Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D12364g7.349ON63163129580.0
Kwal_56.246387.349ON52762412761e-170
ZYRO0F11682g7.349ON59764912721e-168
KLTH0H01276g7.349ON55764312471e-165
TDEL0C019907.349ON60666912081e-158
NCAS0A141507.349ON57053711881e-156
ACL149W7.349ON62839911071e-143
SAKL0F11352g7.349ON58340010941e-141
Skud_4.907.349ON70740110591e-135
TBLA0E020607.349ON56439810441e-134
Smik_4.717.349ON75940010551e-133
YDL167C (NRP1)7.349ON71940510521e-133
Suva_4.797.349ON70841010401e-132
Kpol_530.327.349ON68441310101e-128
KNAG0C037807.349ON5384089791e-125
KAFR0B008707.349ON5423979681e-123
NDAI0A019007.349ON5653947212e-86
CAGL0I03344g7.349ON6033865843e-66
TPHA0F029607.349ON654311823e-13
KLLA0B08976g3.379ON30536810.27
CAGL0D05236g7.188ON44375761.3
Ecym_54192.167ON21583751.3
NDAI0F027202.167ON22633741.6
NCAS0G025802.167ON22430722.6
KNAG0J003608.822ON44067733.1
TDEL0A009402.52ON68231724.2
NCAS0G042801.408ON43528706.3
SAKL0H11330g8.491ON69734708.6
KNAG0F011202.52ON63531698.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D12364g
         (631 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D12364g Chr4 complement(1051765..1053660) [1896 bp, 631 aa]...  1144   0.0  
Kwal_56.24638 s56 (1083888..1085471) [1584 bp, 527 aa] {ON} YDL1...   496   e-170
ZYRO0F11682g Chr6 (956534..958327) [1794 bp, 597 aa] {ON} some s...   494   e-168
KLTH0H01276g Chr8 complement(122337..124010) [1674 bp, 557 aa] {...   484   e-165
TDEL0C01990 Chr3 complement(345897..347717) [1821 bp, 606 aa] {O...   469   e-158
NCAS0A14150 Chr1 (2780086..2781798) [1713 bp, 570 aa] {ON} Anc_7...   462   e-156
ACL149W Chr3 (88715..90601) [1887 bp, 628 aa] {ON} Syntenic homo...   431   e-143
SAKL0F11352g Chr6 (883590..885341) [1752 bp, 583 aa] {ON} some s...   426   e-141
Skud_4.90 Chr4 complement(156704..158827) [2124 bp, 707 aa] {ON}...   412   e-135
TBLA0E02060 Chr5 (502492..504186) [1695 bp, 564 aa] {ON} Anc_7.3...   406   e-134
Smik_4.71 Chr4 complement(137635..139914) [2280 bp, 759 aa] {ON}...   410   e-133
YDL167C Chr4 complement(160995..163154) [2160 bp, 719 aa] {ON}  ...   409   e-133
Suva_4.79 Chr4 complement(148569..150695) [2127 bp, 708 aa] {ON}...   405   e-132
Kpol_530.32 s530 complement(78552..80606) [2055 bp, 684 aa] {ON}...   393   e-128
KNAG0C03780 Chr3 (743477..745093) [1617 bp, 538 aa] {ON} Anc_7.3...   381   e-125
KAFR0B00870 Chr2 (162698..164326) [1629 bp, 542 aa] {ON} Anc_7.3...   377   e-123
NDAI0A01900 Chr1 complement(426743..428440) [1698 bp, 565 aa] {O...   282   2e-86
CAGL0I03344g Chr9 complement(285637..287448) [1812 bp, 603 aa] {...   229   3e-66
TPHA0F02960 Chr6 (651108..653072) [1965 bp, 654 aa] {ON} Anc_7.3...    75   3e-13
KLLA0B08976g Chr2 complement(786122..787039) [918 bp, 305 aa] {O...    36   0.27 
CAGL0D05236g Chr4 (499006..500337) [1332 bp, 443 aa] {ON} weakly...    34   1.3  
Ecym_5419 Chr5 (864517..865164) [648 bp, 215 aa] {ON} similar to...    33   1.3  
NDAI0F02720 Chr6 (668516..669196) [681 bp, 226 aa] {ON} Anc_2.167      33   1.6  
NCAS0G02580 Chr7 complement(461003..461677) [675 bp, 224 aa] {ON...    32   2.6  
KNAG0J00360 Chr10 (56847..58169) [1323 bp, 440 aa] {ON} Anc_8.82...    33   3.1  
TDEL0A00940 Chr1 complement(156781..158829) [2049 bp, 682 aa] {O...    32   4.2  
NCAS0G04280 Chr7 (796093..797400) [1308 bp, 435 aa] {ON} Anc_1.408     32   6.3  
SAKL0H11330g Chr8 (972836..974929) [2094 bp, 697 aa] {ON} simila...    32   8.6  
KNAG0F01120 Chr6 complement(199529..201436) [1908 bp, 635 aa] {O...    31   8.7  

