Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D12430g7.346ON41841822640.0
Ecym_47277.346ON42940718100.0
SAKL0F11286g7.346ON42340317190.0
KLTH0H01342g7.346ON42240316980.0
CAGL0A03927g7.346ON43743716970.0
TDEL0C020207.346ON42541816880.0
Kpol_530.357.346ON42540516800.0
Kwal_56.246317.346ON42240316710.0
NCAS0E028807.346ON42940716500.0
TPHA0F029307.346ON43640316360.0
Suva_10.2977.346ON43640216360.0
Skud_12.2667.346ON43640216330.0
Smik_12.2617.346ON43640216330.0
YLR203C (MSS51)7.346ON43640216230.0
NDAI0E044807.346ON44340416150.0
ZYRO0F11616g7.346ON41540916060.0
ACL152W7.346ON42842215830.0
KNAG0B026307.346ON43842615720.0
KAFR0B008407.346ON42642815500.0
NCAS0A141207.346ON42740115490.0
NDAI0A019307.346ON45041615300.0
TBLA0E005007.346ON43741214770.0
KNAG0C037507.346ON42440214400.0
KLLA0D07029g8.642ON534146741.5
Suva_6.1261.331ON82072713.7
KLTH0G11418g8.357ON897117705.2
NCAS0A075807.38ON27775685.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D12430g
         (418 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D12430g Chr4 complement(1055878..1057134) [1257 bp, 418 aa]...   876   0.0  
Ecym_4727 Chr4 complement(1420885..1422174) [1290 bp, 429 aa] {O...   701   0.0  
SAKL0F11286g Chr6 (880536..881807) [1272 bp, 423 aa] {ON} simila...   666   0.0  
KLTH0H01342g Chr8 complement(125673..126941) [1269 bp, 422 aa] {...   658   0.0  
CAGL0A03927g Chr1 (397179..398492) [1314 bp, 437 aa] {ON} highly...   658   0.0  
TDEL0C02020 Chr3 complement(349453..350730) [1278 bp, 425 aa] {O...   654   0.0  
Kpol_530.35 s530 complement(83032..84309) [1278 bp, 425 aa] {ON}...   651   0.0  
Kwal_56.24631 s56 (1080985..1082253) [1269 bp, 422 aa] {ON} YLR2...   648   0.0  
NCAS0E02880 Chr5 complement(563006..564295) [1290 bp, 429 aa] {O...   640   0.0  
TPHA0F02930 Chr6 (647081..648391) [1311 bp, 436 aa] {ON} Anc_7.3...   634   0.0  
Suva_10.297 Chr10 complement(523465..524775) [1311 bp, 436 aa] {...   634   0.0  
Skud_12.266 Chr12 complement(497291..498601) [1311 bp, 436 aa] {...   633   0.0  
Smik_12.261 Chr12 complement(497673..498983) [1311 bp, 436 aa] {...   633   0.0  
YLR203C Chr12 complement(550650..551960) [1311 bp, 436 aa] {ON} ...   629   0.0  
NDAI0E04480 Chr5 complement(1007346..1008677) [1332 bp, 443 aa] ...   626   0.0  
ZYRO0F11616g Chr6 (953577..954824) [1248 bp, 415 aa] {ON} simila...   623   0.0  
ACL152W Chr3 (85701..86987) [1287 bp, 428 aa] {ON} Syntenic homo...   614   0.0  
KNAG0B02630 Chr2 complement(508645..509961) [1317 bp, 438 aa] {O...   610   0.0  
KAFR0B00840 Chr2 (159480..160760) [1281 bp, 426 aa] {ON} Anc_7.3...   601   0.0  
NCAS0A14120 Chr1 (2777017..2778300) [1284 bp, 427 aa] {ON} Anc_7...   601   0.0  
NDAI0A01930 Chr1 complement(430531..431883) [1353 bp, 450 aa] {O...   593   0.0  
TBLA0E00500 Chr5 (91769..93082) [1314 bp, 437 aa] {ON} Anc_7.346...   573   0.0  
KNAG0C03750 Chr3 (740426..741700) [1275 bp, 424 aa] {ON} Anc_7.3...   559   0.0  
KLLA0D07029g Chr4 (602763..604367) [1605 bp, 534 aa] {ON} simila...    33   1.5  
Suva_6.126 Chr6 complement(209913..212375) [2463 bp, 820 aa] {ON...    32   3.7  
KLTH0G11418g Chr7 (962267..964960) [2694 bp, 897 aa] {ON} simila...    32   5.2  
NCAS0A07580 Chr1 complement(1507060..1507893) [834 bp, 277 aa] {...    31   5.7  

>KLLA0D12430g Chr4 complement(1055878..1057134) [1257 bp, 418 aa]
           {ON} similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203C MSS51 Protein required for the maturation and
           translation of COX1 mRNA involved in maturation of COX1
           and COB mRNA
          Length = 418

 Score =  876 bits (2264), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/418 (100%), Positives = 418/418 (100%)

Query: 1   MLASRTPVVYRAKPMTRPIMGFVRNALGLDPPASPDDPTPENRFHPWDQSPSPDLRERAA 60
           MLASRTPVVYRAKPMTRPIMGFVRNALGLDPPASPDDPTPENRFHPWDQSPSPDLRERAA
Sbjct: 1   MLASRTPVVYRAKPMTRPIMGFVRNALGLDPPASPDDPTPENRFHPWDQSPSPDLRERAA 60

Query: 61  RIKAMATCPVTHKDIQFTCPLSGIPTHHSREAWEKDTEYHKSKRYELLKKVNIYEHDLRS 120
           RIKAMATCPVTHKDIQFTCPLSGIPTHHSREAWEKDTEYHKSKRYELLKKVNIYEHDLRS
Sbjct: 61  RIKAMATCPVTHKDIQFTCPLSGIPTHHSREAWEKDTEYHKSKRYELLKKVNIYEHDLRS 120

Query: 121 GRPFPEFDFPQDQDYDRMVNMSNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLH 180
           GRPFPEFDFPQDQDYDRMVNMSNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLH
Sbjct: 121 GRPFPEFDFPQDQDYDRMVNMSNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLH 180

Query: 181 QYSPYSLNPKGPITLEGLKSLAALRYTLYPEQSGRFRAGQDTPIRIFILGTRAEAQLPGH 240
           QYSPYSLNPKGPITLEGLKSLAALRYTLYPEQSGRFRAGQDTPIRIFILGTRAEAQLPGH
Sbjct: 181 QYSPYSLNPKGPITLEGLKSLAALRYTLYPEQSGRFRAGQDTPIRIFILGTRAEAQLPGH 240

Query: 241 VWKQLQYLIPDTSIELHFVGPESFYDREKRSYVQSSTETIVKRIDEKMQLFYHTDFFHVF 300
           VWKQLQYLIPDTSIELHFVGPESFYDREKRSYVQSSTETIVKRIDEKMQLFYHTDFFHVF
Sbjct: 241 VWKQLQYLIPDTSIELHFVGPESFYDREKRSYVQSSTETIVKRIDEKMQLFYHTDFFHVF 300

Query: 301 HEAQDFFPYDPYNDVFFCFHPGFAAPETEEYWMGDTMKALMQTKCAVFTTGFSKEDLLRD 360
           HEAQDFFPYDPYNDVFFCFHPGFAAPETEEYWMGDTMKALMQTKCAVFTTGFSKEDLLRD
Sbjct: 301 HEAQDFFPYDPYNDVFFCFHPGFAAPETEEYWMGDTMKALMQTKCAVFTTGFSKEDLLRD 360

Query: 361 ISIVQDKYGSELDMLMEPVPNVFGSTKWELNDTNPHEVYQFNMYIAGFRGKRYHAIEL 418
           ISIVQDKYGSELDMLMEPVPNVFGSTKWELNDTNPHEVYQFNMYIAGFRGKRYHAIEL
Sbjct: 361 ISIVQDKYGSELDMLMEPVPNVFGSTKWELNDTNPHEVYQFNMYIAGFRGKRYHAIEL 418

>Ecym_4727 Chr4 complement(1420885..1422174) [1290 bp, 429 aa] {ON}
           similar to Ashbya gossypii ACL152W
          Length = 429

 Score =  701 bits (1810), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/407 (79%), Positives = 363/407 (89%), Gaps = 1/407 (0%)

Query: 12  AKPMTRPIMGFVRNALGLDPPASPDDPTPENRFHPWDQSPSPDLRERAARIKAMATCPVT 71
            K   R IMGFVRNALGLDPP SPD+PT +NRFHPWDQSPSP+LRERAARIKA+A CPVT
Sbjct: 24  GKQQRRQIMGFVRNALGLDPPTSPDEPTVDNRFHPWDQSPSPELRERAARIKALAKCPVT 83

Query: 72  HKDIQFTCPLSGIPTHHSREAWEKDTEYHKSKRYELLKKVNIYEHDLRSGRPFPEFDFPQ 131
            K+IQF+C  SGIPTHHS EAW+ D+EYH+SKRY LLKKVNIYEHDLRSGRPF EFDFP+
Sbjct: 84  GKNIQFSCKYSGIPTHHSEEAWKNDSEYHESKRYRLLKKVNIYEHDLRSGRPFLEFDFPE 143

Query: 132 DQDYDRMVNMSNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQYSPYSLNPKG 191
            QDYDRMVNM NWDL+FYTRSF+SMDTEFQLAAVTKMLSYPITIGS+LHQYSPYSLNPKG
Sbjct: 144 QQDYDRMVNMMNWDLYFYTRSFFSMDTEFQLAAVTKMLSYPITIGSILHQYSPYSLNPKG 203

Query: 192 PITLEGLKSLAALRYTLYPEQSGRFRAGQDTPIRIFILGTRAEAQLPGHVWKQLQYLIPD 251
           PITLEGLKSLAALRYTLYPEQ+ R R+ QD P+R+FILG RAEAQLPGHVWKQLQYL P+
Sbjct: 204 PITLEGLKSLAALRYTLYPEQNRRVRSIQDKPLRVFILGARAEAQLPGHVWKQLQYLFPE 263

Query: 252 TSIELHFVGPESFYDREKRSYVQSSTETIVKRIDEKMQLFYHTDFFHVFHEAQDFFPYDP 311
           + IELHFVGPES YDREKR YV SS   +VKRID+ M++ YHTD+FHVFHEAQDFFPYDP
Sbjct: 264 SLIELHFVGPESNYDREKREYVTSSI-PVVKRIDDTMKMHYHTDYFHVFHEAQDFFPYDP 322

