQTRDMHNKINAYMSMKMAFAMRHGFIYRQGIVAYYYVFHAIE 66
           +TIPSPTDVGALANRINF TRD HNKI+  MS+K AFAM+HGFIYRQG++A++YVF AIE
Sbjct: 2   STIPSPTDVGALANRINFYTRDEHNKIDKQMSVKFAFAMKHGFIYRQGLLAFFYVFQAIE 61

Query: 67  QEIDRLLEHPVTVQDEKVKGILQQFWCEEFRRSDKLVLDLQVLYNDEYPGSEQLQEFLDG 126
           QEIDRLL++  T ++ + + IL QFW   F R+ ++  DL++LY  E+P  EQL  FL  
Sbjct: 62  QEIDRLLQNAQTAEEVQTRDILLQFWVSSFSRTPRIYQDLKLLYAKEFPSDEQLSLFLQQ 121

Query: 127 FQLPAKLQEFVDEIHSNVQKEPHTILAYCHVLYLALFAGGRVMKSNLYRHIGLFPKFGHL 186
             LP + Q FVD +H +V+  P +ILA+CHVLYLALFAGGRVM+S +YR  GLFPKF  L
Sbjct: 122 NTLPPEQQGFVDFVHESVRARPTSILAFCHVLYLALFAGGRVMRSTIYRSTGLFPKFPDL 181

Query: 187 SPKELVRRATNFFTFSEEGVDDENRLRWQYKKGYXXXXXXXXXXXXXXXIIEVSQTIFQR 246
           +P+E+VR+ TNFFTFS++GV  EN+LR +YK+GY               I+EV+   F+ 
Sbjct: 182 TPEEVVRKGTNFFTFSDDGVQAENQLRKEYKRGYELATREGLTEDQKLNILEVAAATFEW 241

Query: 247 NMEVVAEIGEINRAELMGKFSYKLISFLSEEWKYSEKLTPEVKKLIVFALIVFNMVFVYT 306
           N  V++EIGEINR ELMGK S+KL+SF  +EWK++EKLT   K +++    V  ++ +Y 
Sbjct: 242 NTRVISEIGEINRQELMGKLSFKLVSFAIDEWKHTEKLTRRQKSIVLATGAVIQILVMYW 301

Query: 307 ILRRLI 312
           +LR+ +
Sbjct: 302 MLRKFL 307

>Skud_12.268 Chr12 complement(499347..500303) [957 bp, 318 aa] {ON}
           YLR205C (REAL)
          Length = 318

 Score =  348 bits (894), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 168/301 (55%), Positives = 219/301 (72%), Gaps = 1/301 (0%)

Query: 7   TTIPSPTDVGALANRINFQTRDMHNKINAYMSMKMAFAMRHGFIYRQGIVAYYYVFHAIE 66
           T IPSPTDVGALANRINF TRD HNKIN +M ++MA AMRHGFIYRQGI+AYYYVF AIE
Sbjct: 7   TIIPSPTDVGALANRINFHTRDAHNKINTFMGIRMAIAMRHGFIYRQGILAYYYVFDAIE 66

Query: 67  QEIDRLLEHPVTVQDEKVKGILQQFWCEEFRRSDKLVLDLQVLYNDEYPGSEQLQEFLDG 126
           QEIDRLL  PVT ++ +   IL+QFW E+FRRS ++  DL++LY++ +  +E L EFL  
Sbjct: 67  QEIDRLLHDPVTEKELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNLFKSTESLNEFLAK 126

Query: 127 FQLPAKLQEFVDEIHSNVQKEPHTILAYCHVLYLALFAGGRVMKSNLYRHIGLFPKFGHL 186
           F+ P  LQ+FV++IH N++KEP TIL+YCHVLYLALFAGG++++SNLYR +GLFP F  L
Sbjct: 127 FEKPPLLQQFVNDIHENIRKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFERL 186

Query: 187 SPKELVRRATNFFTFSEEGVDDENRLRWQYKKGYXXXXXXXXXXXXXXXIIEVSQTIFQR 246
           S KELV++ TNFFTFS+ G  +E RL+ +YKK Y               II V+  IF  
Sbjct: 187 SQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVAGGIFDW 246