>KLLA0D12364g Chr4 complement(1051765..1053660) [1896 bp, 631 aa]
           {ON} some similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 631

 Score = 1144 bits (2958), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 555/631 (87%), Positives = 555/631 (87%)

Query: 1   MFYVLFECETVYSEEAPKDHTMISSIAYQIISVETLKPIWEEARRHSIDATHSLKNTIQS 60
           MFYVLFECETVYSEEAPKDHTMISSIAYQIISVETLKPIWEEARRHSIDATHSLKNTIQS
Sbjct: 1   MFYVLFECETVYSEEAPKDHTMISSIAYQIISVETLKPIWEEARRHSIDATHSLKNTIQS 60

Query: 61  MENAVMENVAGEEFVLCSLNSTWDLRVTLSRQARDESWLLPSFLQHPKVFDLWREVDRWY 120
           MENAVMENVAGEEFVLCSLNSTWDLRVTLSRQARDESWLLPSFLQHPKVFDLWREVDRWY
Sbjct: 61  MENAVMENVAGEEFVLCSLNSTWDLRVTLSRQARDESWLLPSFLQHPKVFDLWREVDRWY 120

Query: 121 RNHPEQYEKGTDRXXXXXXXXXXXXQRNKHKLVKSIDALLVFLNIDLDNKSTTDQRMEQV 180
           RNHPEQYEKGTDR            QRNKHKLVKSIDALLVFLNIDLDNKSTTDQRMEQV
Sbjct: 121 RNHPEQYEKGTDRGGGNVANTNTTTQRNKHKLVKSIDALLVFLNIDLDNKSTTDQRMEQV 180

Query: 181 NIDKNSFETLPSIQQCEKVLFKLHRNCTSDNDQTLVLTHPFDSYLDIKNFLLEKSTVLYM 240
           NIDKNSFETLPSIQQCEKVLFKLHRNCTSDNDQTLVLTHPFDSYLDIKNFLLEKSTVLYM
Sbjct: 181 NIDKNSFETLPSIQQCEKVLFKLHRNCTSDNDQTLVLTHPFDSYLDIKNFLLEKSTVLYM 240

Query: 241 NNLPPDTTQSELESWFAQFGSRPVGFWTVKNVVEDXXXXXXXXXXXXXLYVDEQDSISGF 300
           NNLPPDTTQSELESWFAQFGSRPVGFWTVKNVVED             LYVDEQDSISGF
Sbjct: 241 NNLPPDTTQSELESWFAQFGSRPVGFWTVKNVVEDTSNVNNNWSTNNNLYVDEQDSISGF 300

Query: 301 VVYQAHEEALDSLTLNGRSILSNMSNTKQPRVVEHVVEIQPSSNSVLDRAQEILTAFPQS 360
           VVYQAHEEALDSLTLNGRSILSNMSNTKQPRVVEHVVEIQPSSNSVLDRAQEILTAFPQS
Sbjct: 301 VVYQAHEEALDSLTLNGRSILSNMSNTKQPRVVEHVVEIQPSSNSVLDRAQEILTAFPQS 360

