Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D12408g7.347ON1841849921e-139
Ecym_47267.347ON1911917681e-105
ACL151C7.347ON2081917661e-104
Kwal_56.246347.347ON1901907011e-94
KLTH0H01320g7.347ON1901906983e-94
YDL165W (CDC36)7.347ON1911916976e-94
Skud_4.927.347ON1911916966e-94
Smik_4.737.347ON1911916968e-94
NDAI0A019207.347ON1931936899e-93
Suva_4.817.347ON1911916881e-92
ZYRO0F11638g7.347ON1911916881e-92
TDEL0C020107.347ON1911916862e-92
KAFR0B008507.347ON1921926844e-92
CAGL0I03388g7.347ON1911916802e-91
KNAG0C037607.347ON1911916776e-91
SAKL0F11308g7.347ON1911896751e-90
Kpol_530.347.347ON1911916691e-89
NCAS0A141307.347ON1911916672e-89
TPHA0F029407.347ON1911916384e-85
TBLA0E005107.347ON2871676362e-83
ZYRO0C16588g3.370ON608801063e-05
SAKL0B08052g3.370ON576811037e-05
KAFR0H008603.370ON578791011e-04
NDAI0A050803.370ON575791002e-04
Kwal_23.39623.370ON55378992e-04
CAGL0D01342g3.370ON54879992e-04
TPHA0A035003.370ON54879983e-04
KLTH0F11880g3.370ON56378983e-04
Smik_16.3163.370ON56079974e-04
YPR072W (NOT5)3.370ON56079974e-04
Kpol_1006.73.370ON54078965e-04
Skud_16.3613.370ON56081958e-04
Suva_16.4013.370ON56581940.001
KNAG0A072903.370ON50779900.003
TBLA0H014903.370ON55279890.005
Ecym_34563.370ON508117880.006
ADL364C3.370ON50480870.007
TDEL0C051203.370ON56280840.020
KLLA0B09196g3.370ON59066830.026
ZYRO0F16500g1.90ON1197139800.061
KLTH0A03652g7.214ON77238780.10
Kpol_1070.257.214ON68682780.12
TDEL0H023307.214ON81281750.30
NCAS0A112103.370ON58293740.36
NDAI0A026907.214ON84681730.51
ZYRO0D16302g7.214ON82981701.4
NCAS0A133507.214ON80081691.6
KNAG0E022302.413ON86458672.7
Skud_12.2511.64ON25274653.9
Kpol_2000.811.64ON25274654.1
Smik_12.2461.64ON25274654.2
Suva_10.2821.64ON25274654.2
YLR186W (EMG1)1.64ON25274654.3
TPHA0B046401.64ON25383654.3
KLTH0F01958g1.64ON25274644.6
NCAS0A005001.64ON25274644.7
KAFR0D040301.64ON25274644.7
Kwal_33.132891.64ON25274644.9
TBLA0D042707.214ON84766655.1
TDEL0C063801.64ON25274645.4
KAFR0I002207.16ON76634646.5
TPHA0C012907.214ON78682647.4
KLLA0E04335g7.214ON75836647.7
TDEL0C053803.401ON237174639.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D12408g
         (184 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D12408g Chr4 (1055117..1055671) [555 bp, 184 aa] {ON} simil...   386   e-139
Ecym_4726 Chr4 (1420080..1420655) [576 bp, 191 aa] {ON} similar ...   300   e-105
ACL151C Chr3 complement(87037..87663) [627 bp, 208 aa] {ON} Synt...   299   e-104
Kwal_56.24634 s56 complement(1082319..1082891) [573 bp, 190 aa] ...   274   1e-94
KLTH0H01320g Chr8 (125017..125589) [573 bp, 190 aa] {ON} highly ...   273   3e-94
YDL165W Chr4 (164290..164865) [576 bp, 191 aa] {ON}  CDC36Compon...   273   6e-94
Skud_4.92 Chr4 (159953..160528) [576 bp, 191 aa] {ON} YDL165W (R...   272   6e-94
Smik_4.73 Chr4 (141054..141629) [576 bp, 191 aa] {ON} YDL165W (R...   272   8e-94
NDAI0A01920 Chr1 (429808..430389) [582 bp, 193 aa] {ON} Anc_7.34...   270   9e-93
Suva_4.81 Chr4 (151849..152424) [576 bp, 191 aa] {ON} YDL165W (R...   269   1e-92
ZYRO0F11638g Chr6 complement(954908..955483) [576 bp, 191 aa] {O...   269   1e-92
TDEL0C02010 Chr3 (348737..349312) [576 bp, 191 aa] {ON} Anc_7.34...   268   2e-92
KAFR0B00850 Chr2 complement(160852..161430) [579 bp, 192 aa] {ON...   268   4e-92
CAGL0I03388g Chr9 (288784..289359) [576 bp, 191 aa] {ON} highly ...   266   2e-91
KNAG0C03760 Chr3 complement(741798..742373) [576 bp, 191 aa] {ON...   265   6e-91
SAKL0F11308g Chr6 complement(882040..882615) [576 bp, 191 aa] {O...   264   1e-90
Kpol_530.34 s530 (82095..82670) [576 bp, 191 aa] {ON} (82095..82...   262   1e-89
NCAS0A14130 Chr1 complement(2778386..2778961) [576 bp, 191 aa] {...   261   2e-89
TPHA0F02940 Chr6 complement(648881..649456) [576 bp, 191 aa] {ON...   250   4e-85
TBLA0E00510 Chr5 complement(93705..94568) [864 bp, 287 aa] {ON} ...   249   2e-83
ZYRO0C16588g Chr3 (1293001..1294827) [1827 bp, 608 aa] {ON} high...    45   3e-05
SAKL0B08052g Chr2 (688482..690212) [1731 bp, 576 aa] {ON} highly...    44   7e-05
KAFR0H00860 Chr8 complement(158881..160617) [1737 bp, 578 aa] {O...    44   1e-04
NDAI0A05080 Chr1 complement(1154530..1156257) [1728 bp, 575 aa] ...    43   2e-04
Kwal_23.3962 s23 complement(502287..503948) [1662 bp, 553 aa] {O...    43   2e-04
CAGL0D01342g Chr4 complement(149562..151208) [1647 bp, 548 aa] {...    43   2e-04
TPHA0A03500 Chr1 complement(769721..771367) [1647 bp, 548 aa] {O...    42   3e-04
KLTH0F11880g Chr6 complement(1000583..1002274) [1692 bp, 563 aa]...    42   3e-04
Smik_16.316 Chr16 (567157..568839) [1683 bp, 560 aa] {ON} YPR072...    42   4e-04
YPR072W Chr16 (690107..691789) [1683 bp, 560 aa] {ON}  NOT5Subun...    42   4e-04
Kpol_1006.7 s1006 (30700..32322) [1623 bp, 540 aa] {ON} (30700.....    42   5e-04
Skud_16.361 Chr16 (655247..656929) [1683 bp, 560 aa] {ON} YPR072...    41   8e-04
Suva_16.401 Chr16 (697328..699025) [1698 bp, 565 aa] {ON} YPR072...    41   0.001
KNAG0A07290 Chr1 (1139630..1141153) [1524 bp, 507 aa] {ON} Anc_3...    39   0.003
TBLA0H01490 Chr8 complement(331583..333241) [1659 bp, 552 aa] {O...    39   0.005
Ecym_3456 Chr3 complement(853907..855433) [1527 bp, 508 aa] {ON}...    39   0.006
ADL364C Chr4 complement(66072..67586) [1515 bp, 504 aa] {ON} Syn...    38   0.007
TDEL0C05120 Chr3 (917832..919520) [1689 bp, 562 aa] {ON} Anc_3.3...    37   0.020
KLLA0B09196g Chr2 complement(803259..805031) [1773 bp, 590 aa] {...    37   0.026
ZYRO0F16500g Chr6 (1355819..1359412) [3594 bp, 1197 aa] {ON} sim...    35   0.061
KLTH0A03652g Chr1 (314336..316654) [2319 bp, 772 aa] {ON} some s...    35   0.10 
Kpol_1070.25 s1070 complement(58286..59491,59501..59509,59592..6...    35   0.12 
TDEL0H02330 Chr8 complement(391361..393799) [2439 bp, 812 aa] {O...    33   0.30 
NCAS0A11210 Chr1 (2223815..2225563) [1749 bp, 582 aa] {ON} Anc_3...    33   0.36 
NDAI0A02690 Chr1 complement(603611..606151) [2541 bp, 846 aa] {O...    33   0.51 
ZYRO0D16302g Chr4 (1357223..1359712) [2490 bp, 829 aa] {ON} simi...    32   1.4  
NCAS0A13350 Chr1 (2627917..2630319) [2403 bp, 800 aa] {ON} Anc_7...    31   1.6  
KNAG0E02230 Chr5 complement(449921..452515) [2595 bp, 864 aa] {O...    30   2.7  
Skud_12.251 Chr12 (470293..471051) [759 bp, 252 aa] {ON} YLR186W...    30   3.9  
Kpol_2000.81 s2000 complement(181752..182510) [759 bp, 252 aa] {...    30   4.1  
Smik_12.246 Chr12 (470597..471355) [759 bp, 252 aa] {ON} YLR186W...    30   4.2  
Suva_10.282 Chr10 (496316..497074) [759 bp, 252 aa] {ON} YLR186W...    30   4.2  
YLR186W Chr12 (523632..524390) [759 bp, 252 aa] {ON}  EMG1Member...    30   4.3  
TPHA0B04640 Chr2 complement(1092893..1093654) [762 bp, 253 aa] {...    30   4.3  
KLTH0F01958g Chr6 (154767..155525) [759 bp, 252 aa] {ON} highly ...    29   4.6  
NCAS0A00500 Chr1 (78733..79491) [759 bp, 252 aa] {ON} Anc_1.64         29   4.7  
KAFR0D04030 Chr4 complement(795277..796035) [759 bp, 252 aa] {ON...    29   4.7  
Kwal_33.13289 s33 (159729..160487) [759 bp, 252 aa] {ON} YLR186W...    29   4.9  
TBLA0D04270 Chr4 complement(1055025..1057568) [2544 bp, 847 aa] ...    30   5.1  
TDEL0C06380 Chr3 complement(1167515..1168273) [759 bp, 252 aa] {...    29   5.4  
KAFR0I00220 Chr9 (45560..47860) [2301 bp, 766 aa] {ON} Anc_7.16 ...    29   6.5  
TPHA0C01290 Chr3 complement(294072..296432) [2361 bp, 786 aa] {O...    29   7.4  
KLLA0E04335g Chr5 (391816..394092) [2277 bp, 758 aa] {ON} simila...    29   7.7  
TDEL0C05380 Chr3 (960131..967246) [7116 bp, 2371 aa] {ON} Anc_3....    29   9.9  