Query: 312 YNDVFFCFHPGFAAPETEEYWMGDTMKALMQTKCAVFTTGFSKEDLLRDISIVQDKYGSE 371
           YND+FFCFHPGF +PET + WM  T++AL+QTKCA+FTTGF+K+DL+ D+  V++KYG E
Sbjct: 323 YNDIFFCFHPGFGSPETRDTWMNSTLQALLQTKCAIFTTGFNKKDLMDDLQAVKEKYGDE 382

Query: 372 LDMLMEPVPNVFGSTKWELNDTNPHEVYQFNMYIAGFRGKRYHAIEL 418
           LDML++P  NVFGSTKWELND NPHEVYQFNMYIAGFRGKRYHAIEL
Sbjct: 383 LDMLVDPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHAIEL 429

>SAKL0F11286g Chr6 (880536..881807) [1272 bp, 423 aa] {ON} similar
           to uniprot|P32335 Saccharomyces cerevisiae YLR203C MSS51
           Protein required for the maturation and translation of
           COX1 mRNA involved in maturation of COX1 and COB mRNA
          Length = 423

 Score =  666 bits (1719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/403 (78%), Positives = 363/403 (90%), Gaps = 2/403 (0%)

Query: 17  RPIMGFVRNALGLDPPASPDDPTPENRFHPWDQSPSPDLRERAARIKAMATCPVTHKDIQ 76
           R I+GFVRNALGLDPP SPDDPTP+NRFHPWDQSPSPDLR RAA I+A+A CPVT K+I 
Sbjct: 22  RHIIGFVRNALGLDPPPSPDDPTPDNRFHPWDQSPSPDLRTRAATIRALARCPVTGKEIN 81

Query: 77  FTCPLSGIPTHHSREAWEKDTEYHKSKRYELLKKVNIYEHDLRSGRPFPEFDFPQDQDYD 136
           +TCP SGIPTHHSREAWE+DT YH +K+YE+LKKVNIYEHDLRSGRPFPEFDFPQDQDYD
Sbjct: 82  YTCPQSGIPTHHSREAWEQDTMYHATKKYEILKKVNIYEHDLRSGRPFPEFDFPQDQDYD 141

Query: 137 RMVNMSNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQYSPYSLNPKGPITLE 196
           RMVNM+NWDLFFYTR FYSMDTEFQLAAVTKMLSYP T+GSVLH++SPY+LNPKGPITLE
Sbjct: 142 RMVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPTTVGSVLHEFSPYALNPKGPITLE 201

Query: 197 GLKSLAALRYTLYPEQSGRFRAG-QDTPIRIFILGTRAEAQLPGHVWKQLQYLIPDTSIE 255
           GLKSLAALRYTLYP+Q  +  A  +D P+RIFILG RAEAQLPGHVWKQ Q+L P+ + E
Sbjct: 202 GLKSLAALRYTLYPQQHRKVSAATKDRPMRIFILGARAEAQLPGHVWKQFQFLFPEINFE 261

Query: 256 LHFVGPESFYDREKRSYVQSSTETIVKRIDEKMQLFYHTDFFHVFHEAQDFFPYDPYNDV 315
           LHF+GPESFYDREKR Y+ SST  IV+R+DE +   YHTD+FHVFHEAQDFFPYDPY D+
Sbjct: 262 LHFIGPESFYDREKREYITSST-PIVRRVDETLSFVYHTDYFHVFHEAQDFFPYDPYLDI 320

Query: 316 FFCFHPGFAAPETEEYWMGDTMKALMQTKCAVFTTGFSKEDLLRDISIVQDKYGSELDML 375
           FFCFHPGFAAPE+ E+WMG TM+ L++TKCA+FTTGF+++DL+RD++ V++KYG+E+DML
Sbjct: 321 FFCFHPGFAAPESTEHWMGKTMEGLLETKCAIFTTGFNEQDLVRDMTAVREKYGNEMDML 380

Query: 376 MEPVPNVFGSTKWELNDTNPHEVYQFNMYIAGFRGKRYHAIEL 418
           MEPV N+FGSTKWELND NP EVYQFNMYIAGFRGKRYHAIE+
Sbjct: 381 MEPVRNLFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 423

>KLTH0H01342g Chr8 complement(125673..126941) [1269 bp, 422 aa] {ON}
           similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203C MSS51 Protein required for the maturation and
           translation of COX1 mRNA involved in maturation of COX1
           and COB mRNA
          Length = 422

 Score =  658 bits (1698), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/403 (78%), Positives = 359/403 (89%), Gaps = 2/403 (0%)

Query: 17  RPIMGFVRNALGLDPPASPDDPTPENRFHPWDQSPSPDLRERAARIKAMATCPVTHKDIQ 76
           R IMGFVRNALGLDPP SPD+PTPENRFHPWDQSPSPDLRERAA I+A+A CPVT ++I 
Sbjct: 21  RHIMGFVRNALGLDPPPSPDEPTPENRFHPWDQSPSPDLRERAATIRALAKCPVTGREIN 80

Query: 77  FTCPLSGIPTHHSREAWEKDTEYHKSKRYELLKKVNIYEHDLRSGRPFPEFDFPQDQDYD 136
           +TCP SGIPTH+SREAWE D EY +SKR E+LKKVNIYEHDLRSGRPFPEFDFP DQD+D
Sbjct: 81  YTCPKSGIPTHYSREAWENDLEYQQSKRPEILKKVNIYEHDLRSGRPFPEFDFPLDQDFD 140

Query: 137 RMVNMSNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQYSPYSLNPKGPITLE 196
           RMVN++NWDLFFYTR FYSMDTEFQLAAVTKMLSYP+TIGSVLHQ+SPYSLNPKGP+TLE
Sbjct: 141 RMVNLTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIGSVLHQFSPYSLNPKGPVTLE 200

Query: 197 GLKSLAALRYTLYPEQSGRFRA-GQDTPIRIFILGTRAEAQLPGHVWKQLQYLIPDTSIE 255
           GLKSLAALRYTLYPEQ+ R  +  +++P+RIFILG RAEAQLPGHVWKQLQ++ P+T+IE
Sbjct: 201 GLKSLAALRYTLYPEQNRRVTSITKNSPLRIFILGARAEAQLPGHVWKQLQFMFPETNIE 260

Query: 256 LHFVGPESFYDREKRSYVQSSTETIVKRIDEKMQLFYHTDFFHVFHEAQDFFPYDPYNDV 315
           LHFVGPES+YDR KR YV SS+  IV+R+DE +   YHTD+FHVFHEAQDFFPYDPY D+
Sbjct: 261 LHFVGPESYYDRNKREYVHSSS-PIVRRVDETLSFVYHTDYFHVFHEAQDFFPYDPYTDI 319

Query: 316 FFCFHPGFAAPETEEYWMGDTMKALMQTKCAVFTTGFSKEDLLRDISIVQDKYGSELDML 375
           FFCFHPGFAAPE+ E WMG TM+AL++TKCAVFTTGF++ DL RD+  V  K+G ELDML
Sbjct: 320 FFCFHPGFAAPESRENWMGKTMEALLETKCAVFTTGFNELDLRRDVGTVVGKHGKELDML 379

Query: 376 MEPVPNVFGSTKWELNDTNPHEVYQFNMYIAGFRGKRYHAIEL 418
           MEPV N FGSTKWELND NP EVYQFNM+IAGFRGKRYHAIE+
Sbjct: 380 MEPVHNAFGSTKWELNDMNPQEVYQFNMFIAGFRGKRYHAIEV 422

>CAGL0A03927g Chr1 (397179..398492) [1314 bp, 437 aa] {ON} highly
           similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203c MSS51
          Length = 437

 Score =  658 bits (1697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/437 (70%), Positives = 357/437 (81%), Gaps = 19/437 (4%)

Query: 1   MLASRTPVV-----YRAKPMTRPIMGFVRNALGLDPPASPDDPTPENRFHPWDQSPSPDL 55
           M+ +RT  V     + A    R +MGFVRNALGLDPP SPD+PT +NRFHPWDQSP+ DL
Sbjct: 1   MIRTRTRAVQNTGKFYACVSKRQLMGFVRNALGLDPPPSPDEPTEQNRFHPWDQSPAVDL 60

Query: 56  RERAARIKAMATCPVTHKDIQFTCPLSGIPTHHSREAWEKDTEYHKSKRYELLKKVNIYE 115
           RERAARIK +A CPVTHK IQ+TCP+SGIPTHHSREAWE+D EYH SK+YE+LKKVNIYE
Sbjct: 61  RERAARIKTLAKCPVTHKPIQYTCPISGIPTHHSREAWEQDKEYHASKKYEILKKVNIYE 120

Query: 116 HDLRSGRPFPEFDFPQDQDYDRMVNMSNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITI 175
           HDLRSGRPFPEFDFP+DQ  DR VN++NWDLF YTRSFYSMDTEFQLAAVTKMLSYPITI
Sbjct: 121 HDLRSGRPFPEFDFPRDQGPDRTVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITI 180

Query: 176 GSVLHQYSPYSLNPKGPITLEGLKSLAALRYTLYPEQS-GRFRAGQDTPIRIFILGTRAE 234
           GSVLHQ+SPYSLNPKGPITLEGLKSLAALRYTLYP Q+       ++ P+RIFILG RAE
Sbjct: 181 GSVLHQFSPYSLNPKGPITLEGLKSLAALRYTLYPLQNRAVTTTAKNKPMRIFILGARAE 240

Query: 235 AQLPGHVWKQLQYLIPDTSIELHFVGPESFYDREKRSYVQSSTET-------------IV 281
           AQLPGHVWKQLQ+L P  + E+HF+GPES YDRE+  Y++S+T               + 
Sbjct: 241 AQLPGHVWKQLQFLFPQQNFEIHFIGPESLYDRERNEYIRSATANGETAADGTTSSIPVT 300

Query: 282 KRIDEKMQLFYHTDFFHVFHEAQDFFPYDPYNDVFFCFHPGFAAPETEEYWMGDTMKALM 341
           KRIDE M+ FYHTD+FH  H AQDFFPYDPY DVFF FHPG A+PE+++ WM DT+K L+
Sbjct: 301 KRIDETMKFFYHTDYFHTLHTAQDFFPYDPYQDVFFMFHPGLASPESKDTWMKDTVKGLL 360