Query: 361 KNKPRPGDWTCPSCSFSNFQRRTACFRCSFPMSSALQMSNGNNYNKNSVHGYKARTSTPQ 420
           KNKPRPGDWTCPSCSFSNFQRRTACFRCSFPMSSALQMSNGNNYNKNSVHGYKARTSTPQ
Sbjct: 361 KNKPRPGDWTCPSCSFSNFQRRTACFRCSFPMSSALQMSNGNNYNKNSVHGYKARTSTPQ 420

Query: 421 TADYNDNIXXXXXXXFVLNSLSGQLTSASAQDLTQKMKLQMSDTANRRFNYPNRGPXXXX 480
           TADYNDNI       FVLNSLSGQLTSASAQDLTQKMKLQMSDTANRRFNYPNRGP    
Sbjct: 421 TADYNDNIQNQQQQQFVLNSLSGQLTSASAQDLTQKMKLQMSDTANRRFNYPNRGPQLQN 480

Query: 481 XXXXXXXXXXXXXXXXGPMSNGSNVPFRAGDWKCANCTYHNFAKNVVCLRCGGPKXXXXX 540
                           GPMSNGSNVPFRAGDWKCANCTYHNFAKNVVCLRCGGPK     
Sbjct: 481 QHQQSHQHIQNQAQQQGPMSNGSNVPFRAGDWKCANCTYHNFAKNVVCLRCGGPKTANVS 540

Query: 541 XXXXXXXXXXXXXXXXXXXKLVSHDDMSVTPSLQNSSIYHQNGRINVHNMSDVNTTGYVS 600
                              KLVSHDDMSVTPSLQNSSIYHQNGRINVHNMSDVNTTGYVS
Sbjct: 541 ANSNNATVTNATSNAATSNKLVSHDDMSVTPSLQNSSIYHQNGRINVHNMSDVNTTGYVS 600

Query: 601 GQVPSFSGVGLSLNGRSSSEPNWSSNVTGRV 631
           GQVPSFSGVGLSLNGRSSSEPNWSSNVTGRV
Sbjct: 601 GQVPSFSGVGLSLNGRSSSEPNWSSNVTGRV 631

>Kwal_56.24638 s56 (1083888..1085471) [1584 bp, 527 aa] {ON} YDL167C
           (NRP1) - Asparagine-rich protein [contig 161] FULL
          Length = 527

 Score =  496 bits (1276), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 272/624 (43%), Positives = 353/624 (56%), Gaps = 104/624 (16%)

Query: 1   MFYVLFECETVYSEEAPKDHTMISSIAYQIISVETLKPIWEEARRHSIDATHSLKNTIQS 60
           M YV+ E +  + E++PKD + I++  YQ +  E LK +++E +   ++   SL+  +  
Sbjct: 1   MHYVVLEVDLAHREDSPKDWSQIAAFHYQFLDTEELKSVFQENKHIVLENGCSLQEAVSQ 60

Query: 61  MENAVMENVAGEEFVLCSLNSTWDLRVTLSRQARDESWLLPSFLQHPKVFDLWREVDRWY 120
           +E  + E++  ++FVLCSLNSTW  RVT+ RQARDE ++LP  LQHP+VFDLW+E DRW 
Sbjct: 61  LEKDIGEHLK-DDFVLCSLNSTWHFRVTIPRQARDEVFILPPHLQHPRVFDLWKEYDRWC 119

Query: 121 RNHPEQYEKGTDRXXXXXXXXXXXXQRNKHKLVKSIDALLVFLNIDLDNKSTTDQRMEQV 180
            NHPE                      +  K VK +  L   L +D   + +T    E  
Sbjct: 120 VNHPE--------------TLALRRSNSMGKKVKDVAELRSVLELDSATQDSTPGAAEP- 164