>KLLA0D12408g Chr4 (1055117..1055671) [555 bp, 184 aa] {ON} similar
           to uniprot|P06100 Saccharomyces cerevisiae YDL165W CDC36
           Component of the CCR4-NOT complex which has multiple
           roles in regulating mRNA levels including regulation of
           transcription and destabilizing mRNAs by deadenylation
           basal transcription factor
          Length = 184

 Score =  386 bits (992), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 184/184 (100%), Positives = 184/184 (100%)

Query: 1   MEKYGLKDLVPVLRHDPTYDANMTLGIDLNSLLNSLDITKDTKSHHCLDAFESPWVETSR 60
           MEKYGLKDLVPVLRHDPTYDANMTLGIDLNSLLNSLDITKDTKSHHCLDAFESPWVETSR
Sbjct: 1   MEKYGLKDLVPVLRHDPTYDANMTLGIDLNSLLNSLDITKDTKSHHCLDAFESPWVETSR 60

Query: 61  SEVQPTFFIPESFKNIKGMLGTDQVEFTSVNRDQPRISLLQDETLFYLFYKHPGSVIQEL 120
           SEVQPTFFIPESFKNIKGMLGTDQVEFTSVNRDQPRISLLQDETLFYLFYKHPGSVIQEL
Sbjct: 61  SEVQPTFFIPESFKNIKGMLGTDQVEFTSVNRDQPRISLLQDETLFYLFYKHPGSVIQEL 120

Query: 121 TYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYVFFDPQRWEKCQRDFVLHY 180
           TYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYVFFDPQRWEKCQRDFVLHY
Sbjct: 121 TYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYVFFDPQRWEKCQRDFVLHY 180

Query: 181 NAIM 184
           NAIM
Sbjct: 181 NAIM 184

>Ecym_4726 Chr4 (1420080..1420655) [576 bp, 191 aa] {ON} similar to
           Ashbya gossypii ACL151C
          Length = 191

 Score =  300 bits (768), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 143/191 (74%), Positives = 162/191 (84%), Gaps = 7/191 (3%)

Query: 1   MEKYGLKDLVPVLRHDPTYDANMTLGIDLNSLLNSLDIT-KDT------KSHHCLDAFES 53
           M KYGLK L+PV++HD  YD++MTLG DL S+L+SL +T +D+        HH LD F S
Sbjct: 1   MSKYGLKSLLPVIKHDKQYDSSMTLGTDLPSILHSLQLTTRDSYNSGLNNGHHTLDTFPS 60

Query: 54  PWVETSRSEVQPTFFIPESFKNIKGMLGTDQVEFTSVNRDQPRISLLQDETLFYLFYKHP 113
           PWVETSRSEV+P FFIPESFKNI G+LG     FTSV RD PRISLLQDETLFYLFYKHP
Sbjct: 61  PWVETSRSEVEPKFFIPESFKNIVGVLGQPSTYFTSVARDHPRISLLQDETLFYLFYKHP 120

Query: 114 GSVIQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYVFFDPQRWEKCQ 173
           G+V+QELTYLELRKRNWRYHKTLKVWLTKDP+MEP+V+QDS SERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDPQRWEKCQ 180

Query: 174 RDFVLHYNAIM 184
           RDF+L+YNAIM
Sbjct: 181 RDFILNYNAIM 191

>ACL151C Chr3 complement(87037..87663) [627 bp, 208 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL165W
           (CDC36)
          Length = 208

 Score =  299 bits (766), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 141/191 (73%), Positives = 164/191 (85%), Gaps = 7/191 (3%)

Query: 1   MEKYGLKDLVPVLRHDPTYDANMTLGIDLNSLLNSLDIT-KD------TKSHHCLDAFES 53
           M+KYGLK L+PV++H+  YDA MTLG+D++SLL+SL ++ KD      +  HH LD F S
Sbjct: 18  MDKYGLKGLLPVIKHEKQYDAFMTLGVDVSSLLHSLQVSSKDGYNTALSNGHHALDTFPS 77

Query: 54  PWVETSRSEVQPTFFIPESFKNIKGMLGTDQVEFTSVNRDQPRISLLQDETLFYLFYKHP 113
           PWVETSRSEV+P FFIPESF NI G+LG    +FTSV RD PRISLLQDETLFYLFYKHP
Sbjct: 78  PWVETSRSEVEPKFFIPESFCNIGGVLGQASTDFTSVARDHPRISLLQDETLFYLFYKHP 137

Query: 114 GSVIQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYVFFDPQRWEKCQ 173
           G+V+QELTYLELRKRNWRYHKTLKVWLTKDP+MEP+V+QDS SERGSYVFFDPQRWEKCQ
Sbjct: 138 GTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDPQRWEKCQ 197

Query: 174 RDFVLHYNAIM 184
           RDF+L+Y+AIM
Sbjct: 198 RDFILNYSAIM 208

>Kwal_56.24634 s56 complement(1082319..1082891) [573 bp, 190 aa]
           {ON} YDL165W (CDC36) - nuclear protein that negatively
           regulates basal transcription [contig 161] FULL
          Length = 190

 Score =  274 bits (701), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 134/190 (70%), Positives = 153/190 (80%), Gaps = 6/190 (3%)

Query: 1   MEKYGLKDLVPVLRHD---PTYDANMTLGIDLNSLLNSLDITKDTKSHH-CLDAFESPWV 56
           MEKYGL  L+P++R +   P YD++MTLGIDL+ +L+SL I  +  + +  LD F+SPWV
Sbjct: 1   MEKYGLSALLPLIRREDQSPEYDSSMTLGIDLSPVLHSLGIASNQSTRYRVLDTFQSPWV 60

Query: 57  ETSRSEVQPTFFIPESFKNIKGML--GTDQVEFTSVNRDQPRISLLQDETLFYLFYKHPG 114
           ETSRSEV+P FF+PESFKNI  +L  G     F SV +D  +ISL QDETLFYLFYKHPG
Sbjct: 61  ETSRSEVEPKFFVPESFKNIPNVLQAGDKPPAFNSVQQDHAKISLFQDETLFYLFYKHPG 120

Query: 115 SVIQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYVFFDPQRWEKCQR 174
           SV+QELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVA    SERGSYVFFDPQRWEKCQR
Sbjct: 121 SVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEKCQR 180

Query: 175 DFVLHYNAIM 184
           DFVL YNAIM
Sbjct: 181 DFVLFYNAIM 190

>KLTH0H01320g Chr8 (125017..125589) [573 bp, 190 aa] {ON} highly
           similar to uniprot|P06100 Saccharomyces cerevisiae
           YDL165W CDC36 Component of the CCR4-NOT complex which
           has multiple roles in regulating mRNA levels including
           regulation of transcription and destabilizing mRNAs by
           deadenylation basal transcription factor
          Length = 190

 Score =  273 bits (698), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 153/190 (80%), Gaps = 6/190 (3%)

Query: 1   MEKYGLKDLVPVLRHD---PTYDANMTLGIDLNSLLNSLDITKDTKSHH-CLDAFESPWV 56
           MEKYGL  L+P++R +   P YD++MTLGIDL+ +L+SL I  +  S +  LD F+SPWV
Sbjct: 1   MEKYGLSALLPLIRREDQSPDYDSSMTLGIDLSPVLHSLGIPNNQPSRNRVLDTFQSPWV 60

Query: 57  ETSRSEVQPTFFIPESFKNIKGML--GTDQVEFTSVNRDQPRISLLQDETLFYLFYKHPG 114
           ETSRSEV+P FF+PESFKNI  +L  G     F SV +D  +ISL QDETLFYLFYKHPG
Sbjct: 61  ETSRSEVEPKFFVPESFKNIPNVLQSGERPPAFNSVQQDHAKISLFQDETLFYLFYKHPG 120

Query: 115 SVIQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYVFFDPQRWEKCQR 174
           SV+QELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVA    SERGSYVFFDPQRWEKCQR
Sbjct: 121 SVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEKCQR 180

Query: 175 DFVLHYNAIM 184
           DFVL YNAIM
Sbjct: 181 DFVLFYNAIM 190

>YDL165W Chr4 (164290..164865) [576 bp, 191 aa] {ON}  CDC36Component
           of the CCR4-NOT complex, which has multiple roles in
           regulating mRNA levels including regulation of
           transcription and destabilizing mRNAs by deadenylation;
           basal transcription factor
          Length = 191

 Score =  273 bits (697), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 153/191 (80%), Gaps = 7/191 (3%)