Query: 342 QTKCAVFTTGFSKEDLLRDISIVQDKYGSELDMLMEPVPNVFGSTKWELNDTNPHEVYQF 401
            TKCA+FTTGF+K+D+  DI I+QD YG E+DMLM PV NVFGSTKWEL+D++PH VYQF
Sbjct: 361 DTKCAIFTTGFNKKDMADDIQILQDTYGKEMDMLMNPVKNVFGSTKWELDDSDPHSVYQF 420

Query: 402 NMYIAGFRGKRYHAIEL 418
           NMYIAGFRGKRYH I++
Sbjct: 421 NMYIAGFRGKRYHPIKV 437

>TDEL0C02020 Chr3 complement(349453..350730) [1278 bp, 425 aa] {ON}
           Anc_7.346 YLR203C
          Length = 425

 Score =  654 bits (1688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/418 (75%), Positives = 356/418 (85%), Gaps = 4/418 (0%)

Query: 1   MLASRTPVVYRAKPMTRPIMGFVRNALGLDPPASPDDPTPENRFHPWDQSPSPDLRERAA 60
           + A R   V+  +   R I+GFVRNALGLDPP SPDDPTPENRFHPWDQSP  DLRERAA
Sbjct: 12  LRAQRCGKVFNQR---RFIIGFVRNALGLDPPPSPDDPTPENRFHPWDQSPVGDLRERAA 68

Query: 61  RIKAMATCPVTHKDIQFTCPLSGIPTHHSREAWEKDTEYHKSKRYELLKKVNIYEHDLRS 120
           RI+ +A CPVT K+I +TCPLSGIPTHHSREAWE+D +YH+SK+YE+LKKVNIYEHDLRS
Sbjct: 69  RIRTLARCPVTGKEINYTCPLSGIPTHHSREAWEQDKQYHQSKKYEILKKVNIYEHDLRS 128

Query: 121 GRPFPEFDFPQDQDYDRMVNMSNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLH 180
           GRPFPEFDFPQ QD+DR VNM+NWDLFFYTR FYSMDTEFQLAAVTKMLSYPI+I SVLH
Sbjct: 129 GRPFPEFDFPQGQDFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPISIASVLH 188

Query: 181 QYSPYSLNPKGPITLEGLKSLAALRYTLYPEQSGRFRAGQDTPIRIFILGTRAEAQLPGH 240
           Q+SPYSLNPKGP+TLEGLKSLAALRYTLYP ++    + +D P+RIFILG RAEAQLPGH
Sbjct: 189 QFSPYSLNPKGPVTLEGLKSLAALRYTLYPLENKTISSTKDRPMRIFILGARAEAQLPGH 248

Query: 241 VWKQLQYLIPDTSIELHFVGPESFYDREKRSYVQSSTETIVKRIDEKMQLFYHTDFFHVF 300
           VWKQLQYL P+   ELHFVGPE   ++EK  YV SST  +VKR+DE +   YHTDFFHV 
Sbjct: 249 VWKQLQYLFPEQMFELHFVGPECLLNKEKHQYVTSST-PVVKRVDETISFVYHTDFFHVL 307

Query: 301 HEAQDFFPYDPYNDVFFCFHPGFAAPETEEYWMGDTMKALMQTKCAVFTTGFSKEDLLRD 360
           HEAQDFFPYDPY DVFFCFHPGF APET   W+ +TMK L++TKCA+FTTGF+K DLLRD
Sbjct: 308 HEAQDFFPYDPYLDVFFCFHPGFGAPETSASWLNETMKGLLETKCAIFTTGFNKADLLRD 367

Query: 361 ISIVQDKYGSELDMLMEPVPNVFGSTKWELNDTNPHEVYQFNMYIAGFRGKRYHAIEL 418
           +  V+DKYG E+D+LMEPV NVFGSTKWELND NP EVYQFNMYIAGFRGKRYHAIE+
Sbjct: 368 VDAVKDKYGKEVDVLMEPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 425

>Kpol_530.35 s530 complement(83032..84309) [1278 bp, 425 aa] {ON}
           complement(83032..84309) [1278 nt, 426 aa]
          Length = 425

 Score =  651 bits (1680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/405 (76%), Positives = 357/405 (88%), Gaps = 4/405 (0%)

Query: 17  RPIMGFVRNALGLDPPASPDDPTPENRFHPWDQSPSPDLRERAARIKAMATCPVTHKDIQ 76
           R +MGFVRNALGLDPP SPDDPTPENRFHPWDQSP  DLRERAA+I+ +A CPVTHKDI 
Sbjct: 22  RSLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPCVDLRERAAKIRTLAKCPVTHKDIN 81

Query: 77  FTCPLSGIPTHHSREAWEKDTEYHKSKRYELLKKVNIYEHDLRSGRPFPEFDFPQDQDYD 136
           +TCPLSGIPTHH +EAW  D +YH+SKRYE+LKKVNIYEHDLRSGRPFPEFDFPQDQDYD
Sbjct: 82  YTCPLSGIPTHHDKEAWLMDKDYHESKRYEILKKVNIYEHDLRSGRPFPEFDFPQDQDYD 141

Query: 137 RMVNMSNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQYSPYSLNPKGPITLE 196
           R++N++NWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGS+LHQ+SPYSLNPKGP+TLE
Sbjct: 142 RLINLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHQFSPYSLNPKGPVTLE 201

Query: 197 GLKSLAALRYTLYPEQSGRFRAG---QDTPIRIFILGTRAEAQLPGHVWKQLQYLIPDTS 253
           GLKSLAALRYTLYP Q+         +D P+RIFILG RAEAQLPGHVWKQ QYL P+  
Sbjct: 202 GLKSLAALRYTLYPYQNKSQNVKVNTRDRPMRIFILGARAEAQLPGHVWKQFQYLFPEQE 261

Query: 254 IELHFVGPESFYDREKRSYVQSSTETIVKRIDEKMQLFYHTDFFHVFHEAQDFFPYDPYN 313
            E+HF+GPE + ++EK  Y+ SST  IVK++D+ ++L +H D+FHVFHEAQDFFPYDP+ 
Sbjct: 262 FEIHFIGPECYLNKEKNQYITSST-PIVKKVDDTLKLVFHPDYFHVFHEAQDFFPYDPFL 320

Query: 314 DVFFCFHPGFAAPETEEYWMGDTMKALMQTKCAVFTTGFSKEDLLRDISIVQDKYGSELD 373
           DVFF FHPG+A PET E W+G+TMKAL+ TKCA+FTTGFSK+DLLRDI +V+++YG+ELD
Sbjct: 321 DVFFTFHPGYAYPETTEIWLGETMKALLDTKCAIFTTGFSKQDLLRDIDVVKNRYGNELD 380

Query: 374 MLMEPVPNVFGSTKWELNDTNPHEVYQFNMYIAGFRGKRYHAIEL 418
           MLM+PV NVFGSTKWELND NP EVYQFNMYIAGFRGKRYHAIE+
Sbjct: 381 MLMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 425

>Kwal_56.24631 s56 (1080985..1082253) [1269 bp, 422 aa] {ON} YLR203C
           (MSS51) - involved in maturation of COX1 and COB mRNA
           [contig 161] FULL
          Length = 422

 Score =  648 bits (1671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/403 (76%), Positives = 357/403 (88%), Gaps = 2/403 (0%)

Query: 17  RPIMGFVRNALGLDPPASPDDPTPENRFHPWDQSPSPDLRERAARIKAMATCPVTHKDIQ 76
           R IMGFVRNALGLDPP SPD+PTPENRFHPWDQSPSPDLRERAA I+A+A CPVT ++I 
Sbjct: 21  RHIMGFVRNALGLDPPPSPDEPTPENRFHPWDQSPSPDLRERAATIRALAKCPVTGREIN 80

Query: 77  FTCPLSGIPTHHSREAWEKDTEYHKSKRYELLKKVNIYEHDLRSGRPFPEFDFPQDQDYD 136
           +TCP SGIPTHHSREAWEKD +Y +SKR E+LKKVNIYEHDLRSGRPFPEFDFP DQD+D
Sbjct: 81  YTCPKSGIPTHHSREAWEKDLDYQQSKRPEILKKVNIYEHDLRSGRPFPEFDFPLDQDFD 140

Query: 137 RMVNMSNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQYSPYSLNPKGPITLE 196
           RMVN++NWDLFFYTR F+SMDTEFQLAAVTKMLSYPITIGSVLHQ+SPYSLNPKGPITLE
Sbjct: 141 RMVNLTNWDLFFYTRGFFSMDTEFQLAAVTKMLSYPITIGSVLHQFSPYSLNPKGPITLE 200

Query: 197 GLKSLAALRYTLYPEQSGRFRA-GQDTPIRIFILGTRAEAQLPGHVWKQLQYLIPDTSIE 255
           GLKSLAALRYTLYP+Q+ R  +  +++P+RIF+LG RAEAQLPGHVWKQLQ++ P+T +E
Sbjct: 201 GLKSLAALRYTLYPDQNRRVTSIAKNSPLRIFVLGARAEAQLPGHVWKQLQFMFPETQME 260

Query: 256 LHFVGPESFYDREKRSYVQSSTETIVKRIDEKMQLFYHTDFFHVFHEAQDFFPYDPYNDV 315
           +HFVGPES+YDR KR YV S+   I++R+DE +   YHTD+FHVFHEAQDFFPYDPY D+
Sbjct: 261 IHFVGPESYYDRNKREYVHSAA-PIIRRVDETLNFVYHTDYFHVFHEAQDFFPYDPYTDI 319

Query: 316 FFCFHPGFAAPETEEYWMGDTMKALMQTKCAVFTTGFSKEDLLRDISIVQDKYGSELDML 375
           FFCFHPGFAAPE+ E WMG TM+AL++TKCA+FTTGF++ DL RD+  V  +YG ELD++
Sbjct: 320 FFCFHPGFAAPESRENWMGKTMEALLETKCAIFTTGFNEVDLQRDLDAVVAEYGKELDII 379

Query: 376 MEPVPNVFGSTKWELNDTNPHEVYQFNMYIAGFRGKRYHAIEL 418
           M+P  N FGSTKWELND NP EVYQFNM++AGFRGKRYHAIE+
Sbjct: 380 MDPAKNAFGSTKWELNDVNPQEVYQFNMFMAGFRGKRYHAIEV 422

>NCAS0E02880 Chr5 complement(563006..564295) [1290 bp, 429 aa] {ON}
           Anc_7.346 YLR203C
          Length = 429