Query: 181 NIDKNSFETLPSIQQCEKVLFKLHRNCTSDNDQTLVLTHPFDSYLDIKNFLLEKSTVLYM 240
                      +++Q   ++ +LH+ C +  D++LVLTHP+DSYLD++NFL E+S VLYM
Sbjct: 165 ----------DALEQTIAIIRQLHKKCVTAEDKSLVLTHPYDSYLDVRNFLQERSKVLYM 214

Query: 241 NNLPPDTTQSELESWFAQFGSRPVGFWTVKNVVEDXXXXXXXXXXXXXLYVDEQDSISGF 300
           NNLPPDTTQSELESWF QFG+RPVGFWTVKN+VE+              YV+ QDSISGF
Sbjct: 215 NNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEETSNVNNNWSSNNSTYVEAQDSISGF 274

Query: 301 VVYQAHEEALDSLTLNGRSILSNMSNTKQPRVVEHVVEIQPSSNSVLDRAQEILTAFPQS 360
           VV+Q+HEEA ++L+LNGRSILSN++NTKQPRV+EH+VE+QPSS  VLDRAQEIL+ FPQS
Sbjct: 275 VVFQSHEEATEALSLNGRSILSNIANTKQPRVIEHIVEVQPSSARVLDRAQEILSPFPQS 334

Query: 361 KNKPRPGDWTCPSCSFSNFQRRTACFRCSFPMSSALQMSNGNNYNKNSVHGYKARTSTPQ 420
           KNKPRPGDW CPSC FSNFQRRT+CFRCSFP + +  M+N   Y KN++  +  +    Q
Sbjct: 335 KNKPRPGDWNCPSCGFSNFQRRTSCFRCSFPSTGSAPMNN-TGYVKNTMQPHNIQVGGQQ 393

Query: 421 TADYNDNIXXXXXXXFVLNSLSGQLTSASAQDLTQKMKLQMSDTANR-RFNYPNRGPXXX 479
            A Y                +    T AS+Q     M  Q      R RFN   +GP   
Sbjct: 394 QAAYKMRTAA---------GIPPVQTQASSQMGQPHMAQQHQQQQQRMRFN---QGPRFG 441

Query: 480 XXXXXXXXXXXXXXXXXGPMSNGSNVPFRAGDWKCANCTYHNFAKNVVCLRCGGPKXXXX 539
                                 GSNVPFRAGDWKCA CTYHNFAKNVVCLRCGGPK    
Sbjct: 442 QNQQP---------------QGGSNVPFRAGDWKCATCTYHNFAKNVVCLRCGGPK---- 482

Query: 540 XXXXXXXXXXXXXXXXXXXXKLVSHDDMSVTPSLQNSSIYHQNGRINVHNMSDVNTTGYV 599
                                               S+ + Q G   V++ ++    G  
Sbjct: 483 ------------------------------------STEHQQKGSAAVNSYAEGQDIG-- 504

Query: 600 SGQVPSFSGVGLSLNGRSSSEPNW 623
                  +G+G SLN RS SEP W
Sbjct: 505 -------NGMGFSLNTRSFSEPAW 521

>ZYRO0F11682g Chr6 (956534..958327) [1794 bp, 597 aa] {ON} some
           similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 597

 Score =  494 bits (1272), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 276/649 (42%), Positives = 369/649 (56%), Gaps = 78/649 (12%)

Query: 1   MFYVLFECETVYSEEAPKDHTMISSIAYQIISVETLKPIWEE--ARRHSIDATHS--LKN 56
           M+YV+ E ET +  E PKD   I+ I+YQ ++ ETL+  ++E  A  H I    S  L  
Sbjct: 1   MYYVVLEVETAHLIEIPKDQCRIAKISYQFVNAETLQVHYQENQAPLHIISENDSTNLHE 60

Query: 57  TIQSMENAVMENVAGEE-FVLCSLNSTWDLRVTLSRQARDESWLLPSFLQHPKVFDLWRE 115
            + ++ N  +  +AG+E FVLCSLNSTW LRVTLSRQARD+++ LPS+LQHPK+FDLW+E
Sbjct: 61  AVANL-NEEINRIAGDEPFVLCSLNSTWHLRVTLSRQARDQNFALPSYLQHPKIFDLWKE 119