Query: 1   MEKYGLKDLVPVLRHD-----PTYDANMTLGIDLNSLLNSLDITKDTKSHHCLDAFESPW 55
           MEK+GLK LVP+L+ +      TYD +MTLG DL+S+L SL I +D++ H  LD F+SPW
Sbjct: 1   MEKFGLKALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60

Query: 56  VETSRSEVQPTFFIPESFKNIKGMLGTDQVE--FTSVNRDQPRISLLQDETLFYLFYKHP 113
            ETSRSEV+P FF PESF NI G+L +      F S+  DQ R++L QDETLF+LFYKHP
Sbjct: 61  AETSRSEVEPRFFTPESFTNIPGVLQSTVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP 120

Query: 114 GSVIQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYVFFDPQRWEKCQ 173
           G+VIQELTYLELRKRNWRYHKTLK WLTKDPMMEP+V+ D +SERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ 180

Query: 174 RDFVLHYNAIM 184
           RDF+L YNAIM
Sbjct: 181 RDFLLFYNAIM 191

>Skud_4.92 Chr4 (159953..160528) [576 bp, 191 aa] {ON} YDL165W
           (REAL)
          Length = 191

 Score =  272 bits (696), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 129/191 (67%), Positives = 154/191 (80%), Gaps = 7/191 (3%)

Query: 1   MEKYGLKDLVPVLRHD-----PTYDANMTLGIDLNSLLNSLDITKDTKSHHCLDAFESPW 55
           MEK+GL+ LVP+L+ +      TYD +MTLG DL+S+L SL I +D++ H  LD F+SPW
Sbjct: 1   MEKFGLRALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60

Query: 56  VETSRSEVQPTFFIPESFKNIKGMLGTDQVE--FTSVNRDQPRISLLQDETLFYLFYKHP 113
            ETSRSEV+P FF PESF NI G+L ++     F S+  DQ R++L QDETLF+LFYKHP
Sbjct: 61  AETSRSEVEPRFFTPESFTNIPGVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP 120

Query: 114 GSVIQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYVFFDPQRWEKCQ 173
           G+VIQELTYLELRKRNWRYHKTLK WLTKDPMMEP+V+ D +SERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ 180

Query: 174 RDFVLHYNAIM 184
           RDF+L YNAIM
Sbjct: 181 RDFLLFYNAIM 191

>Smik_4.73 Chr4 (141054..141629) [576 bp, 191 aa] {ON} YDL165W
           (REAL)
          Length = 191

 Score =  272 bits (696), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 129/191 (67%), Positives = 154/191 (80%), Gaps = 7/191 (3%)

Query: 1   MEKYGLKDLVPVLRHD-----PTYDANMTLGIDLNSLLNSLDITKDTKSHHCLDAFESPW 55
           MEK+GL+ LVP+L+ +      TYD +MTLG DL+S+L SL I +D++ H  LD F+SPW
Sbjct: 1   MEKFGLQALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60

Query: 56  VETSRSEVQPTFFIPESFKNIKGMLGTDQVE--FTSVNRDQPRISLLQDETLFYLFYKHP 113
            ETSRSEV+P FF PESF NI G+L ++     F S+  DQ R++L QDETLF+LFYKHP
Sbjct: 61  AETSRSEVEPRFFTPESFTNIPGVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP 120

Query: 114 GSVIQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYVFFDPQRWEKCQ 173
           G+VIQELTYLELRKRNWRYHKTLK WLTKDPMMEP+V+ D +SERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ 180

Query: 174 RDFVLHYNAIM 184
           RDF+L YNAIM
Sbjct: 181 RDFLLFYNAIM 191

>NDAI0A01920 Chr1 (429808..430389) [582 bp, 193 aa] {ON} Anc_7.347
           YDL165W
          Length = 193

 Score =  270 bits (689), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 129/193 (66%), Positives = 156/193 (80%), Gaps = 9/193 (4%)

Query: 1   MEKYGLKDLVPVLRHD-----PTYDANMTLGIDLNSLLNSLDITKDTKSHHCLDAFESPW 55
           M+K+GL+ LVP+++ D       YD +MTLG DL S+L+SL I +D+K H  LD F+SPW
Sbjct: 1   MDKFGLEALVPLIKPDDKELSKIYDHSMTLGADLTSMLHSLGIPRDSKRHRVLDTFQSPW 60

Query: 56  VETSRSEVQPTFFIPESFKNIKGMLGTDQVE----FTSVNRDQPRISLLQDETLFYLFYK 111
            ETSRSEV+PTFFIP+SF +I  +L ++  +    F SV +DQ R++L QDETLFYLFYK
Sbjct: 61  AETSRSEVEPTFFIPDSFTHIPDVLQSNTKDTPPSFDSVQKDQQRVALFQDETLFYLFYK 120

Query: 112 HPGSVIQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYVFFDPQRWEK 171
           HPG+VIQELTYLELRKRNWRYHKTLK WLTKDPMMEPVV+ D +SERGSYVFFDPQRWEK
Sbjct: 121 HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPVVSNDGLSERGSYVFFDPQRWEK 180

Query: 172 CQRDFVLHYNAIM 184
           CQR+F+L YNAIM
Sbjct: 181 CQREFLLFYNAIM 193

>Suva_4.81 Chr4 (151849..152424) [576 bp, 191 aa] {ON} YDL165W
           (REAL)
          Length = 191

 Score =  269 bits (688), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 153/191 (80%), Gaps = 7/191 (3%)

Query: 1   MEKYGLKDLVPVLRHD-----PTYDANMTLGIDLNSLLNSLDITKDTKSHHCLDAFESPW 55
           M+K+GL+ LVP+L+ +      TYD +MTLG DL+S+L SL I +D++ H  LD F+SPW
Sbjct: 1   MDKFGLQALVPLLKQEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60

Query: 56  VETSRSEVQPTFFIPESFKNIKGMLGTDQVE--FTSVNRDQPRISLLQDETLFYLFYKHP 113
            ETSRSEV+P FF PESF NI  +L ++     F S+  DQ R++L QDETLF+LFYKHP
Sbjct: 61  AETSRSEVEPRFFTPESFTNIPSVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP 120

Query: 114 GSVIQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYVFFDPQRWEKCQ 173
           G+VIQELTYLELRKRNWRYHKTLK WLTKDPMMEP+V+ D +SERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ 180

Query: 174 RDFVLHYNAIM 184
           RDF+L YNAIM
Sbjct: 181 RDFLLFYNAIM 191

>ZYRO0F11638g Chr6 complement(954908..955483) [576 bp, 191 aa] {ON}
           highly similar to uniprot|P06100 Saccharomyces
           cerevisiae YDL165W CDC36 Component of the CCR4-NOT
           complex which has multiple roles in regulating mRNA
           levels including regulation of transcription and
           destabilizing mRNAs by deadenylation basal transcription
           factor
          Length = 191

 Score =  269 bits (688), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 129/191 (67%), Positives = 153/191 (80%), Gaps = 7/191 (3%)

Query: 1   MEKYGLKDLVPVLRHD-----PTYDANMTLGIDLNSLLNSLDITKDTKSHHCLDAFESPW 55
           M+K+GL+ LVP+++ +       YD +MTLG DL+S+L+SL I +D+K H  LD F+SPW
Sbjct: 1   MDKFGLEALVPLVKQEDRELSGKYDHSMTLGADLSSMLHSLGIPRDSKRHKVLDTFQSPW 60

Query: 56  VETSRSEVQPTFFIPESFKNIKGMLGTDQVE--FTSVNRDQPRISLLQDETLFYLFYKHP 113
            ETSRSEV+P FFIPESF NI  +L +      F SV +DQ R++L QDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPRFFIPESFVNIPNVLHSQSTPPCFNSVQQDQQRVALFQDETLFYLFYKHP 120

Query: 114 GSVIQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYVFFDPQRWEKCQ 173
           G+VIQELTYLELRKRNWRYHKTLK WLTKDP MEPVV+ D +SERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQ 180

Query: 174 RDFVLHYNAIM 184
           RDF+L YNAIM
Sbjct: 181 RDFLLFYNAIM 191

>TDEL0C02010 Chr3 (348737..349312) [576 bp, 191 aa] {ON} Anc_7.347
           YDL165W
          Length = 191

 Score =  268 bits (686), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 152/191 (79%), Gaps = 7/191 (3%)

Query: 1   MEKYGLKDLVPVLRHD-----PTYDANMTLGIDLNSLLNSLDITKDTKSHHCLDAFESPW 55
           MEK+GLK LVP+++ +       YD ++TLG DL+S+L+SL I +D+K H  LD F+SPW
Sbjct: 1   MEKFGLKALVPLIKQEERETASLYDHSITLGADLSSMLHSLGIPRDSKRHRVLDTFQSPW 60

Query: 56  VETSRSEVQPTFFIPESFKNIKGMLGTDQVE--FTSVNRDQPRISLLQDETLFYLFYKHP 113
            ETSRSEV+P FFIP+SF NI  +L +      F SV  DQ R++L QDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPKFFIPDSFTNIPQVLQSQTTPPCFNSVQHDQQRVALFQDETLFYLFYKHP 120

Query: 114 GSVIQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYVFFDPQRWEKCQ 173
           G+VIQELTYLELRKRNWRYHKTLK WLTKDP MEPVV+ D +SERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQ 180

Query: 174 RDFVLHYNAIM 184
           R+F+L YNAIM
Sbjct: 181 REFLLFYNAIM 191

>KAFR0B00850 Chr2 complement(160852..161430) [579 bp, 192 aa] {ON}
           Anc_7.347 YDL165W
          Length = 192

 Score =  268 bits (684), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 126/192 (65%), Positives = 152/192 (79%), Gaps = 8/192 (4%)