 Score =  640 bits (1650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/407 (75%), Positives = 351/407 (86%), Gaps = 2/407 (0%)

Query: 12  AKPMTRPIMGFVRNALGLDPPASPDDPTPENRFHPWDQSPSPDLRERAARIKAMATCPVT 71
           A   TR +MGFVRNALGLDPP SPDDPTPENRFHPWDQSPSPDLRERAARI+ +A CPVT
Sbjct: 23  AGNQTRHLMGFVRNALGLDPPTSPDDPTPENRFHPWDQSPSPDLRERAARIRTLARCPVT 82

Query: 72  HKDIQFTCPLSGIPTHHSREAWEKDTEYHKSKRYELLKKVNIYEHDLRSGRPFPEFDFPQ 131
            K+I +TCP+SGIPTHHSREAWE+D EYH SKRYELLKKVNIYEHDLRSGRPFPEFDFP+
Sbjct: 83  GKEINYTCPISGIPTHHSREAWEQDKEYHASKRYELLKKVNIYEHDLRSGRPFPEFDFPR 142

Query: 132 DQDYDRMVNMSNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQYSPYSLNPKG 191
           DQ  DRMVNM+NWDLF YTR+FYSMDTEFQ+AAVTKMLSYPITIGSVLHQ+SPYSL PKG
Sbjct: 143 DQGQDRMVNMTNWDLFLYTRAFYSMDTEFQMAAVTKMLSYPITIGSVLHQFSPYSLQPKG 202

Query: 192 PITLEGLKSLAALRYTLYPEQSGR-FRAGQDTPIRIFILGTRAEAQLPGHVWKQLQYLIP 250
           PI+LEGLKSLAALRYTLYP Q+       +  P+RIFILG RAE+QLPGHVWKQLQYL P
Sbjct: 203 PISLEGLKSLAALRYTLYPMQNRLVISTTKARPMRIFILGARAESQLPGHVWKQLQYLFP 262

Query: 251 DTSIELHFVGPESFYDREKRSYVQSSTETIVKRIDEKMQLFYHTDFFHVFHEAQDFFPYD 310
           + + E+HF+GPES+YD++K+ Y+Q +T  I + +DE ++L YHT++FH  HEAQDFFPYD
Sbjct: 263 EQTFEIHFIGPESYYDKDKKKYIQLTTP-ITESVDETLKLIYHTEYFHKLHEAQDFFPYD 321

Query: 311 PYNDVFFCFHPGFAAPETEEYWMGDTMKALMQTKCAVFTTGFSKEDLLRDISIVQDKYGS 370
           PY DVFF FHPGFA+ E  E+WM DTMK L+ TKCA+FTTGF+K DLL DI++VQDKYG 
Sbjct: 322 PYMDVFFIFHPGFASAEIGEHWMKDTMKGLLDTKCAIFTTGFTKNDLLEDIAVVQDKYGK 381

Query: 371 ELDMLMEPVPNVFGSTKWELNDTNPHEVYQFNMYIAGFRGKRYHAIE 417
           ELD+LM+P  NVFGSTKWELND NP EVYQFNMYIAGFRGKRY  I+
Sbjct: 382 ELDILMKPTKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYPTIK 428

>TPHA0F02930 Chr6 (647081..648391) [1311 bp, 436 aa] {ON} Anc_7.346
           YLR203C
          Length = 436

 Score =  634 bits (1636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/403 (73%), Positives = 349/403 (86%), Gaps = 3/403 (0%)

Query: 17  RPIMGFVRNALGLDPPASPDDPTPENRFHPWDQSPSPDLRERAARIKAMATCPVTHKDIQ 76
           R +MGFV+NALGLDP  SPDDPTPENRFHPWDQSPSPDLRERAARI+ +A CPVT K+I 
Sbjct: 34  RSLMGFVKNALGLDPSPSPDDPTPENRFHPWDQSPSPDLRERAARIRTLAKCPVTKKEIN 93

Query: 77  FTCPLSGIPTHHSREAWEKDTEYHKSKRYELLKKVNIYEHDLRSGRPFPEFDFPQDQDYD 136
           +TCPLSGIPTHHSREAWE D +YH+SKRYE+LKKVNIYEHDLRSGRPFPEFDFP DQ +D
Sbjct: 94  YTCPLSGIPTHHSREAWEADKDYHQSKRYEILKKVNIYEHDLRSGRPFPEFDFPLDQIHD 153

Query: 137 RMVNMSNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQYSPYSLNPKGPITLE 196
           R+VN++NWDLFFYTR+FYSMDTEFQLAAVTKMLSYP+TIGS+LHQ+SPYSLNPKGPITLE
Sbjct: 154 RVVNLTNWDLFFYTRNFYSMDTEFQLAAVTKMLSYPMTIGSILHQFSPYSLNPKGPITLE 213

Query: 197 GLKSLAALRYTLYPEQ--SGRFRAGQDTPIRIFILGTRAEAQLPGHVWKQLQYLIPDTSI 254
           GLKSLAALRY+LYP Q  S       D P+RIFILG RAEAQLPGHVWKQLQ+L PD + 
Sbjct: 214 GLKSLAALRYSLYPFQRKSNISLKLHDRPMRIFILGARAEAQLPGHVWKQLQFLFPDQTF 273

Query: 255 ELHFVGPESFYDREKRSYVQSSTETIVKRIDEKMQLFYHTDFFHVFHEAQDFFPYDPYND 314
           E+HF+G E   + EK  Y++S+   +VK+IDE M+L YH+D+FHV+HEAQDF PYDPY D
Sbjct: 274 EIHFIGTECLLNNEKNKYIKSAIP-VVKKIDETMKLIYHSDYFHVYHEAQDFVPYDPYLD 332

Query: 315 VFFCFHPGFAAPETEEYWMGDTMKALMQTKCAVFTTGFSKEDLLRDISIVQDKYGSELDM 374
           VFF FHPGFAAPET + WMGDTMKAL++TKCA+FTTGF+K+D+  D+ IV+ +YG E+D 
Sbjct: 333 VFFTFHPGFAAPETSDLWMGDTMKALLETKCAIFTTGFNKQDITNDVEIVKARYGKEMDT 392

Query: 375 LMEPVPNVFGSTKWELNDTNPHEVYQFNMYIAGFRGKRYHAIE 417
           LM+P+ N +GSTKWELND NP E++QFNMY+AGFRGKRYH I+
Sbjct: 393 LMDPIKNSYGSTKWELNDMNPQEIFQFNMYVAGFRGKRYHTIK 435

>Suva_10.297 Chr10 complement(523465..524775) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  634 bits (1636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/402 (75%), Positives = 350/402 (87%), Gaps = 2/402 (0%)

Query: 17  RPIMGFVRNALGLDPPASPDDPTPENRFHPWDQSPSPDLRERAARIKAMATCPVTHKDIQ 76
           R +MGFVRNALGLDPP SPDDPTPENRFHPWDQSPS DLRERAA+I+ +A CPVT KDI 
Sbjct: 34  RHLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDIN 93

Query: 77  FTCPLSGIPTHHSREAWEKDTEYHKSKRYELLKKVNIYEHDLRSGRPFPEFDFPQDQDYD 136
           +TCPLSGIPTHHSREAWE D  YH SK+YE+LKKVNIYEHDLRSGRPFPEFDFPQ Q YD
Sbjct: 94  YTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYD 153

Query: 137 RMVNMSNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQYSPYSLNPKGPITLE 196
           + VN++NWDLF YTRSFYSMDTEFQLAAVTKMLSYPITIGS+LH++SPYSLNPKGPITLE
Sbjct: 154 KAVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITLE 213

Query: 197 GLKSLAALRYTLYP-EQSGRFRAGQDTPIRIFILGTRAEAQLPGHVWKQLQYLIPDTSIE 255
           GLKSLAALRYTLYP E        ++  +RIFILG RAEAQLPGHVWKQLQ+L P+ + E
Sbjct: 214 GLKSLAALRYTLYPLENRSVLATTRNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQNFE 273

Query: 256 LHFVGPESFYDREKRSYVQSSTETIVKRIDEKMQLFYHTDFFHVFHEAQDFFPYDPYNDV 315
           +HF+GPE  Y R+K+ YV+S+T  +V+RIDE ++ F+HTDFF VFHEAQDFFPYDPY DV
Sbjct: 274 IHFIGPECLYKRDKQEYVKSATP-VVQRIDETLKFFHHTDFFQVFHEAQDFFPYDPYMDV 332

Query: 316 FFCFHPGFAAPETEEYWMGDTMKALMQTKCAVFTTGFSKEDLLRDISIVQDKYGSELDML 375
           FF FHPG+A+PE+   WMG+TM AL++TKCA+FTTGF+K+DL+ DI++V+ KYG E+D+L
Sbjct: 333 FFTFHPGYASPESHGSWMGETMTALLETKCAIFTTGFNKKDLMDDINLVKSKYGKEMDIL 392

Query: 376 MEPVPNVFGSTKWELNDTNPHEVYQFNMYIAGFRGKRYHAIE 417
           M+PV NVFGSTKWELND NP EVYQFNMYIAGFRGKRYH I+
Sbjct: 393 MDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434

>Skud_12.266 Chr12 complement(497291..498601) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  633 bits (1633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/402 (75%), Positives = 350/402 (87%), Gaps = 2/402 (0%)

Query: 17  RPIMGFVRNALGLDPPASPDDPTPENRFHPWDQSPSPDLRERAARIKAMATCPVTHKDIQ 76
           R +MGFVRNALGLDPP SPDDPTPENRFHPWDQSPS DLRERAA+I+ +A CPVT KDI 
Sbjct: 34  RHLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDIN 93

Query: 77  FTCPLSGIPTHHSREAWEKDTEYHKSKRYELLKKVNIYEHDLRSGRPFPEFDFPQDQDYD 136
           +TCPLSGIPTHHSREAWE D  YH SK+YE+LKKVNIYEHDLRSGRPFPEFDFPQ Q YD
Sbjct: 94  YTCPLSGIPTHHSREAWEMDKTYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYD 153

Query: 137 RMVNMSNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQYSPYSLNPKGPITLE 196
           + VN++NWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLH++SPYSLNPKGPITLE
Sbjct: 154 KAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHKFSPYSLNPKGPITLE 213

Query: 197 GLKSLAALRYTLYP-EQSGRFRAGQDTPIRIFILGTRAEAQLPGHVWKQLQYLIPDTSIE 255
           GLKSLAALRYTLYP E        ++  +RIFILG RAEAQLPGHVWKQLQ+L P+ + E
Sbjct: 214 GLKSLAALRYTLYPLENRSVLATTKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQNFE 273

Query: 256 LHFVGPESFYDREKRSYVQSSTETIVKRIDEKMQLFYHTDFFHVFHEAQDFFPYDPYNDV 315
           +HFVGPE  Y R+K+ YV+S+T  +V+R+DE ++  +HTDFF VFHEAQDFFPYDPY DV
Sbjct: 274 IHFVGPECLYKRDKQEYVKSATP-VVQRVDETLRFIHHTDFFDVFHEAQDFFPYDPYMDV 332

Query: 316 FFCFHPGFAAPETEEYWMGDTMKALMQTKCAVFTTGFSKEDLLRDISIVQDKYGSELDML 375
           FF FHPG+A+PE+   WMG+TM+AL++TKCA+FTTGF+K+DL+ DI+ V+ KYG E+D+L
Sbjct: 333 FFTFHPGYASPESHGSWMGETMRALLETKCAIFTTGFNKKDLMDDINAVKSKYGKEMDIL 392

Query: 376 MEPVPNVFGSTKWELNDTNPHEVYQFNMYIAGFRGKRYHAIE 417
           M+PV NVFGSTKWELND NP EVYQFNMYIAGFRGKRYH I+
Sbjct: 393 MDPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434

>Smik_12.261 Chr12 complement(497673..498983) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  633 bits (1633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/402 (75%), Positives = 351/402 (87%), Gaps = 2/402 (0%)

Query: 17  RPIMGFVRNALGLDPPASPDDPTPENRFHPWDQSPSPDLRERAARIKAMATCPVTHKDIQ 76
           R +MGFVRNALGLDPP SPDDPTPENRFHPWDQSPS DLRERAA+I+ +A CPVT KDI 
Sbjct: 34  RHLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDIN 93

Query: 77  FTCPLSGIPTHHSREAWEKDTEYHKSKRYELLKKVNIYEHDLRSGRPFPEFDFPQDQDYD 136
           +TCPLSGIPTHHSREAWE D  YH SK+YE+LKKVNIYEHDLRSGRPFPEFDFPQ+Q YD
Sbjct: 94  YTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQNQGYD 153

Query: 137 RMVNMSNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQYSPYSLNPKGPITLE 196
           + VN++NWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGS+LH++SPYSLNPKGPITLE
Sbjct: 154 KAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITLE 213

Query: 197 GLKSLAALRYTLYP-EQSGRFRAGQDTPIRIFILGTRAEAQLPGHVWKQLQYLIPDTSIE 255
           GLKSLAALRYTLYP E      A ++  +RIFILG RAEAQLPGHVWKQLQ+L P+ + E
Sbjct: 214 GLKSLAALRYTLYPLENRSLLTATKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQNFE 273

Query: 256 LHFVGPESFYDREKRSYVQSSTETIVKRIDEKMQLFYHTDFFHVFHEAQDFFPYDPYNDV 315
           +HF+GPE  Y R+K+ YV+S+T  +V+R+DE ++  + TDFF VFHEAQDFFPYDPY DV
Sbjct: 274 IHFIGPECLYKRDKQEYVKSTTP-VVQRVDETLKFIHRTDFFEVFHEAQDFFPYDPYMDV 332

Query: 316 FFCFHPGFAAPETEEYWMGDTMKALMQTKCAVFTTGFSKEDLLRDISIVQDKYGSELDML 375
           FF FHPG+A+PE+   WMG+TMKAL++TKCA+FTTGF+K+DL  D+++V+ KYG E+D+L
Sbjct: 333 FFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDLNLVKSKYGKEMDIL 392

Query: 376 MEPVPNVFGSTKWELNDTNPHEVYQFNMYIAGFRGKRYHAIE 417
           M+PV NVFGSTKWELND NP EVYQFNMYIAGFRGKRYH I+
Sbjct: 393 MDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434

>YLR203C Chr12 complement(550650..551960) [1311 bp, 436 aa] {ON}
           MSS51Specific translational activator for the
           mitochondrial COX1 mRNA; loosely associated with the
           matrix face of the mitochondrial inner membrane;
           influences both COX1 mRNA translation and Cox1p assembly
           into cytochrome c oxidase
          Length = 436

 Score =  629 bits (1623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/402 (75%), Positives = 350/402 (87%), Gaps = 2/402 (0%)

Query: 17  RPIMGFVRNALGLDPPASPDDPTPENRFHPWDQSPSPDLRERAARIKAMATCPVTHKDIQ 76
           R +MGFVRNALGLDPP SP+DPTPENRFHPWDQSPS DLRERAA+I+ +A CPVT KDI 
Sbjct: 34  RHLMGFVRNALGLDPPPSPEDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDIN 93

Query: 77  FTCPLSGIPTHHSREAWEKDTEYHKSKRYELLKKVNIYEHDLRSGRPFPEFDFPQDQDYD 136
           +TCPLSGIPTHHSREAWE D  YH SK+YE+LKKVNIYEHDLRSGRPFPEFDFPQ Q YD
Sbjct: 94  YTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYD 153

Query: 137 RMVNMSNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQYSPYSLNPKGPITLE 196
           + VN++NWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGS+LH++SPYSLNPKGPITLE
Sbjct: 154 KAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITLE 213

Query: 197 GLKSLAALRYTLYPEQSGRF-RAGQDTPIRIFILGTRAEAQLPGHVWKQLQYLIPDTSIE 255
           GLKSLAALRYTLYP ++       ++  +RIFILG RAEAQLPGHVWKQLQ+L P+ S E
Sbjct: 214 GLKSLAALRYTLYPLENRSLPTTTKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQSFE 273

Query: 256 LHFVGPESFYDREKRSYVQSSTETIVKRIDEKMQLFYHTDFFHVFHEAQDFFPYDPYNDV 315
           +HF+GPE  Y R+K+ YV+S+T  +V+R+DE ++  Y T+FF VFHEAQDFFPYDPY DV
Sbjct: 274 IHFIGPECLYKRDKQEYVKSTTP-VVQRVDETLKFIYRTNFFEVFHEAQDFFPYDPYMDV 332

Query: 316 FFCFHPGFAAPETEEYWMGDTMKALMQTKCAVFTTGFSKEDLLRDISIVQDKYGSELDML 375
           FF FHPG+A+PE+   WMG+TMKAL++TKCA+FTTGF+K+DL  DI++V+ KYG E+D+L
Sbjct: 333 FFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDINLVKSKYGKEMDVL 392

Query: 376 MEPVPNVFGSTKWELNDTNPHEVYQFNMYIAGFRGKRYHAIE 417
           MEPV NVFGSTKWELND NP EVYQFNMYIAGFRGKRYH I+
Sbjct: 393 MEPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434

>NDAI0E04480 Chr5 complement(1007346..1008677) [1332 bp, 443 aa]
           {ON} Anc_7.346 YLR203C
          Length = 443

 Score =  626 bits (1615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/404 (69%), Positives = 346/404 (85%), Gaps = 2/404 (0%)

Query: 16  TRPIMGFVRNALGLDPPASPDDPTPENRFHPWDQSPSPDLRERAARIKAMATCPVTHKDI 75
           +R +MGFVRNALGLDP +SPDDPTPENRFHPWDQSP  DLRERAA+I+ +A CPVT+K+I
Sbjct: 41  SRSLMGFVRNALGLDPKSSPDDPTPENRFHPWDQSPCQDLRERAAKIRTLAHCPVTNKEI 100

Query: 76  QFTCPLSGIPTHHSREAWEKDTEYHKSKRYELLKKVNIYEHDLRSGRPFPEFDFPQDQDY 135
            +TCP+SGIPTHHS+ AWE D  YH +K YE+LKKVNIYEHDLRSGRPFPEF FPQDQD+
Sbjct: 101 NYTCPISGIPTHHSKNAWEMDENYHSNKIYEILKKVNIYEHDLRSGRPFPEFVFPQDQDF 160

Query: 136 DRMVNMSNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQYSPYSLNPKGPITL 195
           DRM+NM+NWDLF YTRSFYSMDTEFQ+AAVTKMLSYPITIGS+LHQ+SPYSL PKGPITL
Sbjct: 161 DRMINMTNWDLFLYTRSFYSMDTEFQMAAVTKMLSYPITIGSILHQFSPYSLQPKGPITL 220

Query: 196 EGLKSLAALRYTLYPEQSGRFRA-GQDTPIRIFILGTRAEAQLPGHVWKQLQYLIPDTSI 254
           EGLKS+AALRYTLYP  +  F    ++ P+RIF+LG RAEAQLPGH+WKQLQYL P+   
Sbjct: 221 EGLKSMAALRYTLYPFHNKSFMTLTKNRPMRIFLLGARAEAQLPGHIWKQLQYLFPEQKF 280

Query: 255 ELHFVGPESFYDREKRSYVQSSTETIVKRIDEKMQLFYHTDFFHVFHEAQDFFPYDPYND 314
           EL F+GPE++YD+EK+ Y++   + +++ ID+ ++L + T++FH  HE+QD FPYDPY D
Sbjct: 281 ELFFIGPEAYYDKEKKQYLKLD-KPLIQTIDDTLKLTFITEYFHTLHESQDLFPYDPYMD 339

Query: 315 VFFCFHPGFAAPETEEYWMGDTMKALMQTKCAVFTTGFSKEDLLRDISIVQDKYGSELDM 374
           VFF FHPGF+A ET E+WM DTMK+L++T+CA+F TGFS+ D+L D++I+ +KY ++LD+
Sbjct: 340 VFFIFHPGFSAIETTEHWMNDTMKSLLETQCAIFNTGFSRNDMLNDMNILDEKYKNDLDI 399

Query: 375 LMEPVPNVFGSTKWELNDTNPHEVYQFNMYIAGFRGKRYHAIEL 418
           LM+PV NVFGSTKWELND NP +VYQFNMYIAGFRGKRY  +EL
Sbjct: 400 LMKPVKNVFGSTKWELNDLNPQDVYQFNMYIAGFRGKRYPTVEL 443

>ZYRO0F11616g Chr6 (953577..954824) [1248 bp, 415 aa] {ON} similar
           to uniprot|P32335 Saccharomyces cerevisiae YLR203C MSS51
           Protein required for the maturation and translation of
           COX1 mRNA involved in maturation of COX1 and COB mRNA
          Length = 415