Query: 247 NMEVVAEIGEINRAELMGKFSYKLISFLSEEWKYSEKLTPEVKKLIVFALIVFNMVFVYT 306
           N  +VAEIGE+NR ELMGKFS+K ++++ EEW  S+K +   K      L++ +++ V+ 
Sbjct: 247 NFHIVAEIGELNRRELMGKFSFKCVTYVYEEW-MSDKDSAFRKAFNTAMLLMLSIIAVWV 305

Query: 307 I 307
           I
Sbjct: 306 I 306

>NCAS0E02890 Chr5 complement(565154..566101) [948 bp, 315 aa] {ON}
           Anc_7.344 YLR205C
          Length = 315

 Score =  313 bits (802), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 145/315 (46%), Positives = 211/315 (66%), Gaps = 3/315 (0%)

Query: 1   MSVEHATTIPSPTDVGALANRINFQTRDMHNKINAYMSMKMAFAMRHGFIYRQGIVAYYY 60
           MS    T IPSPTD  ALANRINFQTRD HNKIN  MS+K+A A+RHGFIYRQGI+ YYY
Sbjct: 1   MSSHTNTIIPSPTDTKALANRINFQTRDAHNKINKKMSIKLAIALRHGFIYRQGILTYYY 60

Query: 61  VFHAIEQEIDRLLEHPVTVQDEKVKGILQQFWCEEFRRSDKLVLDLQVLYNDEYPGSEQL 120
           +F  +E+EI +L   P T ++ K+  +L + W  EF R++ L+ DLQ+LY+DEYP  E L
Sbjct: 61  IFKVVEEEIIKLTTSPTTSEEVKIGNLLSKTWIPEFNRTENLLKDLQLLYHDEYPTKEAL 120

Query: 121 QEFL--DGFQLPAKLQEFVDEIHSNVQKEPHTILAYCHVLYLALFAGGRVMKSNLYRHIG 178
           Q FL  +  +LP  L  F+  IH ++ + P +I AYCHVLYLALFAGG++++S +Y+++G
Sbjct: 121 QLFLETNATELPPVLDSFIKYIHQSILENPCSIFAYCHVLYLALFAGGKIIRSKIYKNLG 180

Query: 179 LFPKFGHLSPKELVRRATNFFTFSEEGVDDENRLRWQYKKGYXXXXXXXXXXXXXXXIIE 238
             P F HLS KE+  + TNFF F  +GV +E +L+ ++KK Y               IIE
Sbjct: 181 FLPNFNHLSSKEVFEKGTNFFKFGSDGVIEETKLKLEFKKNYELNTRESLNEKEKSIIIE 240

Query: 239 VSQTIFQRNMEVVAEIGEINRAELMGKFSYKLISFLSEEWKYSEK-LTPEVKKLIVFALI 297
            S+ IF  N+  + E+G IN+ +LM K ++K++++L EEWK+++  L+   K LI+  ++
Sbjct: 241 TSKKIFDYNLMAMEELGSINKEQLMSKLNFKMVTYLLEEWKFNDNFLSKRGKHLIMVVMV 300

Query: 298 VFNMVFVYTILRRLI 312
           + +M+F + IL+R +
Sbjct: 301 LLHMLFAFFILKRFL 315

>Kpol_530.36 s530 complement(84853..85788) [936 bp, 311 aa] {ON}
           complement(84853..85788) [936 nt, 312 aa]
          Length = 311

 Score =  296 bits (758), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 144/313 (46%), Positives = 208/313 (66%), Gaps = 9/313 (2%)

Query: 6   ATTIPSPTDVGALANRINFQTRDMHNKINAYMSMKMAFAMRHGFIYRQGIVAYYYVFHAI 65
            +TIPSPTDVGALANRINF+TRD HNK++A+M +++A A++HGFIYR+G+V +Y++F+ I
Sbjct: 2   TSTIPSPTDVGALANRINFETRDFHNKVSAFMGIRLALALKHGFIYREGLVVFYHIFNTI 61

Query: 66  EQEIDRLLEHPVTVQDEKVKGILQQFWCEEFRRSDKLVLDLQVLYNDEYPGSE-QLQEFL 124
           E EID +L +     D ++K IL  F+ +EFRR DK++ DL++LY  E+     QL EF+
Sbjct: 62  ETEIDLVLNNQ---DDSQMKLILSSFYLDEFRRKDKILKDLELLYYPEFQNDRPQLLEFI 118