Query: 1   MEKYGLKDLVPVLRHDPT------YDANMTLGIDLNSLLNSLDITKDTKSHHCLDAFESP 54
           M+K+GLK L+P+++ DP       YD +MTLG DL+S+L SL I +D + H  LD F+SP
Sbjct: 1   MDKFGLKALIPLIKQDPQGEKNGQYDHSMTLGADLSSMLYSLGIPRDKQHHRVLDTFQSP 60

Query: 55  WVETSRSEVQPTFFIPESFKNIKGMLGTDQVE--FTSVNRDQPRISLLQDETLFYLFYKH 112
           W ETSRSEV+P F IP+SF NI  +L ++     F S+  DQ R++L QDETLFYLFYKH
Sbjct: 61  WAETSRSEVEPKFSIPDSFNNISNVLQSNVTPPCFDSIQNDQQRVALFQDETLFYLFYKH 120

Query: 113 PGSVIQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYVFFDPQRWEKC 172
           P +VIQELTYLELRKRNWRYHKTLK WLTKDPMMEP+V+QD +SE+GSYVFFDPQRWEKC
Sbjct: 121 PATVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSQDGLSEKGSYVFFDPQRWEKC 180

Query: 173 QRDFVLHYNAIM 184
           QRDF+L YNAIM
Sbjct: 181 QRDFLLFYNAIM 192

>CAGL0I03388g Chr9 (288784..289359) [576 bp, 191 aa] {ON} highly
           similar to uniprot|P06100 Saccharomyces cerevisiae
           YDL165w CDC36 transcription factor
          Length = 191

 Score =  266 bits (680), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 129/191 (67%), Positives = 150/191 (78%), Gaps = 7/191 (3%)

Query: 1   MEKYGLKDLVPVLRHD-----PTYDANMTLGIDLNSLLNSLDITKDTKSHHCLDAFESPW 55
           M K+GL+ LVP++R D       YD +MT+G DL+S+L+SL I +D+K H  LD F+SPW
Sbjct: 1   MSKFGLQKLVPLIRADEEKDGKVYDHSMTIGTDLSSMLHSLGIPRDSKHHRVLDTFQSPW 60

Query: 56  VETSRSEVQPTFFIPESFKNIKGML--GTDQVEFTSVNRDQPRISLLQDETLFYLFYKHP 113
            ETSRSEV+P ++IPESFKNI  +L   T    F  V  DQ R++L QDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPKYYIPESFKNIPDVLQSKTTPPTFDDVQTDQQRVALFQDETLFYLFYKHP 120

Query: 114 GSVIQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYVFFDPQRWEKCQ 173
           G+VIQELTYLELRKRNWRYHK LK WLTKDPMMEPVVA D +SERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLSERGSYVFFDPQRWEKCQ 180

Query: 174 RDFVLHYNAIM 184
           RDF L Y+AIM
Sbjct: 181 RDFPLFYSAIM 191

>KNAG0C03760 Chr3 complement(741798..742373) [576 bp, 191 aa] {ON}
           Anc_7.347 YDL165W
          Length = 191

 Score =  265 bits (677), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 129/191 (67%), Positives = 151/191 (79%), Gaps = 7/191 (3%)

Query: 1   MEKYGLKDLVPVLRH-DP----TYDANMTLGIDLNSLLNSLDITKDTKSHHCLDAFESPW 55
           M+K+GLK LVP++R  DP     YD +M LG DL+S+L+SL I +D+K    L  F+SPW
Sbjct: 1   MDKFGLKALVPLVRQGDPEVASKYDHSMALGADLSSMLHSLGIPRDSKRQAVLATFQSPW 60

Query: 56  VETSRSEVQPTFFIPESFKNIKGMLGTDQVE--FTSVNRDQPRISLLQDETLFYLFYKHP 113
            ETSRSEV+PTF+IP SF  I  +L ++     F SV RDQ R++L QDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPTFYIPASFLGIDEVLQSESTPPCFDSVQRDQQRVALFQDETLFYLFYKHP 120

Query: 114 GSVIQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYVFFDPQRWEKCQ 173
           G+VIQELTYLELRKRNWRYHKTLK WLTKDP MEPVV+ D +SERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPTMEPVVSPDGLSERGSYVFFDPQRWEKCQ 180

Query: 174 RDFVLHYNAIM 184
           RDF+L YNAIM
Sbjct: 181 RDFLLFYNAIM 191

>SAKL0F11308g Chr6 complement(882040..882615) [576 bp, 191 aa] {ON}
           highly similar to uniprot|P06100 Saccharomyces
           cerevisiae YDL165W CDC36 Component of the CCR4-NOT
           complex which has multiple roles in regulating mRNA
           levels including regulation of transcription and
           destabilizing mRNAs by deadenylation basal transcription
           factor
          Length = 191

 Score =  264 bits (675), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 128/189 (67%), Positives = 152/189 (80%), Gaps = 5/189 (2%)

Query: 1   MEKYGLKDLVPVLRHD---PTYDANMTLGIDLNSLLNSLDITKDTK-SHHCLDAFESPWV 56
           +EKYGLK L+P+++ +     YD  MT+G+DL+S+L+SL I  + +     LD F SPWV
Sbjct: 3   VEKYGLKALLPLIKQETGNAEYDPAMTMGMDLSSMLHSLGIDSNQEYKTRVLDTFPSPWV 62

Query: 57  ETSRSEVQPTFFIPESFKNIKGMLGT-DQVEFTSVNRDQPRISLLQDETLFYLFYKHPGS 115
           ETSRSEV+P FF PESF NI  +L +     F SV +D P+I+L QDETLFYLFYKHPG+
Sbjct: 63  ETSRSEVEPKFFTPESFVNIPNVLQSPSPPSFNSVQQDHPKIALFQDETLFYLFYKHPGT 122

Query: 116 VIQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYVFFDPQRWEKCQRD 175
           V+QE+TYLELRKRNWRYHKTLKVWLTKDPMMEPVV+QD +SERGSYVFFDPQRWEKCQRD
Sbjct: 123 VVQEITYLELRKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSERGSYVFFDPQRWEKCQRD 182

Query: 176 FVLHYNAIM 184
           FVL YNAIM
Sbjct: 183 FVLFYNAIM 191

>Kpol_530.34 s530 (82095..82670) [576 bp, 191 aa] {ON}
           (82095..82670) [576 nt, 192 aa]
          Length = 191

 Score =  262 bits (669), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 152/191 (79%), Gaps = 7/191 (3%)

Query: 1   MEKYGLKDLVPVLRHDPT-----YDANMTLGIDLNSLLNSLDITKDTKSHHCLDAFESPW 55
           M+K+GL+ L+P+++ D T     Y+  MT+G DL+S+L+SL I +D + +  LD F+SPW
Sbjct: 1   MDKFGLEALLPLIKQDDTELSKKYNHAMTIGTDLSSMLHSLGIPRDNQRYRILDTFQSPW 60

Query: 56  VETSRSEVQPTFFIPESFKNIKGMLGTDQVE--FTSVNRDQPRISLLQDETLFYLFYKHP 113
            ETSRSEV+P FF PESFKNI  +L +      F S+  DQ R++L QDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPRFFTPESFKNIPNVLQSKVTPPVFNSIENDQQRVTLFQDETLFYLFYKHP 120

Query: 114 GSVIQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYVFFDPQRWEKCQ 173
           G+VIQELTYLELRKRNWRYHKTLK WLTKDPM+EP+V+ D +SERGSY+FFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMVEPLVSGDGLSERGSYIFFDPQRWEKCQ 180

Query: 174 RDFVLHYNAIM 184
           R+FVL YNAIM
Sbjct: 181 REFVLFYNAIM 191

>NCAS0A14130 Chr1 complement(2778386..2778961) [576 bp, 191 aa] {ON}
           Anc_7.347 YDL165W
          Length = 191

 Score =  261 bits (667), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 124/191 (64%), Positives = 148/191 (77%), Gaps = 7/191 (3%)

Query: 1   MEKYGLKDLVPVLRHD-----PTYDANMTLGIDLNSLLNSLDITKDTKSHHCLDAFESPW 55
           M+K+GLK LVP+LR D       YD +MTLG DL+S+++SL I +D   H  LD F+SPW
Sbjct: 1   MDKFGLKALVPLLRQDDKELSKPYDHSMTLGADLSSMIHSLGIPRDNTRHRVLDTFQSPW 60

Query: 56  VETSRSEVQPTFFIPESFKNIKGMLGTDQV--EFTSVNRDQPRISLLQDETLFYLFYKHP 113
            ETSRSEV+PTFFIP+SF  I G+L +      F S   DQ R++L QDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPTFFIPDSFVGISGVLQSPVTPPRFDSAQNDQQRVALFQDETLFYLFYKHP 120

Query: 114 GSVIQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYVFFDPQRWEKCQ 173
           G+V+QELTYLELR RNWRYH TL+ WLTKDP+MEP V+ D +SERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVLQELTYLELRNRNWRYHTTLRAWLTKDPLMEPEVSADGLSERGSYVFFDPQRWEKCQ 180

Query: 174 RDFVLHYNAIM 184
           +DF+L YNAIM
Sbjct: 181 KDFLLFYNAIM 191

>TPHA0F02940 Chr6 complement(648881..649456) [576 bp, 191 aa] {ON}
           Anc_7.347 YDL165W
          Length = 191

 Score =  250 bits (638), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 120/191 (62%), Positives = 144/191 (75%), Gaps = 7/191 (3%)