 Score =  623 bits (1606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/409 (73%), Positives = 349/409 (85%), Gaps = 3/409 (0%)

Query: 12  AKPMT--RPIMGFVRNALGLDPPASPDDPTPENRFHPWDQSPSPDLRERAARIKAMATCP 69
            +P+T  R I+GFVRNALGLDPP SPDDPTPENRFH WDQSP+ DLRERAARI+A+A CP
Sbjct: 8   CRPITQRRTIIGFVRNALGLDPPPSPDDPTPENRFHLWDQSPAGDLRERAARIRALAQCP 67

Query: 70  VTHKDIQFTCPLSGIPTHHSREAWEKDTEYHKSKRYELLKKVNIYEHDLRSGRPFPEFDF 129
           VT K+I +TCPLSGIPTHHS+EAWE+D +YH+SK++ELLKKVNIYEHDLRSGRPFPEFDF
Sbjct: 68  VTGKEINYTCPLSGIPTHHSKEAWEQDKKYHESKKWELLKKVNIYEHDLRSGRPFPEFDF 127

Query: 130 PQDQDYDRMVNMSNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQYSPYSLNP 189
           PQD ++DR VNM+NWDLFFYTR FYSMDTEFQLAAVTKMLSYPITI SVL+Q+SPYSLNP
Sbjct: 128 PQDLEFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPITIASVLNQFSPYSLNP 187

Query: 190 KGPITLEGLKSLAALRYTLYPEQSGRFRAGQDTPIRIFILGTRAEAQLPGHVWKQLQYLI 249
           KGPITLEGLKSLAALRYTLYP ++    A +D P+R+FILG RAEA LPGHVWKQLQ+L 
Sbjct: 188 KGPITLEGLKSLAALRYTLYPFENKTVAATKDRPMRLFILGARAEALLPGHVWKQLQFLF 247

Query: 250 PDTSIELHFVGPESFYDREKRSYVQSSTETIVKRIDEKMQLFYHTDFFHVFHEAQDFFPY 309
           P+T+ ELHF+GPE   ++EK  YV SS   +VKRIDE +   YHTD+FHV+H+AQDFFPY
Sbjct: 248 PETAFELHFIGPECLVNKEKHQYV-SSPAPVVKRIDETLSFVYHTDYFHVYHDAQDFFPY 306

Query: 310 DPYNDVFFCFHPGFAAPETEEYWMGDTMKALMQTKCAVFTTGFSKEDLLRDISIVQDKYG 369
           DPY D FFCFHPGF APE+ + W+  T+  L++TKCA+F TG +K  LLRDI+ V DK+ 
Sbjct: 307 DPYLDAFFCFHPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDINAVMDKHS 366

Query: 370 SELDMLMEPVPNVFGSTKWELNDTNPHEVYQFNMYIAGFRGKRYHAIEL 418
            E+D+LMEP  N++GSTKWELND NP EVYQFNMYIAGFRGKRYHAIE+
Sbjct: 367 KEIDILMEPTKNIYGSTKWELNDVNPQEVYQFNMYIAGFRGKRYHAIEI 415

>ACL152W Chr3 (85701..86987) [1287 bp, 428 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR203C (MSS51)
          Length = 428

 Score =  614 bits (1583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/422 (70%), Positives = 351/422 (83%), Gaps = 7/422 (1%)

Query: 2   LASRTPVVYR-----AKPMTRPIMGFVRNALGLDPPASPDDPTPENRFHPWDQSPSPDLR 56
           LA+R   V R     A    RPIMGFVRNALGLDPPASPD+PT ENRFH W+QSPSPDLR
Sbjct: 9   LAARPYAVGRGCAAGACGQRRPIMGFVRNALGLDPPASPDEPTDENRFHVWEQSPSPDLR 68

Query: 57  ERAARIKAMATCPVTHKDIQFTCPLSGIPTHHSREAWEKDTEYHKSKRYELLKKVNIYEH 116
           ERAARI+A+A CPVT KDI+++C  SGIPTHHSREAWE+D EYH+SKR+  L+KVN+YEH
Sbjct: 69  ERAARIRALARCPVTGKDIRYSCERSGIPTHHSREAWEQDEEYHRSKRWATLRKVNVYEH 128

Query: 117 DLRSGRPFPEFDFPQDQDYDRMVNMSNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIG 176
           DLRSGRPF EFDFPQ+Q  DRMVNM NWDLF YTR FYSMDT+FQLAAVTKMLSYPITIG
Sbjct: 129 DLRSGRPFAEFDFPQEQGRDRMVNMLNWDLFLYTRQFYSMDTDFQLAAVTKMLSYPITIG 188

Query: 177 SVLHQYSPYSLNPKGPITLEGLKSLAALRYTLYPEQSGRFRAGQDTPIRIFILGTRAEAQ 236
           S+LHQ+SPY+L P+GPITLEGLKSLAALRYTLYPE S   RA +  P+RIFILG RAEAQ
Sbjct: 189 SLLHQFSPYALEPRGPITLEGLKSLAALRYTLYPE-SESARAVRSKPMRIFILGARAEAQ 247

Query: 237 LPGHVWKQLQYLIPDTSIELHFVGPESFYDREKRSYVQSSTETIVKRIDEKMQLFYHTDF 296
           LPGHVWKQLQYL P +++E+HF+GPE+ YDR+++ YV SST  + KR+D  ++L +HTD+
Sbjct: 248 LPGHVWKQLQYLFPGSNMEIHFIGPEALYDRQRKEYVHSST-PVSKRVDGTLKLVHHTDY 306

Query: 297 FHVFHEAQDFFPYDPYNDVFFCFHPGFAAPETEEYWMGDTMKALMQTKCAVFTTGFSKED 356
            HVFHEAQDFFPYDPYNDVFFCFHPGFA+ E    WM  T+ AL++TKCA+F TGF ++D
Sbjct: 307 LHVFHEAQDFFPYDPYNDVFFCFHPGFASAEGRSSWMDKTVPALLETKCAIFVTGFHRDD 366

Query: 357 LLRDISIVQDKYGSELDMLMEPVPNVFGSTKWELNDTNPHEVYQFNMYIAGFRGKRYHAI 416
           +  D   ++  + +E+D+LM P  N+FGSTKWELND NPHEVYQFNMYIAGFRGKRYHAI
Sbjct: 367 MFGDFEALRASHDAEMDVLMHPTKNIFGSTKWELNDMNPHEVYQFNMYIAGFRGKRYHAI 426

Query: 417 EL 418
           ++
Sbjct: 427 QV 428

>KNAG0B02630 Chr2 complement(508645..509961) [1317 bp, 438 aa] {ON}
           Anc_7.346 YLR203C
          Length = 438

 Score =  610 bits (1572), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/426 (68%), Positives = 353/426 (82%), Gaps = 15/426 (3%)

Query: 1   MLASRTPVVYRAKPMTRPIMGFVRNALGLDPPASPDDPTPENRFHPWDQSPSPDLRERAA 60
           + AS  P + R     R +MGFVRNALGL+PP SP DPTPENRFHPWDQSP   LRERAA
Sbjct: 18  LRASGLPCIAR-----RQLMGFVRNALGLEPPPSPMDPTPENRFHPWDQSPVDALRERAA 72

Query: 61  RIKAMATCPVTHKDIQFTCPLSGIPTHHSREAWEKDTEYHKSKRYELLKKVNIYEHDLRS 120
           RIK +A CPVT  ++++TCPLSGIPTHHSREAWE+DT+YH +KRYE LKKVNIYEHDLRS
Sbjct: 73  RIKTLAKCPVTGLNVEYTCPLSGIPTHHSREAWEQDTQYHATKRYETLKKVNIYEHDLRS 132

Query: 121 GRPFPEFDFPQDQDYDRMVNMSNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLH 180
           GRPFPEFDFPQ+Q YD++VNM+NWDLFFYTR FYSMDTEFQLAAVTKMLSYP+TI S+L 
Sbjct: 133 GRPFPEFDFPQEQGYDKVVNMTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIASLLA 192

Query: 181 QYSPYSLNPKGPITLEGLKSLAALRYTLYPEQ-SGRFRAG--------QDTPIRIFILGT 231
           Q+SPYSLNPKGPITLEGLKSLAA+RYTLY +  +   RAG        ++ P+R+F+LG 
Sbjct: 193 QFSPYSLNPKGPITLEGLKSLAAVRYTLYSQSFNNSARAGGVTTGGALKNRPMRLFVLGA 252

Query: 232 RAEAQLPGHVWKQLQYLIPDTSIELHFVGPESFYDREKRSYVQSSTETIVKRIDEKMQLF 291
           RAEAQLPGHVWKQL YL P+ S E+ F+GPES+YDR +  YV+S T  +V+++DE ++  
Sbjct: 253 RAEAQLPGHVWKQLSYLFPEQSFEMVFIGPESYYDRARGQYVRSPTP-VVEKVDETLKFI 311

Query: 292 YHTDFFHVFHEAQDFFPYDPYNDVFFCFHPGFAAPETEEYWMGDTMKALMQTKCAVFTTG 351
           ++TD+FHV HE+QDFFPYDPY D FF FHPGFA+PE  + W+ +T+ AL+ TKCA+FTTG
Sbjct: 312 HYTDYFHVLHESQDFFPYDPYFDCFFTFHPGFASPENRDTWLSNTLPALLDTKCAIFTTG 371

Query: 352 FSKEDLLRDISIVQDKYGSELDMLMEPVPNVFGSTKWELNDTNPHEVYQFNMYIAGFRGK 411
           F ++DL+ D++++ +K+GSE+D+LMEP  NVFGSTKWELND NPHEVYQFNMYIAGFRGK
Sbjct: 372 FDRDDLMNDVALLNEKFGSEMDILMEPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGK 431

Query: 412 RYHAIE 417
           RYH I+
Sbjct: 432 RYHTIK 437

>KAFR0B00840 Chr2 (159480..160760) [1281 bp, 426 aa] {ON} Anc_7.346
           YLR203C
          Length = 426

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/428 (67%), Positives = 337/428 (78%), Gaps = 12/428 (2%)

Query: 1   MLASRTPVVY--------RAKPMTRPIMGFVRNALGLDPPASPDDPTPENRFHPWDQSPS 52
           ML S  P VY        + + ++R ++GFVRNALGL+PP +PD+P   NRF+PWDQSPS
Sbjct: 1   MLLSGAPHVYARGRLQHLQRRVLSRTLVGFVRNALGLEPPPTPDEPRVSNRFYPWDQSPS 60