Query: 125 DGFQL---PAKLQEFVDEIHSNVQKEPHTILAYCHVLYLALFAGGRVMKSNLYRHIGLFP 181
           +  +      +LQ FV  I +N  ++P T+LAYCHVLYLALFAGG++MKSN+ +H+G+FP
Sbjct: 119 NSDRFTNDSEQLQNFVKYIQTNATEDPCTLLAYCHVLYLALFAGGKIMKSNVTKHLGIFP 178

Query: 182 KFGHLSPKELVRRATNFFTFSEEGVDDEN--RLRWQYKKGYXXXXXXXXXXXXXXXIIEV 239
           KF HLS KE++ R TNF+ F++    +    +LRW YKK Y               +I+ 
Sbjct: 179 KFEHLSHKEIIARGTNFYQFTDSTNPETTDVKLRWLYKKNYELSTRDELLEQQKLTVIKT 238

Query: 240 SQTIFQRNMEVVAEIGEINRAELMGKFSYKLISFLSEEWKYSEKLTPEVKKLIVFALIVF 299
           S+ +F      +AE+G  NR ELM  FSYKL +F+ EEWKY+  ++P +KK ++F LI+ 
Sbjct: 239 SKDVFVMLENCIAEVGTRNRNELMNIFSYKLFTFIVEEWKYNSSISPFLKKSLMFILIII 298

Query: 300 NMVFVYTILRRLI 312
                  +L R I
Sbjct: 299 QFTLASVLLNRYI 311

>TPHA0F02920 Chr6 (645567..646529) [963 bp, 320 aa] {ON} Anc_7.344
           YLR205C
          Length = 320

 Score =  287 bits (734), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 150/310 (48%), Positives = 210/310 (67%), Gaps = 9/310 (2%)

Query: 9   IPSPTDVGALANRINFQTRDMHNKINAYMSMKMAFAMRHGFIYRQGIVAYYYVFHAIEQE 68
           IPSPTDV ALANRINF+TRD HNKI A+MS+++A A+RHGFIYRQG+VA+Y++F  IE E
Sbjct: 7   IPSPTDVKALANRINFETRDFHNKIGAFMSIRLALALRHGFIYRQGLVAFYHIFGTIENE 66

Query: 69  IDRLLEHPVTVQDE---KVKGILQQFWCEEFRRSDKLVLDLQVLYNDEYPGSEQ-LQEFL 124
           ID LL    +  D    + K IL+ F+  EFRR D L+ DL VLY  E+ G+ Q + +FL
Sbjct: 67  IDNLLNTLDSELDSVQIQTKKILKSFYVNEFRRKDNLLQDLTVLYYPEFKGNRQDVLDFL 126

Query: 125 DGFQLPA----KLQEFVDEIHSNVQKEPHTILAYCHVLYLALFAGGRVMKSNLYRHIGLF 180
           +          +L  F D I    +++P+TI+AYCHVLYLALFAGG++MKSN+ +++GLF
Sbjct: 127 NSETFNKENYPELNFFTDYIKDTTKEKPYTIIAYCHVLYLALFAGGKIMKSNVLKNVGLF 186

Query: 181 PKFGHLSPKELVRRATNFFTFSEEGVDD-ENRLRWQYKKGYXXXXXXXXXXXXXXXIIEV 239
           PKF H+S +E+  + +NFF F++E   D +++LR++YKK Y               IIEV
Sbjct: 187 PKFDHMSHEEVTNQGSNFFRFTQEDTADFDSKLRFEYKKNYELSTRDELNEMQKNDIIEV 246

Query: 240 SQTIFQRNMEVVAEIGEINRAELMGKFSYKLISFLSEEWKYSEKLTPEVKKLIVFALIVF 299
           S+ IF     V+AEIG  NR +LMG F+ K I++L EEWKY+EKLT   K++I+  + + 
Sbjct: 247 SKNIFVMLENVIAEIGAKNRTKLMGGFTLKTITYLVEEWKYNEKLTKTNKQIILLIISII 306

Query: 300 NMVFVYTILR 309
           N++  YTI++
Sbjct: 307 NILITYTIIK 316

>NDAI0E04500 Chr5 complement(1009814..1010797) [984 bp, 327 aa] {ON}
           Anc_7.344 YLR205C
          Length = 327

 Score =  285 bits (730), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 140/314 (44%), Positives = 206/314 (65%), Gaps = 16/314 (5%)