Query: 1   MEKYGLKDLVPVLRHD-----PTYDANMTLGIDLNSLLNSLDITKDTKSHHCLDAFESPW 55
           M+K+GL+ L+P+++ D       Y+  MT+G DL S+ +SL I  + K +  LD F+SPW
Sbjct: 1   MDKFGLEALLPLIKQDDPEFSKKYNHAMTIGADLTSIQHSLGIPNNNKRYRVLDTFQSPW 60

Query: 56  VETSRSEVQPTFFIPESFKNIKGMLGTDQVE--FTSVNRDQPRISLLQDETLFYLFYKHP 113
            ETSRSEV+P +F P+SF NI  +L +      F SV  DQ RISL QDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPRYFTPKSFTNIPKVLQSIDTPSVFNSVETDQQRISLFQDETLFYLFYKHP 120

Query: 114 GSVIQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYVFFDPQRWEKCQ 173
           G+VIQELTYLELRKRNWRYHK LK WLTKDP++EP+V  D  SERGSY+FFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKILKAWLTKDPIVEPIVTADGQSERGSYIFFDPQRWEKCQ 180

Query: 174 RDFVLHYNAIM 184
           RDFVL YNAIM
Sbjct: 181 RDFVLFYNAIM 191

>TBLA0E00510 Chr5 complement(93705..94568) [864 bp, 287 aa] {ON}
           Anc_7.347 YDL165W
          Length = 287

 Score =  249 bits (636), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 115/167 (68%), Positives = 134/167 (80%), Gaps = 2/167 (1%)

Query: 20  DANMTLGIDLNSLLNSLDITKDTKSHHCLDAFESPWVETSRSEVQPTFFIPESFKNIKGM 79
           D ++T+G DL+S+L+SL + +D K H  LD F+SPW ETSRSEVQP FFIP SF NI  +
Sbjct: 121 DHSLTIGADLSSMLHSLGLPRDNKRHRILDTFQSPWAETSRSEVQPRFFIPSSFSNISNV 180

Query: 80  L--GTDQVEFTSVNRDQPRISLLQDETLFYLFYKHPGSVIQELTYLELRKRNWRYHKTLK 137
           L   T    F ++  DQ R++L QDETLFYLFYKHPG+VIQELTYLELRKRNWR+HK LK
Sbjct: 181 LQCNTTPPTFNNIELDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRFHKILK 240

Query: 138 VWLTKDPMMEPVVAQDSMSERGSYVFFDPQRWEKCQRDFVLHYNAIM 184
            WLTKDPMMEP+VA D  SERGSYVFFDPQRWEKCQR+F+L YNAIM
Sbjct: 241 TWLTKDPMMEPIVAADGFSERGSYVFFDPQRWEKCQREFILFYNAIM 287

>ZYRO0C16588g Chr3 (1293001..1294827) [1827 bp, 608 aa] {ON} highly
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072W NOT5 Subunit of global transcriptional regulator
          Length = 608

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 46/80 (57%), Gaps = 8/80 (10%)

Query: 103 ETLFYLFYKHPGSVIQELTYLELRK-RNWRYHKTLKVWLTKD-PMMEPVVAQDSMSERGS 160
           +TLF++FY + G+  Q L   EL K R W+++K  + W  K+   + P +AQ   SE  S
Sbjct: 522 DTLFFIFYHYQGTYEQFLAARELAKNRKWKFNKVDRCWYYKEVEKLPPGMAQ---SEEES 578

Query: 161 YVFFDPQR-W--EKCQRDFV 177
           + +FD QR W   +C  DF+
Sbjct: 579 WRYFDYQRSWLARRCNSDFI 598

>SAKL0B08052g Chr2 (688482..690212) [1731 bp, 576 aa] {ON} highly
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072W NOT5 Subunit of global transcriptional regulator
          Length = 576

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 6/81 (7%)

Query: 103 ETLFYLFYKHPGSVIQELTYLEL-RKRNWRYHKTLKVWLTKDPMMEP--VVAQDSMSERG 159
           +TLF++FY + G+  Q L   EL + RNW+++K    W  K+    P  VV+ ++  E  
Sbjct: 487 DTLFFIFYHYQGTYEQFLAARELSQNRNWQFNKLNHCWFYKEVEKLPPGVVSSENKQEEI 546

Query: 160 SYVFFDPQR-W--EKCQRDFV 177
           S+ +FD Q+ W   +C  DFV
Sbjct: 547 SWRYFDYQKSWLARRCGSDFV 567

>KAFR0H00860 Chr8 complement(158881..160617) [1737 bp, 578 aa] {ON}
           Anc_3.370 YPR072W
          Length = 578

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 47/79 (59%), Gaps = 6/79 (7%)

Query: 103 ETLFYLFYKHPGSVIQELTYLELRK-RNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSY 161
           +TLF++FY + G+  Q L+  EL K RNW+++K  + W  K+  +E +    + SE  S+
Sbjct: 493 DTLFFIFYHYQGTYEQFLSSRELNKNRNWQFNKVDRCWYYKE--IEKLPPGMNKSEEESW 550

Query: 162 VFFDPQR-W--EKCQRDFV 177
            +FD ++ W   +C  DFV
Sbjct: 551 RYFDYKKSWLARRCSPDFV 569

>NDAI0A05080 Chr1 complement(1154530..1156257) [1728 bp, 575 aa]
           {ON} Anc_3.370
          Length = 575

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 43/79 (54%), Gaps = 4/79 (5%)

Query: 103 ETLFYLFYKHPGSVIQELTYLELRK-RNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSY 161
           +TLF++FY + G+  Q L   EL K R+W+Y+K    W  K+    P  A  +  E  S+
Sbjct: 488 DTLFFIFYHYQGTYDQFLASRELSKNRDWKYNKVDYCWYYKEIEKLPPGANYNKDEEESW 547

Query: 162 VFFDPQR-W--EKCQRDFV 177
            +FD ++ W   +C  DFV
Sbjct: 548 RYFDYKKSWLSRRCGNDFV 566

>Kwal_23.3962 s23 complement(502287..503948) [1662 bp, 553 aa] {ON}
           YPR072W (NOT5) - member of the NOT complex, a global
           negative regulator of transcription [contig 255] FULL
          Length = 553

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 103 ETLFYLFYKHPGSVIQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYV 162
           +TLF++FY + G+  Q L   EL  R W+++K  + W  K+  +E +      SE  S+ 
Sbjct: 469 DTLFFIFYHYQGTHEQFLAARELTMRGWQFNKVNRCWFYKE--VEKLPPGMEQSEEISWR 526

Query: 163 FFDPQR-W--EKCQRDFV 177
           +FD Q+ W   +C  DFV
Sbjct: 527 YFDYQKSWLARRCGTDFV 544

>CAGL0D01342g Chr4 complement(149562..151208) [1647 bp, 548 aa] {ON}
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072w NOT5
          Length = 548

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 45/79 (56%), Gaps = 6/79 (7%)

Query: 103 ETLFYLFYKHPGSVIQELTYLELRK-RNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSY 161
           +TLF++FY + G+  Q L   EL K RNW+++K  + W  K+  +E +    + SE  S+
Sbjct: 463 DTLFFIFYHYQGTYEQFLAARELAKIRNWQFNKKDRCWYYKE--IEKLPPGMTKSEEESW 520

Query: 162 VFFD-PQRW--EKCQRDFV 177
            +FD  + W   +C  DFV
Sbjct: 521 RYFDFKKSWLSRRCGSDFV 539

>TPHA0A03500 Chr1 complement(769721..771367) [1647 bp, 548 aa] {ON}
           Anc_3.370 YPR072W
          Length = 548

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 44/79 (55%), Gaps = 8/79 (10%)

Query: 103 ETLFYLFYKHPGSVIQELTYLELRK-RNWRYHKTLKVWLTKD-PMMEPVVAQDSMSERGS 160
           +TLF++FY + G+  Q L   EL K RNW+Y+K  + W  K+     P +AQ   +E  +
Sbjct: 463 DTLFFIFYHYQGTYEQFLVARELSKCRNWKYNKVDRNWYFKEVTKSAPDMAQ---TEEET 519

Query: 161 YVFFDPQR-W--EKCQRDF 176
           + +FD Q  W   +C  DF
Sbjct: 520 WRYFDYQNSWLARRCNHDF 538

>KLTH0F11880g Chr6 complement(1000583..1002274) [1692 bp, 563 aa]
           {ON} highly similar to uniprot|Q12514 Saccharomyces
           cerevisiae YPR072W NOT5 Subunit of global
           transcriptional regulator
          Length = 563

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 103 ETLFYLFYKHPGSVIQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYV 162
           +TLF++FY + G+  Q L+  EL  R W+++K  + W  K+  +E +      SE  S+ 
Sbjct: 479 DTLFFIFYHYQGTYEQFLSARELSIRGWQFNKVNRCWFYKE--VEKLPPGMEQSEEISWR 536

Query: 163 FFDPQR-W--EKCQRDFV 177
           +FD Q+ W   +C  +FV
Sbjct: 537 YFDYQKSWLARRCGAEFV 554

>Smik_16.316 Chr16 (567157..568839) [1683 bp, 560 aa] {ON} YPR072W
           (REAL)
          Length = 560

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 44/79 (55%), Gaps = 6/79 (7%)

Query: 103 ETLFYLFYKHPGSVIQELTYLELRK-RNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSY 161
           +TLF++FY + GS  Q L   EL K RNW ++K  + W  K+  +E +      SE  S+
Sbjct: 475 DTLFFIFYHYQGSYEQFLAARELYKNRNWLFNKVDRCWYYKE--IEKLPPGMGKSEEESW 532

Query: 162 VFFDPQR-W--EKCQRDFV 177
            +FD ++ W   +C  DFV
Sbjct: 533 RYFDYKKSWLARRCGNDFV 551

>YPR072W Chr16 (690107..691789) [1683 bp, 560 aa] {ON}  NOT5Subunit
           of the CCR4-NOT complex, which is a global
           transcriptional regulator with roles in transcription
           initiation and elongation and in mRNA degradation
          Length = 560