Query: 116 VDRWYRNHPEQYEKGTDRXXXXXXXXXXXXQRNKHKLVKSIDALLVFLNIDLDNKSTTDQ 175
            +RW  NHPE                    ++N  + +K +  L   L+I+         
Sbjct: 120 YERWCVNHPE----------------VMPLRKNGGRRMKDVAELARVLDIN--------- 154

Query: 176 RMEQVNIDKNSFETLPSIQQCEKVLFKLHRNCTSDNDQTLVLTHPFDSYLDIKNFLLEKS 235
               +N + +SF+   S++    +L +LH+ C++  D  +VLTHP+DS++D++NFL E S
Sbjct: 155 ---GLNFNDSSFDLSRSVE----ILLRLHQRCSTPEDMAMVLTHPYDSHMDVRNFLQECS 207

Query: 236 TVLYMNNLPPDTTQSELESWFAQFGSRPVGFWTVKNVVEDXXXXXXXXXXXXXLYVDEQD 295
            VLY+NNLPPDTTQSELESWF QFG+RPVGFWTVKN+VE+              YV+EQD
Sbjct: 208 KVLYLNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEETSNVNNNWSMNNSPYVEEQD 267

Query: 296 SISGFVVYQAHEEALDSLTLNGRSILSNMSNTKQPRVVEHVVEIQPSSNSVLDRAQEILT 355
           SISGFVV+Q HEEA + LTLNGRSILSNM+NTKQPRVVEH+VEIQPSS  VLDRAQEIL+
Sbjct: 268 SISGFVVFQTHEEATEVLTLNGRSILSNMANTKQPRVVEHIVEIQPSSTRVLDRAQEILS 327

Query: 356 AFPQSKNKPRPGDWTCPSCSFSNFQRRTACFRCSFPMSSALQMSNGNNYNKNSVHGYKAR 415
            FPQSKNKPRPGDW CPSC FSNFQRRTACFRCSFP ++A+Q++      K  + G  A 
Sbjct: 328 PFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPATTAVQVN-----TKQYISGGPAA 382

Query: 416 -------TSTPQTADYNDNIXXXXXXXFVLNSLSGQLTSASAQDLTQKMKLQMSDTANRR 468
                  T +P    Y  N+          +  +  +T    Q +        +      
Sbjct: 383 NLQNGKITPSPSQTYYPLNVTPTQTVPTPQSRHNTTMTPHMDQSMAMLHGTGAAGAGGNN 442

Query: 469 FNYPNR------GPXXXXXXXXXXXXXXXXXXXXGPMSNGSNVPFRAGDWKCANCTYHNF 522
           + YP                              G  + GSNVPFRAGDWKC +C YHNF
Sbjct: 443 YRYPGAQSLNFVANNVNNGNGNGNNNSGSNNRYNGQGNGGSNVPFRAGDWKCPSCIYHNF 502

Query: 523 AKNVVCLRCGGPKXXXXXXXXXXXXXXXXXXXXXXXXKLVSHDDMSVTPSLQNSSIYHQN 582
           AKNVVCLRCGGPK                         +  HD          + +  +N
Sbjct: 503 AKNVVCLRCGGPK----ITAVDLENAATTSNNINNNNGVNQHD----------AKVVAKN 548

Query: 583 GRINVHNMSDVNTTGYVSGQVP--------SFSGVGLSLNGRSSSEPNW 623
             +++ +++ + +T  +S ++P        ++ G G++L+ RS SEP W
Sbjct: 549 NSVSLLDLTSMGSTVSLSDKLPNGNATSSAAYDGFGVALDSRSVSEPKW 597

>KLTH0H01276g Chr8 complement(122337..124010) [1674 bp, 557 aa] {ON}
           some similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 557