Query: 1   MSVEHATTIPSPTDVGALANRINFQTRDMHNKINAYMSMKMAFAMRHGFIYRQGIVAYYY 60
           MS    T IPSPTD  ALANRINF TRD HNKI+  M++K+A A+RHG IYRQGI+ YYY
Sbjct: 1   MSSSTVTIIPSPTDTEALANRINFHTRDAHNKIDKKMTLKLAVALRHGDIYRQGILTYYY 60

Query: 61  VFHAIEQEIDRLL--EHPVTVQDEKVKGILQQFWCEEFRRSDKLVLDLQVLYNDEYPGSE 118
           +F A+E EI+ LL      T + ++   +L + W  EF R+DKL  DL++LY+D +   +
Sbjct: 61  IFQAVESEINYLLSFNTDATKEQKRTGSLLSKIWLTEFNRTDKLFKDLKLLYSDRFQNDQ 120

Query: 119 QLQEFLD-GFQL-----PAKLQEFVDEIHSNVQKEPHTILAYCHVLYLALFAGGRVMKSN 172
            L  F++  F+L      +KL +FV+ IH ++Q  P  ILAYCHVLYLALFAGG+++KS 
Sbjct: 121 DLLNFINEEFKLIHQNKNSKLYQFVNFIHISIQTNPCCILAYCHVLYLALFAGGKIIKSK 180

Query: 173 LYRHIGLFPKFGHLSPKELVRRATNFFTFSE-----EGVD---DENRLRWQYKKGYXXXX 224
           +Y+++G  P F HLS KEL   ATNFF F+E     EG++   +EN+L+ ++K+ +    
Sbjct: 181 IYKNLGFLPNFNHLSSKELFNNATNFFQFTENSDSLEGINSISNENKLKLKFKRNFELNT 240

Query: 225 XXXXXXXXXXXIIEVSQTIFQRNMEVVAEIGEINRAELMGKFSYKLISFLSEEWKYSEKL 284
                      IIE+++ IFQ N+E + E+G+ N+ ELM  FS+KLI++L EEWK+++ +
Sbjct: 241 RSNLNENEKLTIIEIAKQIFQWNLESMEELGQRNQKELMNLFSFKLINYLFEEWKFNDSI 300

Query: 285 TPEVKKLIVFALIV 298
               K +++F +++
Sbjct: 301 KKNFKAILMFVILL 314

>ACL154W Chr3 (83962..84921) [960 bp, 319 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR205C (HMX1)
          Length = 319

 Score =  268 bits (684), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 130/285 (45%), Positives = 181/285 (63%), Gaps = 1/285 (0%)

Query: 3   VEHATTIPSPTDVGALANRINFQTRDMHNKINAYMSMKMAFAMRHGFIYRQGIVAYYYVF 62
            + +  +P PTD GALANRINF TR++H+K +A++S K A A+RH  IYRQG++A YY+F
Sbjct: 12  TQASPVVPLPTDTGALANRINFHTRELHSKADAFVSAKFAVALRHPSIYRQGLLAMYYIF 71

Query: 63  HAIEQEIDRLLEHPVTVQDEKVKGILQQFWCEEFRRSDKLVLDLQVLYNDEYPGSEQLQE 122
            ++EQ IDRLL  P T  + ++  IL+ FW  EF R+  LV D +V Y  EY  S QL +
Sbjct: 72  RSVEQHIDRLLRAPATADEARIGEILRAFWRPEFARAPALVQDFEVYYAAEYSTSAQLHQ 131

Query: 123 FLDGFQLPAKLQEFVDEIHSNVQKEPHTILAYCHVLYLALFAGGRVMKSNLYRHIGLFPK 182
           FLD ++LP +L   V +I +   ++P TILA+CHVLYLALFAGGRVM+S L R +GL P+
Sbjct: 132 FLDSYELPPRLAAAVADIEAAALRQPWTILAHCHVLYLALFAGGRVMRSALSRQLGLLPR 191

Query: 183 FGHLSPKELVRRATNFFTFSEEGVDDENRLRWQYKKGYXXXXXXXXXXXXXXXIIEVSQT 242
              LS +E   R T+FFTF   G  +EN+ R  YK+ Y               +I+ ++ 
Sbjct: 192 AAGLSARETQLRGTHFFTFG-AGAGEENKARVAYKRAYELATRTALSEAEKADVIDAARA 250