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 44/79 (55%), Gaps = 6/79 (7%)

Query: 103 ETLFYLFYKHPGSVIQELTYLEL-RKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSY 161
           +TLF++FY + GS  Q L   EL + RNW ++K  + W  K+  +E +      SE  S+
Sbjct: 475 DTLFFIFYHYQGSYEQFLAARELFKNRNWLFNKVDRCWYYKE--IEKLPPGMGKSEEESW 532

Query: 162 VFFDPQR-W--EKCQRDFV 177
            +FD ++ W   +C  DFV
Sbjct: 533 RYFDYKKSWLARRCGNDFV 551

>Kpol_1006.7 s1006 (30700..32322) [1623 bp, 540 aa] {ON}
           (30700..32322) [1623 nt, 541 aa]
          Length = 540

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 42/78 (53%), Gaps = 6/78 (7%)

Query: 103 ETLFYLFYKHPGSVIQELTYLELRK-RNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSY 161
           +TLF++FY + G+  Q L   EL K RNW+++K  + W  K+    P   Q   +E  ++
Sbjct: 455 DTLFFIFYHYQGTYEQFLVARELAKHRNWKFNKINRNWYYKEVTKSPPGMQ--QAEEETW 512

Query: 162 VFFDPQR-W--EKCQRDF 176
            +FD Q  W   +C  DF
Sbjct: 513 RYFDYQNSWLARRCNSDF 530

>Skud_16.361 Chr16 (655247..656929) [1683 bp, 560 aa] {ON} YPR072W
           (REAL)
          Length = 560

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 45/81 (55%), Gaps = 6/81 (7%)

Query: 103 ETLFYLFYKHPGSVIQELTYLELRK-RNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSY 161
           +TLF++FY + GS  Q L   EL K RNW +++  + W  K+  +E +      SE  S+
Sbjct: 475 DTLFFIFYHYQGSYEQFLAARELYKNRNWLFNRVDRCWYYKE--IEKLPPGMGKSEEESW 532

Query: 162 VFFDPQR-W--EKCQRDFVLH 179
            +FD ++ W   +C  DFV +
Sbjct: 533 RYFDYKKSWLARRCGNDFVYN 553

>Suva_16.401 Chr16 (697328..699025) [1698 bp, 565 aa] {ON} YPR072W
           (REAL)
          Length = 565

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 45/81 (55%), Gaps = 6/81 (7%)

Query: 103 ETLFYLFYKHPGSVIQELTYLELRK-RNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSY 161
           +TLF++FY + GS  Q L   EL K RNW +++  + W  K+  +E +      SE  S+
Sbjct: 480 DTLFFIFYHYQGSYEQFLAARELYKNRNWLFNRVDRCWYYKE--IEKLPPGMGKSEEESW 537

Query: 162 VFFDPQR-W--EKCQRDFVLH 179
            +FD ++ W   +C  DFV +
Sbjct: 538 RYFDYKKSWLARRCGNDFVYN 558

>KNAG0A07290 Chr1 (1139630..1141153) [1524 bp, 507 aa] {ON}
           Anc_3.370 YPR072W
          Length = 507

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 45/79 (56%), Gaps = 6/79 (7%)

Query: 103 ETLFYLFYKHPGSVIQELTYLELR-KRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSY 161
           +TLF++FY + G+  Q L   EL   R+W+++K  + W  K+  +E +    + SE  S+
Sbjct: 422 DTLFFIFYHYQGTYEQFLAARELSINRDWQFNKKDRCWYYKE--IEKLPPGMNKSEEESW 479

Query: 162 VFFDPQR-W--EKCQRDFV 177
            +FD ++ W   +C  DFV
Sbjct: 480 RYFDYKKSWLARRCNSDFV 498

>TBLA0H01490 Chr8 complement(331583..333241) [1659 bp, 552 aa] {ON}
           Anc_3.370 YPR072W
          Length = 552

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 45/79 (56%), Gaps = 8/79 (10%)

Query: 103 ETLFYLFYKHPGSVIQELTYLELRK-RNWRYHKTLKVWLTKD-PMMEPVVAQDSMSERGS 160
           +TLF++FY + G+  Q L+  EL K RNW ++K  + W  ++   + P + Q   SE  S
Sbjct: 466 DTLFFIFYHYQGTYDQFLSARELAKNRNWEFNKVDRRWYYREVEKLPPGLPQ---SEEIS 522

Query: 161 YVFFDPQR-W--EKCQRDF 176
           + +FD Q+ W   +C  +F
Sbjct: 523 WRYFDYQKSWLSRRCNSNF 541

>Ecym_3456 Chr3 complement(853907..855433) [1527 bp, 508 aa] {ON}
           similar to Ashbya gossypii ADL364C
          Length = 508

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 56/117 (47%), Gaps = 9/117 (7%)

Query: 64  QPTFFIPESFKNIKGMLGTDQVEFTSVNRDQPRISLLQDETLFYLFYKHPGSVIQELTYL 123
           +P  F+  +  N  G +  D    TS+ +   +  L   +TLF++FY + G+  Q L   
Sbjct: 389 EPIRFVTTTL-NSSGTITNDIYGKTSMAQILTKFDL---DTLFFIFYHYQGTYEQFLAAR 444

Query: 124 ELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYVFFDPQR-W--EKCQRDFV 177
           EL  R W +++  + W  ++  +E +       E  S+ +FD Q+ W   +C  DFV
Sbjct: 445 ELNIRGWLFNRVNRCWFYRE--VEKLPPGMEQKEEVSWRYFDYQKSWLARRCGPDFV 499

>ADL364C Chr4 complement(66072..67586) [1515 bp, 504 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR072W
           (NOT5)
          Length = 504

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 41/80 (51%), Gaps = 5/80 (6%)

Query: 103 ETLFYLFYKHPGSVIQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYV 162
           +TLF++FY + G+  Q L   EL  R W +++  + W  K+  +E +       E  S+ 
Sbjct: 420 DTLFFIFYHYQGTYDQFLAARELIIRGWIFNRVNRCWFYKE--VEKLPPGMDQKEEVSWR 477

Query: 163 FFDPQR-W--EKCQRDFVLH 179
           +FD Q+ W   +C  DFV  
Sbjct: 478 YFDYQKSWLARRCGPDFVFR 497

>TDEL0C05120 Chr3 (917832..919520) [1689 bp, 562 aa] {ON} Anc_3.370
           YPR072W
          Length = 562

 Score = 37.0 bits (84), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 43/80 (53%), Gaps = 8/80 (10%)

Query: 103 ETLFYLFYKHPGSVIQELTYLELRK-RNWRYHKTLKVWLTKD-PMMEPVVAQDSMSERGS 160
           +TLF++FY + G+  Q L   EL K R W+++K  + W  K+   + P + Q   +E  S
Sbjct: 476 DTLFFIFYHYQGTYDQFLAARELSKNRKWKFNKIDRCWYYKEVEKLPPGMLQ---AEEES 532

Query: 161 YVFFDPQ-RW--EKCQRDFV 177
           + +FD Q  W   +C  D V
Sbjct: 533 WRYFDYQGSWLARRCNNDVV 552

>KLLA0B09196g Chr2 complement(803259..805031) [1773 bp, 590 aa] {ON}
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072W NOT5 Subunit of global transcriptional regulator
          Length = 590

 Score = 36.6 bits (83), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 35/66 (53%), Gaps = 2/66 (3%)

Query: 103 ETLFYLFYKHPGSVIQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYV 162
           +TLF++FY + GS  Q L   EL  R W ++K  + W  K+  +E +       E  ++ 
Sbjct: 505 DTLFFIFYHYQGSYDQFLASRELSLRGWTFNKVNRCWFHKE--VEKLPPGIEGKEEVTWR 562

Query: 163 FFDPQR 168
           +FD Q+
Sbjct: 563 YFDYQK 568

>ZYRO0F16500g Chr6 (1355819..1359412) [3594 bp, 1197 aa] {ON}
           similar to uniprot|P53120 Saccharomyces cerevisiae
           YGL140C Hypothetical ORF
          Length = 1197

 Score = 35.4 bits (80), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 64/139 (46%), Gaps = 25/139 (17%)

Query: 39  TKDTKSHHCLDAFESPWVETSRSEVQPTFFIP--ESFKN----IKGMLGTDQVEFTSVNR 92
           T  T  H C+        E S S V PT   P  E+FK+    I G++   Q+EFT ++R
Sbjct: 267 TCSTVLHECI-------YEISYSYVSPTQLKPIIETFKSCSMYINGLINACQLEFTLLSR 319

Query: 93  DQPR----ISLLQDETLFYLFYKHPGSVIQELTYLELRKRNWRYHKTL--KVWLTKDPMM 146
           D+ R    + +  D+ + Y  ++    V++     +LR   +  HK L   V+LTK  ++
Sbjct: 320 DENREGDLLQIKTDKEIAYAHFERFDRVLR-----KLRPSIYNLHKILSESVYLTK-ILL 373

Query: 147 EPVVAQDSMSERGSYVFFD 165
                 D    +GS +F D
Sbjct: 374 AHAYDVDLSRAKGSEIFKD 392

>KLTH0A03652g Chr1 (314336..316654) [2319 bp, 772 aa] {ON} some
           similarities with uniprot|P06102 Saccharomyces
           cerevisiae YIL038C NOT3 Subunit of the CCR4-NOT complex
           which is a global transcriptional regulator with roles
           in transcription initiation and elongation and in mRNA
           degradation
          Length = 772