 Score =  484 bits (1247), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 277/643 (43%), Positives = 350/643 (54%), Gaps = 106/643 (16%)

Query: 1   MFYVLFECETVYSEEAPKDHTMISSIAYQIISVETLKPIWEEARRHSIDATHSLKNTIQS 60
           M YV+ E E  + E++PKD + I+   YQ +  ETL+P++EE +   +    +L++ +  
Sbjct: 1   MHYVVLEVELAHREDSPKDWSQIAKFNYQFLDTETLEPVFEENKHVELGNGCTLQDAVAQ 60

Query: 61  MENAVMENVAGEEFVLCSLNSTWDLRVTLSRQARDESWLLPSFLQHPKVFDLWREVDRWY 120
           +E  + E+ A ++FVLCSLNSTW  RVT+ RQARDE ++LP  LQHPKVFDLW+E DRW 
Sbjct: 61  LEKDISEH-AKDDFVLCSLNSTWHFRVTIPRQARDEVFILPPHLQHPKVFDLWKEYDRWC 119

Query: 121 RNHPEQYEK-------------------GTDRXXXXXXXXXXXXQRNKHKLVKSIDALLV 161
            NHPE                       G D                + K  +S    LV
Sbjct: 120 MNHPETSAMRQNPLGKRTKDLAEMRSVLGLDGTEEGAHPDANQNGGEQSKAEQSGAEQLV 179

Query: 162 FLNIDLDNKSTTDQRMEQVNIDKNSFETLPSIQQCEKVLFKLHRNCTSDNDQTLVLTHPF 221
               D    ST     EQ     +  E   +I Q   ++ +LH+ C + +D++LVLTHP+
Sbjct: 180 AGQPDTKQPSTELSSSEQ-----SPAEQPDTITQAVVIITQLHKKCVTADDKSLVLTHPY 234

Query: 222 DSYLDIKNFLLEKSTVLYMNNLPPDTTQSELESWFAQFGSRPVGFWTVKNVVEDXXXXXX 281
           DSYLD++NFL E+S VLYMNNLPPDTTQSELESWF QFG+RPVGFWTVKN+VE+      
Sbjct: 235 DSYLDVRNFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEETSNVNN 294

Query: 282 XXXXXXXLYVDEQDSISGFVVYQAHEEALDSLTLNGRSILSNMSNTKQPRVVEHVVEIQP 341
                   YV+ QDSISGFVV+Q+HEEA ++L+LNGRSILSN++NTKQPRV+EH+VEIQP
Sbjct: 295 NWSSNNSTYVEAQDSISGFVVFQSHEEATEALSLNGRSILSNIANTKQPRVIEHIVEIQP 354

Query: 342 SSNSVLDRAQEILTAFPQSKNKPRPGDWTCPSCSFSNFQRRTACFRCSFPMSSALQMSNG 401
           SS  VLDRAQEIL+ FPQSKNKPRPGDW CPSC FSNFQRRT+CFRCSFP +S      G
Sbjct: 355 SSARVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTSCFRCSFPAAS------G 408

Query: 402 NNYNKNSVHGYKARTSTPQTADYNDNIXXXXXXXFVLNSLSGQLTSASAQDLTQKMKLQM 461
              N N   GY      P    +N          + + + +G L +   Q      + Q 
Sbjct: 409 AGMNNN---GYMKNPLQP----HNAQAGSQQQAAYKMRTPAG-LQAMQVQSGPHMGQPQQ 460

Query: 462 SDTANRRFNYPNRGPXXXXXXXXXXXXXXXXXXXXGPMSNGSNVPFRAGDWKCANCTYHN 521
                +R  Y                              GSNVPFRAGDWKCA CTYHN
Sbjct: 461 QQQQQQRMRY----------------NQGQRFGQGQQHQGGSNVPFRAGDWKCATCTYHN 504

Query: 522 FAKNVVCLRCGGPKXXXXXXXXXXXXXXXXXXXXXXXXKLVSHDDMSVTPSLQNSSIYHQ 581
           FAKNVVCLRCGGPK                                         S  HQ
Sbjct: 505 FAKNVVCLRCGGPK-----------------------------------------STEHQ 523