Query: 53  PDLRERAARIKAMATCPVTHKDIQFTCPLSGIPTHHSREAWEKDTEYHKSKRYELLKKVN 112
           P+LRERAA+IKAMA CP+T K+I +TCP+SGIPTHHSREAWE+D  YH++K  ++LKKVN
Sbjct: 61  PELRERAAKIKAMARCPITGKEINYTCPISGIPTHHSREAWEQDEAYHRNKIPDILKKVN 120

Query: 113 IYEHDLRSGRPFPEFDFPQDQDYDRMVNMSNWDLFFYTRSFYSMDTEFQLAAVTKMLSYP 172
           IYEHDLRSGR FPEFDFP DQ +DR VN++NWDL+FYTRSFYSMDTEFQLA VTKMLSYP
Sbjct: 121 IYEHDLRSGRSFPEFDFPSDQTFDRAVNLANWDLYFYTRSFYSMDTEFQLATVTKMLSYP 180

Query: 173 ITIGSVLHQYSPYSLNPKGPITLEGLKSLAALRYTLYPEQ--SGRFRAGQDTPIRIFILG 230
           ITI SVLHQYSPYSL P GPITLEGLKS+AALRY+LYP Q  S R    +  P+RIFILG
Sbjct: 181 ITIASVLHQYSPYSLYPHGPITLEGLKSIAALRYSLYPSQHKSSRSVLNKTRPMRIFILG 240

Query: 231 TRAEAQLPGHVWKQLQYLIPDTSIELHFVGPESFYDREKRSYVQSSTETIVKRIDEKMQL 290
            RAE+QLPGHVWKQ QYL P  + E+ F+GPE    RE  + V      IVKRID+ + L
Sbjct: 241 ARAESQLPGHVWKQFQYLFPLQTFEIIFIGPECQL-REPSNSV-GGANNIVKRIDDTISL 298

Query: 291 FYHTDFFHVFHEAQDFFPYDPYNDVFFCFHPGFAAPETEEYWMGDTMKALMQTKCAVFTT 350
            YH   FH  H+AQDFFPYDPYNDVFF FHPGFA+PET+E WM DT+KAL+ TKCAVF T
Sbjct: 299 VYHPKLFHDIHKAQDFFPYDPYNDVFFVFHPGFASPETKELWMNDTVKALLDTKCAVFHT 358

Query: 351 GFSKEDLLRDISIVQDKYGSELDMLMEPVPNVFGSTKWELNDTNPHEVYQFNMYIAGFRG 410
           GFSK+DL  D+ ++   YG +LD LM PV N+FGSTKWELND NP EVYQFNMYI+ FRG
Sbjct: 359 GFSKKDLSNDVKLLNKMYGDKLDTLMTPVKNLFGSTKWELNDLNPQEVYQFNMYISAFRG 418

Query: 411 KRYHAIEL 418
           KRYH IE+
Sbjct: 419 KRYHPIEI 426

>NCAS0A14120 Chr1 (2777017..2778300) [1284 bp, 427 aa] {ON}
           Anc_7.346 YLR203C
          Length = 427

 Score =  601 bits (1549), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/401 (68%), Positives = 333/401 (83%), Gaps = 4/401 (0%)

Query: 17  RPIMGFVRNALGLDPPASPDDPTPENRFHPWDQSPSPDLRERAARIKAMATCPVTHKDIQ 76
           R ++GFV+NALG+DPP  P +P   NRF+PWD+SPSP +RERAARIKA A CPVT K+I+
Sbjct: 30  RTLVGFVKNALGIDPPPLPTEPVFANRFYPWDESPSPAIRERAARIKAQAKCPVTGKEIR 89

Query: 77  FTCPLSGIPTHHSREAWEKDTEYHKSKRYELLKKVNIYEHDLRSGRPFPEFDFPQDQDYD 136
           FTCPLSGIPTH+S+EAWE DT YHK+K YE L+KVNIYEHDLRSGRPFPEFDFP +Q  D
Sbjct: 90  FTCPLSGIPTHYSKEAWENDTNYHKNKIYEKLRKVNIYEHDLRSGRPFPEFDFPGEQARD 149

Query: 137 RMVNMSNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQYSPYSLNPKGPITLE 196
             VNM+NWDLFFYTR FYSMDTEFQLA VTKMLSYPITIGS+L++YSPY+L PKGP+TLE
Sbjct: 150 STVNMTNWDLFFYTRQFYSMDTEFQLATVTKMLSYPITIGSILYKYSPYNLIPKGPVTLE 209

Query: 197 GLKSLAALRYTLYPEQSGRFRAGQDTPIRIFILGTRAEAQLPGHVWKQLQYLIPDTSIEL 256
           GLKSLAALRYTL   ++  F   +  P+RIFILG RAE+QLP H+WKQLQ+L P  + E+
Sbjct: 210 GLKSLAALRYTL---RNNAFATTKTRPMRIFILGARAESQLPIHIWKQLQFLFPAQAFEI 266

Query: 257 HFVGPESFYDREKRSYVQSSTETIVKRIDEKMQLFYHTDFFHVFHEAQDFFPYDPYNDVF 316
           +F+GPE     +  +Y+ SS   IVKR+DE + L Y+ D+F  FH+AQDFFPYDPYND+F
Sbjct: 267 NFIGPECSLLEQDSNYL-SSDSRIVKRVDESLTLAYYPDYFDKFHKAQDFFPYDPYNDIF 325

Query: 317 FCFHPGFAAPETEEYWMGDTMKALMQTKCAVFTTGFSKEDLLRDISIVQDKYGSELDMLM 376
           F FHPGFA+PE+ + WMGDTMKAL+ TKCA+FTTGFS++D+++DI+ VQD YG E+DMLM
Sbjct: 326 FTFHPGFASPESSKTWMGDTMKALLDTKCAIFTTGFSQDDIMKDITSVQDTYGEEVDMLM 385

Query: 377 EPVPNVFGSTKWELNDTNPHEVYQFNMYIAGFRGKRYHAIE 417
            P+ NVFGSTKWELND NP +VYQFNMYIAGFRGKRYH ++
Sbjct: 386 NPIKNVFGSTKWELNDLNPQQVYQFNMYIAGFRGKRYHTVK 426

>NDAI0A01930 Chr1 complement(430531..431883) [1353 bp, 450 aa] {ON}
           Anc_7.346 YLR203C
          Length = 450

 Score =  593 bits (1530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/416 (65%), Positives = 334/416 (80%), Gaps = 16/416 (3%)

Query: 16  TRPIMGFVRNALGLDPPASPDDPTPENRFHPWDQSPSPDLRERAARIKAMATCPVTHKDI 75
            R  +GFV+NALG++PP SP++P  ENRFHPWDQSPSPDLRERAARI+A+A CPVT K+I
Sbjct: 38  NRHFVGFVKNALGMEPPPSPNEPAFENRFHPWDQSPSPDLRERAARIRALAKCPVTGKEI 97

Query: 76  QFTCPLSGIPTHHSREAWEKDTEYHKSKRYELLKKVNIYEHDLRSGRPFPEFDFPQDQDY 135
            +TCP+SGIPTHHS+EAWE DT YH++K Y++LKKVN++EHDLRSGR FPEF+FPQ QD+
Sbjct: 98  NYTCPISGIPTHHSKEAWENDTNYHQNKIYDILKKVNVFEHDLRSGRSFPEFEFPQSQDH 157

Query: 136 DRMVNMSNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQYSPYSLNPKGPITL 195
           D  V+M+NWD+FFYTR F SMD+EFQLA VTKMLSYPITI S+LH+Y PY+L P GPITL
Sbjct: 158 DCAVSMNNWDMFFYTRQFVSMDSEFQLATVTKMLSYPITIASILHKYCPYALEPNGPITL 217

Query: 196 EGLKSLAALRYTLYPEQSGRFRAGQDTPIRIFILGTRAEAQLPGHVWKQLQYLIPDTSIE 255
           EGLKS+AAL+Y+L   +   F   ++ P+RIFILG RAE+QLP H+WKQ  YL P  + E
Sbjct: 218 EGLKSIAALKYSL---RHNEFETTKERPMRIFILGARAESQLPEHIWKQFSYLFPFQNFE 274

Query: 256 LHFVGPES-------FYDREKRSYVQSSTET------IVKRIDEKMQLFYHTDFFHVFHE 302
           ++F+GPE          + E+ +   S + T      IVKRIDE++ L YHTDFFH  H 
Sbjct: 275 INFIGPECSVLMNNNNMNAEETNTTTSGSMTEIRPNRIVKRIDERLNLVYHTDFFHTLHN 334

Query: 303 AQDFFPYDPYNDVFFCFHPGFAAPETEEYWMGDTMKALMQTKCAVFTTGFSKEDLLRDIS 362
           A+DFFPYD YNDVFF FHPGFA+PE  + WMG+TMKAL+ TKCA+FTTGF+K+DLL+DI 
Sbjct: 335 ARDFFPYDSYNDVFFTFHPGFASPENTKSWMGETMKALLDTKCAIFTTGFNKQDLLKDID 394

Query: 363 IVQDKYGSELDMLMEPVPNVFGSTKWELNDTNPHEVYQFNMYIAGFRGKRYHAIEL 418
           IVQ+ YG E+DMLM+P  NVFGSTKWELND +P EVYQ+NMYIAGFRGKRYHA+++
Sbjct: 395 IVQETYGKEVDMLMKPTKNVFGSTKWELNDMDPQEVYQYNMYIAGFRGKRYHAVKV 450

>TBLA0E00500 Chr5 (91769..93082) [1314 bp, 437 aa] {ON} Anc_7.346
           YLR203C
          Length = 437

 Score =  573 bits (1477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/412 (66%), Positives = 333/412 (80%), Gaps = 14/412 (3%)

Query: 17  RPIMGFVRNALGLDPPASPDDPTPENRFHPWDQSPSPDLRERAARIKAMATCPVTHKDIQ 76
           R +MGFVR+ LGLDPP SP+DPTPENRFHPW+ SP  DLRERAARIK MA CPV++ DI 
Sbjct: 25  RNLMGFVRSTLGLDPPPSPNDPTPENRFHPWETSPCDDLRERAARIKTMAKCPVSNLDIN 84