 Score = 34.7 bits (78), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%)

Query: 105 LFYLFYKHPGSVIQELTYLELRKRNWRYHKTLKVWLTK 142
           LFY FY     + QE+ Y  L +RNW+  KT + W ++
Sbjct: 667 LFYCFYYSITPLEQEIAYTLLGERNWKVSKTGENWFSR 704

>Kpol_1070.25 s1070
           complement(58286..59491,59501..59509,59592..60437) [2061
           bp, 686 aa] {ON}
           complement(58286..59491,59501..59509,59592..60437) [2061
           nt, 687 aa]
          Length = 686

 Score = 34.7 bits (78), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 43/82 (52%), Gaps = 4/82 (4%)

Query: 104 TLFYLFYKHPGSVIQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYVF 163
           TLFY +Y     + ++++ + L +R+W+  K   +W  K    EP  + +S  E G+Y  
Sbjct: 564 TLFYHYYFPLTPLQKQISSILLIERDWKLLKNGTMWFLK--QGEPKFSNESF-EVGNYKI 620

Query: 164 FDPQRWEKCQR-DFVLHYNAIM 184
           F    W   ++ +F L +N++M
Sbjct: 621 FKADDWTVIEKFNFKLDFNSLM 642

>TDEL0H02330 Chr8 complement(391361..393799) [2439 bp, 812 aa] {ON}
           Anc_7.214 YIL038C
          Length = 812

 Score = 33.5 bits (75), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 37/81 (45%), Gaps = 4/81 (4%)

Query: 104 TLFYLFYKHPGSVIQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYVF 163
           TLFY +Y     + Q +  L L +RNW+  K+  +W  +    EP  A + + E   Y  
Sbjct: 692 TLFYNYYFAVTPLEQTIASLVLSERNWKVSKSGTLWFLR--QGEPKFANE-VCEVADYKI 748

Query: 164 FDPQRWEKCQR-DFVLHYNAI 183
           F    W    + +F L Y A+
Sbjct: 749 FKLDDWTVADKPNFKLDYAAL 769

>NCAS0A11210 Chr1 (2223815..2225563) [1749 bp, 582 aa] {ON}
           Anc_3.370 YPR072W
          Length = 582

 Score = 33.1 bits (74), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 47/93 (50%), Gaps = 16/93 (17%)

Query: 103 ETLFYLFYKHPGSVIQELTYLEL-RKRNWRYHKTLKVWLTKD-PMMEPVVA--------- 151
           +TLF++FY + G+  Q L   EL + R+W ++K    W  ++   + P +          
Sbjct: 483 DTLFFIFYHYQGTYDQFLAARELSQNRHWLFNKVDSCWYFREIEKLPPTINMSNTIPNNK 542

Query: 152 -QDSMS-ERGSYVFFDPQR-W--EKCQRDFVLH 179
            +DS S E  S+ +FD ++ W   +C  DFV H
Sbjct: 543 REDSNSDEEESWRYFDYKKSWLARRCGPDFVYH 575

>NDAI0A02690 Chr1 complement(603611..606151) [2541 bp, 846 aa] {ON}
           Anc_7.214
          Length = 846

 Score = 32.7 bits (73), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 38/81 (46%), Gaps = 4/81 (4%)

Query: 104 TLFYLFYKHPGSVIQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYVF 163
           TLFY +Y     + +E+  + L +RNW+      +W  +     P+  Q+ + E G Y  
Sbjct: 719 TLFYNYYFAVTPLEKEIANVILNERNWKVSFDETMWFLR---QGPIKFQNELCELGDYKI 775

Query: 164 FDPQRWEKCQR-DFVLHYNAI 183
           F    W    + +F L Y+++
Sbjct: 776 FKLDEWLVVDKINFKLDYSSL 796

>ZYRO0D16302g Chr4 (1357223..1359712) [2490 bp, 829 aa] {ON} similar
           to uniprot|P06102 Saccharomyces cerevisiae YIL038C NOT3
           Subunit of the CCR4-NOT complex which is a global
           transcriptional regulator with roles in transcription
           initiation and elongation and in mRNA degradation
          Length = 829

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 36/81 (44%), Gaps = 4/81 (4%)

Query: 104 TLFYLFYKHPGSVIQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYVF 163
           TLFY +Y     + QE+  + L +R+W+  K   +W  +    E   A + + E   Y  
Sbjct: 712 TLFYNYYFAVTPLEQEIASIILSERDWKVSKNCAMWFLR--QSETKFANE-LCEVADYKI 768

Query: 164 FDPQRWEKCQR-DFVLHYNAI 183
           F    W    R +F L Y A+
Sbjct: 769 FKLDDWTVIDRLNFKLDYAAL 789

>NCAS0A13350 Chr1 (2627917..2630319) [2403 bp, 800 aa] {ON}
           Anc_7.214 YIL038C
          Length = 800

 Score = 31.2 bits (69), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 37/81 (45%), Gaps = 4/81 (4%)

Query: 104 TLFYLFYKHPGSVIQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYVF 163
           TLFY +Y     + +E++ + L +R+WR  K   +W  +      V  Q+   E G Y  
Sbjct: 671 TLFYNYYFAVTPLEKEISNVILNERSWRISKDETLWFLR---QGSVKLQNEFCEIGDYKI 727

Query: 164 FDPQRWEKCQR-DFVLHYNAI 183
           F    W    + +F L Y+ +
Sbjct: 728 FKLDDWTVIDKINFKLDYSNL 748

>KNAG0E02230 Chr5 complement(449921..452515) [2595 bp, 864 aa] {ON}
           Anc_2.413 YMR125W
          Length = 864

 Score = 30.4 bits (67), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 5/58 (8%)

Query: 28  DLNSLLNSLDITKDTKSHHCLDAFESPWVETSRSEVQPTFFIPESFKNIKGMLGTDQV 85
           DL +L NSL I +  K    ++A  S W     S  Q  F I ++FK   GM+ ++ +
Sbjct: 666 DLKTLFNSLQIDESVKETAIIEAVMSYW----NSNSQNGFLIVDAFK-FGGMVSSNSI 718

>Skud_12.251 Chr12 (470293..471051) [759 bp, 252 aa] {ON} YLR186W
           (REAL)
          Length = 252

 Score = 29.6 bits (65), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 38/74 (51%), Gaps = 15/74 (20%)

Query: 44  SHHCL-DAFESP---------WVETSRS---EVQPTFFIPESFKNIKGMLGT--DQVEFT 88
           +H CL    +SP         +++TSR+   EV PT  IP +FK   G++     ++   
Sbjct: 92  THQCLLTLLDSPINKAGKLQVYIQTSRNILIEVNPTVRIPRTFKRFSGLMVQLLHKLSIR 151

Query: 89  SVNRDQPRISLLQD 102
           SVN ++  + ++++
Sbjct: 152 SVNSEEKLLKVIKN 165

>Kpol_2000.81 s2000 complement(181752..182510) [759 bp, 252 aa] {ON}
           complement(181752..182510) [759 nt, 253 aa]
          Length = 252

 Score = 29.6 bits (65), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 37/74 (50%), Gaps = 15/74 (20%)

Query: 44  SHHCL-DAFESP---------WVETSRS---EVQPTFFIPESFKNIKGMLGT--DQVEFT 88
           +H CL    +SP         +++TSR    EV PT  IP +FK   G++     ++   
Sbjct: 92  THQCLLTLLDSPINKAGKLQVYIQTSRGVLVEVNPTVRIPRTFKRFSGLMVQLLHKLSIR 151

Query: 89  SVNRDQPRISLLQD 102
           SVN ++  + ++++
Sbjct: 152 SVNSEEKLLKVIKN 165

>Smik_12.246 Chr12 (470597..471355) [759 bp, 252 aa] {ON} YLR186W
           (REAL)
          Length = 252

 Score = 29.6 bits (65), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 37/74 (50%), Gaps = 15/74 (20%)

Query: 44  SHHCL-DAFESP---------WVETSRS---EVQPTFFIPESFKNIKGMLGT--DQVEFT 88
           +H CL    +SP         +++TSR    EV PT  IP +FK   G++     ++   
Sbjct: 92  THQCLLTLLDSPINKAGKLQVYIQTSRGILIEVNPTVRIPRTFKRFSGLMVQLLHKLSIR 151

Query: 89  SVNRDQPRISLLQD 102
           SVN ++  + ++++
Sbjct: 152 SVNSEEKLLKVIKN 165

>Suva_10.282 Chr10 (496316..497074) [759 bp, 252 aa] {ON} YLR186W
           (REAL)
          Length = 252

 Score = 29.6 bits (65), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 37/74 (50%), Gaps = 15/74 (20%)

Query: 44  SHHCL-DAFESP---------WVETSRS---EVQPTFFIPESFKNIKGMLGT--DQVEFT 88
           +H CL    +SP         +++TSR    EV PT  IP +FK   G++     ++   
Sbjct: 92  THQCLLTLLDSPINKAGKLQVYIQTSRGILVEVNPTVRIPRTFKRFSGLMVQLLHKLSIR 151

Query: 89  SVNRDQPRISLLQD 102
           SVN ++  + ++++
Sbjct: 152 SVNSEEKLLKVIKN 165

>YLR186W Chr12 (523632..524390) [759 bp, 252 aa] {ON}  EMG1Member of
           the alpha/beta knot fold methyltransferase superfamily;
           required for maturation of 18S rRNA and for 40S ribosome
           production; interacts with RNA and with
           S-adenosylmethionine; associates with
           spindle/microtubules; forms homodimers; human ortholog
           is mutated in Bowen-Conradi syndrome
          Length = 252

 Score = 29.6 bits (65), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 37/74 (50%), Gaps = 15/74 (20%)