Query: 243 IFQRNMEVVAEIGEINRAELMGKFSYKLISFLSEEWKYSEKLTPE 287
            F     V+AE+   NR EL+G  SY+L++FL EEW+Y  K +P+
Sbjct: 251 DFDHIQAVMAELAVRNRQELLGSPSYRLLTFLGEEWRYRTKNSPQ 295

>CAGL0A03905g Chr1 complement(395219..396067) [849 bp, 282 aa] {ON}
           similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205c
          Length = 282

 Score =  261 bits (666), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 130/257 (50%), Positives = 174/257 (67%), Gaps = 11/257 (4%)

Query: 37  MSMKMAFAMRHGFIYRQGIVAYYYVFHAIEQEIDRLLE--------HPVTVQDEKV--KG 86
           MS++ A A+RHG +YRQGI+A+YYVF AIEQEID LL             V D+K+    
Sbjct: 1   MSVRFAVALRHGKLYRQGILAFYYVFQAIEQEIDALLSIDTATGATGATDVSDQKLLASK 60

Query: 87  ILQQFWCEEFRRSDKLVLDLQVLYNDEYPGSEQLQEFLDGFQLPAKLQEFVDEIHSNVQK 146
           I++QFW  EFRR+++L  DL +LY+ EYP S +L   L   QLP +LQ FVD +H+ V++
Sbjct: 61  IVKQFWMPEFRRTEQLYKDLLLLYSPEYPTSTELDAMLVDHQLPPQLQGFVDMVHATVRQ 120

Query: 147 EPHTILAYCHVLYLALFAGGRVMKSNLYRHIGLFPKFGHLSPKELVRRATNFFTFSEEGV 206
            P T+LAYCHV+YLALFAGG+VM+S LYR+ GLFPKF HLS KEL R+ TNFFTFS+ GV
Sbjct: 121 NPVTVLAYCHVMYLALFAGGKVMRSTLYRNTGLFPKFEHLSSKELARKGTNFFTFSDAGV 180

Query: 207 DDENRLRWQYKKGYXXXXXXXXXXXXXXXIIEVSQTIFQRNMEVVAEIGEINRAELMGKF 266
           D EN+L+WQYKK Y               II+V++ IF+RNM+++ EIG++N+  L    
Sbjct: 181 DVENQLKWQYKKNYELATREALAENDKLEIIDVAKRIFERNMDIIQEIGQLNKEALTNN- 239

Query: 267 SYKLISFLSEEWKYSEK 283
              L+ ++ EE K+  K
Sbjct: 240 KLDLLQYVFEELKFYNK 256

>KAFR0L01470 Chr12 (272767..273669) [903 bp, 300 aa] {ON} Anc_7.344
           YLR205C
          Length = 300

 Score =  232 bits (591), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 118/307 (38%), Positives = 195/307 (63%), Gaps = 20/307 (6%)

Query: 9   IPSPTDVGALANRINFQTRDMHNKINAYMSMKMAFAMRHGFIYRQGIVAYYYVFHAIEQE 68
           +PSPTD  ALANRINF TRD+HN I+  MS+K  FA+RH FIY+  +++YYYVF  +E E
Sbjct: 5   VPSPTDTDALANRINFHTRDLHNVIDKTMSIKATFALRHSFIYKDILLSYYYVFRTLEDE 64

Query: 69  IDRLLEHPVTVQDEKVKGILQQFWCEEFRRSDKLVLDLQVLYNDEYPGSEQLQEFLDGFQ 128
           ID ++ +  +     +  IL+ F+ ++FRR D+++ DL+ L          +Q+  D   
Sbjct: 65  IDFIISNDRS----HIGEILRGFFNDKFRRKDQILKDLKFL--------NVIQDQSDDQW 112

Query: 129 LPAK--LQEFVDEIHSNVQKEPHTILAYCHVLYLALFAGGRVMKSNLYRHIGLF--PKFG 184
           L ++  L +F++ I SN+ + P  +LAYCHVLYLALFAGGR+M++++ +++  F  PKF 
Sbjct: 113 LSSRPELCKFLNFIKSNLHEHPVDVLAYCHVLYLALFAGGRIMRASMNKNLSFFFMPKFD 172