Query: 77  FTCPLSGIPTHHSREAWEKDTEYHKSKRYELLKKVNIYEHDLRSGRPFPEFDFPQDQDYD 136
           +TCP+SGIPTHHSR+ WE DT YHK+   ++LKKVNIYEHDLRSGRPFPEFDFP++Q+YD
Sbjct: 85  YTCPISGIPTHHSRKEWEMDTNYHKNHIADILKKVNIYEHDLRSGRPFPEFDFPREQEYD 144

Query: 137 RMVNMSNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQYSPYSLNPKGPITLE 196
            ++N+ NWDL+FYTR+F+SMDTEFQLAAVTKMLSYP+TI SVLHQ+SPYSL PKGP+TLE
Sbjct: 145 TVINLINWDLYFYTRNFFSMDTEFQLAAVTKMLSYPMTIASVLHQFSPYSLTPKGPVTLE 204

Query: 197 GLKSLAALRYTLYPEQSGRFRAG-----------QDTPIRIFILGTRAEAQLPGHVWKQL 245
           GLKSLAALRYTL         +G           ++ P+RIFILG RAEAQLP HVWKQL
Sbjct: 205 GLKSLAALRYTLNNNSLSDTSSGNSDSTTITATSKNRPMRIFILGARAEAQLPPHVWKQL 264

Query: 246 QYLIPDTSIELHFVGPESFYDREKRSYVQSSTETIVKRIDEKMQLFYHTDFFHVFHEAQD 305
           QYL P+++ E+HF+GPES   ++K  YV S+T  I KRID+ M L YHTD+FHV+H+AQD
Sbjct: 265 QYLFPNSNFEIHFIGPESLLSKDKSHYVTSTTP-ITKRIDDSMSLVYHTDYFHVYHKAQD 323

Query: 306 FFPYDPYNDVFFCFHPGFAAPETEEYWMGDTMKALMQTKCAVFTTGFSKEDLLRDISIVQ 365
           F+PYDPY D+FF FHPG AA  T+E W+ +TM+ L+ +KC +F TGF ++D+  DIS++ 
Sbjct: 324 FYPYDPYFDIFFMFHPGLAA--TKETWLNETMQGLLDSKCPIFMTGFHEKDITADISVLN 381

Query: 366 DKYGSELDMLMEPVPNVFGSTKWELNDTNPHEVYQFNMYIAGFRGKRYHAIE 417
             +  ++D+LM+PV NVFGSTKWELND+NP EVYQFNMYIAG+RGKRYHA E
Sbjct: 382 KNFSKDMDILMKPVKNVFGSTKWELNDSNPQEVYQFNMYIAGYRGKRYHATE 433

>KNAG0C03750 Chr3 (740426..741700) [1275 bp, 424 aa] {ON} Anc_7.346
           YLR203C
          Length = 424

 Score =  559 bits (1440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/402 (62%), Positives = 317/402 (78%), Gaps = 6/402 (1%)

Query: 17  RPIMGFVRNALGLDPPASPDDPTPENRFHPWDQSPSPDLRERAARIKAMATCPVTHKDIQ 76
           R IMG+VRNA GL+P  SPD P   NRFHPW++SP  DLR+RAARIK +A CPVT K+I 
Sbjct: 29  RTIMGYVRNAFGLEPRDSPDTPQISNRFHPWEESPCADLRDRAARIKTLARCPVTGKNIN 88

Query: 77  FTCPLSGIPTHHSREAWEKDTEYHKSKRYELLKKVNIYEHDLRSGRPFPEFDFPQDQDYD 136
           +TCP+SGIPTHHSR+AWE DT+YHK+K YE LKKVNIYEHDLRSGR FPEFDFP +Q  D
Sbjct: 89  YTCPISGIPTHHSRKAWEDDTDYHKNKTYEKLKKVNIYEHDLRSGRSFPEFDFPAEQGRD 148

Query: 137 RMVNMSNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQYSPYSLNPKGPITLE 196
           R VN+ NWDLF YTR FYSMDTEF LA VTKMLSYPITI SVLH++SPY L P+GP+TLE
Sbjct: 149 RAVNLQNWDLFLYTRQFYSMDTEFHLATVTKMLSYPITIASVLHEFSPYKLQPRGPVTLE 208

Query: 197 GLKSLAALRYTLYPEQSGRFRAGQDTPIRIFILGTRAEAQLPGHVWKQLQYLIPDTSIEL 256
           GLKS+AALRYTLYP + G+     ++P+RIFI+GTRAE+QLPGHVWKQLQYL  +   E+
Sbjct: 209 GLKSIAALRYTLYP-KLGKTSLSNNSPMRIFIVGTRAESQLPGHVWKQLQYLFSERIFEI 267

Query: 257 HFVGPESFYDREKRSYVQSSTETIVKRIDEKMQLFYHTDFFHVFHEAQDFFPYDPYNDVF 316
           HF+GPE      K     +++  ++K++D+ + L YH  +FH  H++ D FPY+PY DVF
Sbjct: 268 HFIGPECQLKEPK-----NTSTPLIKKVDDTLSLIYHPQYFHELHKSGDLFPYNPYKDVF 322

Query: 317 FCFHPGFAAPETEEYWMGDTMKALMQTKCAVFTTGFSKEDLLRDISIVQDKYGSELDMLM 376
           F FHPGFA P+T + W+ +T+  L++TKCA+F TGF++ D+  D++++   Y +E+D+LM
Sbjct: 323 FIFHPGFAYPDTRKLWLDETIPNLLETKCAIFHTGFNEGDITNDVTLIDKCYRNEIDVLM 382

Query: 377 EPVPNVFGSTKWELNDTNPHEVYQFNMYIAGFRGKRYHAIEL 418
           +P+ NVFGS KWELND NP EVYQFNMYIAGFRGKRYH I++
Sbjct: 383 KPIKNVFGSVKWELNDINPQEVYQFNMYIAGFRGKRYHPIKI 424

>KLLA0D07029g Chr4 (602763..604367) [1605 bp, 534 aa] {ON} similar
           to uniprot|P19541 Saccharomyces cerevisiae YPL133C RDS2
           Regulator of drug sensitivity Transcriptional regulator
          Length = 534

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 62/146 (42%), Gaps = 16/146 (10%)

Query: 15  MTRPIMGFVRNALGLDPPASPDD--PTPENRFHPWDQSPSPDLRERAARIKAMATCPVTH 72
           M  P+   V+NA G+ PP  PDD  PTP+  F      PS ++     R+K +    +  
Sbjct: 293 MQSPVHSNVQNAGGMSPPLLPDDQQPTPKENFFLTAADPSTEINPE-DRLKLVINAKLEA 351

Query: 73  KDIQFTCPLSGIPTHHSREAWEKDTEYHKSKRYELLKKVNIYEHDLRS-GRPFPEFDFP- 130
             +Q      G    +SR     D   ++S +  +LK ++I     R+  R   + D   
Sbjct: 352 GLLQPYNYAKG----YSRLQKFMDKYMNQSSKQRILKPLSIIRPAFRAIARSLKDVDLVL 407

Query: 131 QDQDYDRMVNMSNWDLFFYTRSFYSM 156
            ++ ++RM       L  Y R F SM
Sbjct: 408 VEESFERM-------LLSYDRVFTSM 426

>Suva_6.126 Chr6 complement(209913..212375) [2463 bp, 820 aa] {ON}
           YJL051W (REAL)
          Length = 820

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 34/72 (47%), Gaps = 10/72 (13%)

Query: 84  IPTHHSREAWEKDTEYHKSKRYELLKKVNIYEHDLRSGRPFPEFDFPQDQDYDRMVNMSN 143
           +P H + E WEKD E        +L+KV     +L   +  P F F    D DR  + + 
Sbjct: 455 LPAHVTLEMWEKDQE-------NILRKVTT---NLADSKLLPPFRFTSKSDIDRNSSPTE 504

Query: 144 WDLFFYTRSFYS 155
            ++  +T++ +S
Sbjct: 505 LEVELHTQNNFS 516

>KLTH0G11418g Chr7 (962267..964960) [2694 bp, 897 aa] {ON} similar
           to uniprot|P89102 Saccharomyces cerevisiae YDR166C SEC5
           Essential 107kDa subunit of the exocyst complex (Sec3p
           Sec5p Sec6p Sec8p Sec10p Sec15p Exo70p and Exo84p) which
           has the essential function of mediating polarized
           targeting of secretory vesicles to active sites of
           exocytosis
          Length = 897

 Score = 31.6 bits (70), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 27/117 (23%), Positives = 53/117 (45%), Gaps = 12/117 (10%)

Query: 165 VTKMLSYPITIGSVLHQYSPYSLNPKGPITLEGLKSLAALRYTLYPEQSGRFRAGQDTP- 223
           V +++S    + S+L + +    NP+ P T+  L +L  ++ +++P+    F    +T  
Sbjct: 661 VQQIVSMEAVLESILKEAAKEKENPRNPRTILTLTNLQYIKGSVFPQVLRYFDESFETQL 720

Query: 224 ----IRIFILGTRAEAQLPGHVWKQLQYLIPDTSIELHFVGPESFYDREKRSYVQSS 276
               + IF L  + E  + G+      YL  D  + L  +  E FY+    +Y  +S
Sbjct: 721 SRKNLEIFTLLAKMETSILGN------YL-SDLKVTLRDILEERFYEINWAAYNSNS 770

>NCAS0A07580 Chr1 complement(1507060..1507893) [834 bp, 277 aa] {ON}
           Anc_7.38
          Length = 277

 Score = 30.8 bits (68), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 35/75 (46%), Gaps = 9/75 (12%)

Query: 66  ATCPVTHKDIQFTCPLSGIPTHHSREAWEKDTEYHKSKRYELLKKVNIYEHDLRSGRPFP 125
           + CPV HKD +   PL+ +P   S       ++ H ++R EL K   I     R   P  
Sbjct: 46  SACPVMHKDAENINPLNNMPFSIS-------SDKHSTQRLELPKDRTISSIP-RGSDPSQ 97

Query: 126 EFDFPQDQD-YDRMV 139
            +++P  Q  Y+ MV
Sbjct: 98  NWEYPSPQQMYNAMV 112

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.138    0.432 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,482,951
Number of extensions: 2201760
Number of successful extensions: 4774
Number of sequences better than 10.0: 31
Number of HSP's gapped: 4841
Number of HSP's successfully gapped: 31
Length of query: 418
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 306
Effective length of database: 40,638,807
Effective search space: 12435474942
Effective search space used: 12435474942
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)