Query: 44  SHHCL-DAFESP---------WVETSRS---EVQPTFFIPESFKNIKGMLGT--DQVEFT 88
           +H CL    +SP         +++TSR    EV PT  IP +FK   G++     ++   
Sbjct: 92  THQCLLTLLDSPINKAGKLQVYIQTSRGILIEVNPTVRIPRTFKRFSGLMVQLLHKLSIR 151

Query: 89  SVNRDQPRISLLQD 102
           SVN ++  + ++++
Sbjct: 152 SVNSEEKLLKVIKN 165

>TPHA0B04640 Chr2 complement(1092893..1093654) [762 bp, 253 aa] {ON}
           Anc_1.64 YLR186W
          Length = 253

 Score = 29.6 bits (65), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 40/83 (48%), Gaps = 15/83 (18%)

Query: 44  SHHCL-DAFESP---------WVETSRS---EVQPTFFIPESFKNIKGMLGT--DQVEFT 88
           +H CL    +SP         +++TSR    EV PT  IP +FK   G++     ++   
Sbjct: 92  THQCLLTLLDSPINKAGKLQVYIQTSRGVLIEVNPTVRIPRTFKRFSGLMVQLLHKLSIR 151

Query: 89  SVNRDQPRISLLQDETLFYLFYK 111
           SVN ++  + ++++    +L  K
Sbjct: 152 SVNSEEKLLKVIKNPVTDHLPTK 174

>KLTH0F01958g Chr6 (154767..155525) [759 bp, 252 aa] {ON} highly
           similar to uniprot|Q06287 Saccharomyces cerevisiae
           YLR186W EMG1 Protein required for the maturation of the
           18S rRNA and for 40S ribosome production associated with
           spindle/microtubules nuclear localization depends on
           physical interaction with Nop14p may bind snoRNAs
          Length = 252

 Score = 29.3 bits (64), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 37/74 (50%), Gaps = 15/74 (20%)

Query: 44  SHHCL-DAFESP---------WVETSRS---EVQPTFFIPESFKNIKGMLGT--DQVEFT 88
           +H CL    +SP         +++TSR    EV PT  IP +FK   G++     ++   
Sbjct: 92  THQCLLTLLDSPINKAGKLQVYIQTSRGVLVEVNPTVRIPRTFKRFSGLMVQLLHKLSIR 151

Query: 89  SVNRDQPRISLLQD 102
           SVN ++  + ++++
Sbjct: 152 SVNSEEKLLKVIKN 165

>NCAS0A00500 Chr1 (78733..79491) [759 bp, 252 aa] {ON} Anc_1.64
          Length = 252

 Score = 29.3 bits (64), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 37/74 (50%), Gaps = 15/74 (20%)

Query: 44  SHHCL-DAFESP---------WVETSRS---EVQPTFFIPESFKNIKGMLGT--DQVEFT 88
           +H CL    +SP         +++TSR    EV PT  IP +FK   G++     ++   
Sbjct: 92  THQCLLTLLDSPINKAGKLQVYIQTSRGILIEVNPTVRIPRTFKRFSGLMVQLLHKLSIR 151

Query: 89  SVNRDQPRISLLQD 102
           SVN ++  + ++++
Sbjct: 152 SVNSEEKLLKVIKN 165

>KAFR0D04030 Chr4 complement(795277..796035) [759 bp, 252 aa] {ON}
           Anc_1.64 YLR186W
          Length = 252

 Score = 29.3 bits (64), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 37/74 (50%), Gaps = 15/74 (20%)

Query: 44  SHHCL-DAFESP---------WVETSRS---EVQPTFFIPESFKNIKGMLGT--DQVEFT 88
           +H CL    +SP         +++TSR    EV PT  IP +FK   G++     ++   
Sbjct: 92  THQCLLTLLDSPINKAGKLQVYIQTSRGVLVEVNPTVRIPRTFKRFSGLMVQLLHKLSIR 151

Query: 89  SVNRDQPRISLLQD 102
           SVN ++  + ++++
Sbjct: 152 SVNSEEKLLKVIKN 165

>Kwal_33.13289 s33 (159729..160487) [759 bp, 252 aa] {ON} YLR186W
           (EMG1) - Essential for Mitotic Growth [contig 119] FULL
          Length = 252

 Score = 29.3 bits (64), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 37/74 (50%), Gaps = 15/74 (20%)

Query: 44  SHHCL-DAFESP---------WVETSRS---EVQPTFFIPESFKNIKGMLGT--DQVEFT 88
           +H CL    +SP         +++TSR    EV PT  IP +FK   G++     ++   
Sbjct: 92  THQCLLTLLDSPINKAGKLQVYIQTSRGVLVEVNPTVRIPRTFKRFSGLMVQLLHKLSIR 151

Query: 89  SVNRDQPRISLLQD 102
           SVN ++  + ++++
Sbjct: 152 SVNSEEKLLKVIKN 165

>TBLA0D04270 Chr4 complement(1055025..1057568) [2544 bp, 847 aa]
           {ON} Anc_7.214 YIL038C
          Length = 847

 Score = 29.6 bits (65), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 31/66 (46%), Gaps = 3/66 (4%)

Query: 104 TLFYLFYKHPGSVIQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYVF 163
           TLFY +Y     + +E++ + L +R+WR      +W ++    +     D + E G Y  
Sbjct: 725 TLFYNYYFSVTPLEKEVSMVVLAERDWRITNNETMWFSRQGEAK---LSDELYEIGDYRI 781

Query: 164 FDPQRW 169
           F  + W
Sbjct: 782 FSLEDW 787

>TDEL0C06380 Chr3 complement(1167515..1168273) [759 bp, 252 aa] {ON}
           Anc_1.64 YLR186W
          Length = 252

 Score = 29.3 bits (64), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 37/74 (50%), Gaps = 15/74 (20%)

Query: 44  SHHCL-DAFESP---------WVETSRS---EVQPTFFIPESFKNIKGMLGT--DQVEFT 88
           +H CL    +SP         +++TSR    EV PT  IP +FK   G++     ++   
Sbjct: 92  THQCLLTLLDSPINKAGKLQVYIQTSRGVLIEVNPTVRIPRTFKRFSGLMVQLLHKLSIR 151

Query: 89  SVNRDQPRISLLQD 102
           SVN ++  + ++++
Sbjct: 152 SVNSEEKLLKVIKN 165

>KAFR0I00220 Chr9 (45560..47860) [2301 bp, 766 aa] {ON} Anc_7.16
           YOR365C
          Length = 766

 Score = 29.3 bits (64), Expect = 6.5,   Method: Composition-based stats.
 Identities = 15/34 (44%), Positives = 21/34 (61%)

Query: 85  VEFTSVNRDQPRISLLQDETLFYLFYKHPGSVIQ 118
           V F SV     R ++L+D T FY + KH GS+I+
Sbjct: 369 VTFKSVLELLTRANVLKDTTNFYQYRKHWGSIIK 402

>TPHA0C01290 Chr3 complement(294072..296432) [2361 bp, 786 aa] {ON}
           Anc_7.214 YIL038C
          Length = 786

 Score = 29.3 bits (64), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 37/82 (45%), Gaps = 4/82 (4%)

Query: 104 TLFYLFYKHPGSVIQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYVF 163
           TLFY FY    S+ +++    L +RNW       +W  +   ++     +  SE   Y  
Sbjct: 668 TLFYNFYFSVTSMERDIAAKILVERNWIQLSNGVMWFLRQGNIK---FANENSEVADYKI 724

Query: 164 FDPQRWEKCQR-DFVLHYNAIM 184
           F    W   ++ +F L Y++IM
Sbjct: 725 FKADDWTVVEKLNFKLDYDSIM 746

>KLLA0E04335g Chr5 (391816..394092) [2277 bp, 758 aa] {ON} similar
           to uniprot|Q75AN0 Ashbya gossypii ADL108C ADL108Cp and
           some similarites with YIL038C uniprot|P06102
           Saccharomyces cerevisiae YIL038C NOT3 Subunit of the
           CCR4- NOT complex which is a global transcriptional
           regulator with roles in transcription initiation and
           elongation and in mRNA degradation
          Length = 758

 Score = 29.3 bits (64), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 19/36 (52%)

Query: 104 TLFYLFYKHPGSVIQELTYLELRKRNWRYHKTLKVW 139
           TLFY +Y     + Q +  L L++R WR  KT   W
Sbjct: 641 TLFYHYYFSVTPLEQRICALLLKQREWRVLKTGDCW 676

>TDEL0C05380 Chr3 (960131..967246) [7116 bp, 2371 aa] {ON} Anc_3.401
            YBR136W
          Length = 2371

 Score = 28.9 bits (63), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 34/74 (45%), Gaps = 3/74 (4%)

Query: 78   GMLGTDQVEFTSVNRDQPRISLLQDETLFYLFYKHPGSVIQELTYLELRKRNWRYHKTLK 137
            G LGT     + + RD  R+ L  +  +  L Y HP + ++    L  +  N R  K ++
Sbjct: 1687 GDLGTTFFNLSRLCRDSSRLDLASESLMHCLQYNHPQTELEFAEILLKQGENDRAVKLVR 1746

Query: 138  VWLTK---DPMMEP 148
                K   DPM++P
Sbjct: 1747 EINEKYKDDPMLKP 1760

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 21,025,898
Number of extensions: 875435
Number of successful extensions: 2185
Number of sequences better than 10.0: 73
Number of HSP's gapped: 2171
Number of HSP's successfully gapped: 73
Length of query: 184
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 81
Effective length of database: 41,670,801
Effective search space: 3375334881
Effective search space used: 3375334881
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 62 (28.5 bits)