Query: 185 HLSPKELVRRATNFFTFSEEGVDDENRLRWQYKKGYXXXXXXXXXXXXXXXIIEVSQTIF 244
            +S  +++  ATNFF F ++ V  EN+L+ +YK+ Y               II++S+ IF
Sbjct: 173 KMSHTDVIMNATNFFKFDKDIV-SENKLKSEYKRNYDILTKAKLNEDEKLEIIDISREIF 231

Query: 245 QRNMEVVAEIGEINRAELMGKFSYKLISFLSEEWKYSEKLTPEVKKLIVFALIVFNMVFV 304
           + N  ++ EIG +N+ ELM  F+YK+++++ EEWK+ +   P++KK ++  LI+F++   
Sbjct: 232 KFNFNLLQEIGTVNKDELMKNFNYKMVTYVVEEWKFRK---PQIKKYVILFLIIFHLFVF 288

Query: 305 YTILRRL 311
             + ++ 
Sbjct: 289 INLFKKF 295

>KNAG0B02640 Chr2 complement(510618..511526) [909 bp, 302 aa] {ON}
           Anc_7.344 YLR205C
          Length = 302

 Score =  215 bits (547), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 121/311 (38%), Positives = 174/311 (55%), Gaps = 18/311 (5%)

Query: 7   TTIPSPTDVGALANRINFQTRDMHNKINAYMSMKMAFAMRHGFIYRQGIVAYYYVFHAIE 66
           +TIPSPTD  ALANRINF TRD+HN+++   S+K   A+RH FIY   +  +Y VF  +E
Sbjct: 3   STIPSPTDTDALANRINFHTRDLHNEVDKAFSVKFMMALRHSFIYTDILKTFYTVFGTVE 62

Query: 67  QEIDRLLEHPVTVQDEKVKGILQQFWCEEFRRSDKLVLDLQVLYNDEYPGSEQLQEFLDG 126
           Q ID L+    +   + V  IL +F+  EFRR+DK+  DL  L   E+   E  Q     
Sbjct: 63  QRIDELI---ASEGGDGVGAILGEFYVPEFRRADKIKRDLVFL--GEWDTVESGQ----- 112

Query: 127 FQLPAKLQEFVDEIHSNVQKEPHTILAYCHVLYLALFAGGRVMKSNLYRHIGLFPKFG-- 184
           +  P +L  F+  + S + ++P T+LA CHVLYLALFAGGRV KS+L++++G  P F   
Sbjct: 113 WTPPPQLAGFLQYLRSEMDRDPITVLAPCHVLYLALFAGGRVFKSSLFKNLGFLPNFRDK 172

Query: 185 -----HLSPKELVRRATNFFTFSEEGVDDENRLRWQYKKGYXXXXXXXXXXXXXXXIIEV 239
                 +S   LV  ATNFF F+E  ++DEN+LRW YK+ Y               +I  
Sbjct: 173 NGPGEEMSDHTLVSNATNFFQFAET-IEDENKLRWTYKRNYELATRDTLTEDQKLAVIAA 231

Query: 240 SQTIFQRNMEVVAEIGEINRAELMGKFSYKLISFLSEEWKYSEKLTPEVKKLIVFALIVF 299
           S+ +F+    V+ EI + N  ELM   S+K++++  EEWK+++     V   + F     
Sbjct: 232 SRDVFRHTFAVIEEICQQNHDELMSFRSFKIVTYFLEEWKFNKNFKRGVLWGVAFLAQFL 291

Query: 300 NMVFVYTILRR 310
            +V     LRR
Sbjct: 292 FVVLYCCFLRR 302

>Skud_7.104 Chr7 complement(193144..195996) [2853 bp, 950 aa] {ON}
           YGL167C (REAL)
          Length = 950

 Score = 30.0 bits (66), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 19/32 (59%)

Query: 2   SVEHATTIPSPTDVGALANRINFQTRDMHNKI 33
           S EHAT + +PTDV  L    NF+  D+ N +
Sbjct: 438 SQEHATFLGNPTDVALLEQLANFEMPDIRNTV 469

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.140    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 30,480,328
Number of extensions: 1272693
Number of successful extensions: 4430
Number of sequences better than 10.0: 23
Number of HSP's gapped: 4506
Number of HSP's successfully gapped: 23
Length of query: 312
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 203
Effective length of database: 40,982,805
Effective search space: 8319509415
Effective search space used: 8319509415
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 65 (29.6 bits)