Query: 582 NGRIN-VHNMSDVNTTGYVSGQVPSFSGVGLSLNGRSSSEPNW 623
              +  V++ +D+   G         +G+G+SLN RS SEP W
Sbjct: 524 QKELGTVNSYTDIQDIG---------NGMGISLNTRSFSEPAW 557

>TDEL0C01990 Chr3 complement(345897..347717) [1821 bp, 606 aa] {ON}
           Anc_7.349 YDL167C
          Length = 606

 Score =  469 bits (1208), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 289/669 (43%), Positives = 369/669 (55%), Gaps = 111/669 (16%)

Query: 1   MFYVLFECETVYSEEAPKDHTMISSIAYQIISVETLKPIWEEARRHSI----DATHSLKN 56
           M YV+ E E  +  EAPKDH  ++ ++YQ I  E++K  + + +   I      + S + 
Sbjct: 1   MHYVVLEVEATHRIEAPKDHGRVNKLSYQFIDAESMKAYYADDQIPLISLDQQGSISFQE 60

Query: 57  TIQSMENAVMENVAGEEFVLCSLNSTWDLRVTLSRQARDESWLLPSFLQHPKVFDLWREV 116
           +I   +  VM  V  +EFVLCSL STW +RVT+ RQARDE +LLPS+LQHP+VFDLW+E 
Sbjct: 61  SIAKFDRDVMSIVGEDEFVLCSLYSTWHIRVTIPRQARDEGFLLPSYLQHPRVFDLWKEY 120

Query: 117 DRWYRNHPEQYEKGTDRXXXXXXXXXXXXQRNKHKLVKSIDALLVFLNIDLDNKSTTDQR 176
           DRW  NHPE                     R   K VK    +L  L +      +T++ 
Sbjct: 121 DRWCANHPE-------------VLTLRKSCRTGIKRVKDQTEILKVLEM------STEEI 161

Query: 177 MEQVNIDKNSFETLPSIQQCEKVLFKLHRNCTSDNDQTLVLTHPFDSYLDIKNFLLEKST 236
            E+           P +     +L +L   CT+  D + VL+ P+DS+LDI+NFL E+S 
Sbjct: 162 TEK-----------PVLGYTVDILLQLCERCTTKEDISDVLSRPYDSHLDIRNFLQEQSK 210

Query: 237 VLYMNNLPPDTTQSELESWFAQFGSRPVGFWTVKNVVEDXXXXXXXXXXXXXLYVDEQDS 296
           VLY+NNLPPDTTQSELESWF QFG+RPVGFWTVKN+VE+              YV+EQDS
Sbjct: 211 VLYLNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEETANINNKWSMNNSPYVEEQDS 270

Query: 297 ISGFVVYQAHEEALDSLTLNGRSILSNMSNTKQPRVVEHVVEIQPSSNSVLDRAQEILTA 356
           ISGFVV+Q HEEA + L LNGRSILSNM+NTKQPRVVEH+VEIQPSS  VLDRAQEIL+ 
Sbjct: 271 ISGFVVFQTHEEATEVLVLNGRSILSNMANTKQPRVVEHIVEIQPSSTRVLDRAQEILSP 330

Query: 357 FPQSKNKPRPGDWTCPSCSFSNFQRRTACFRCSFPMSSALQMSNGN--NYNKN------- 407
           FPQSKNKPRPGDW CPSC FSNFQRRTACFRCSFP +SA+Q++N    NYN N       
Sbjct: 331 FPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPAASAVQVNNKQYMNYNGNINSTNQG 390

Query: 408 -SVHGYKARTSTPQTADYNDNIXXXXXXXFVLNSLSGQLTSASAQDLTQKMKLQMSDTAN 466
            +++  K   S P  + Y  N          L       T+A+  D   +  L+ S++A 
Sbjct: 391 GNIYITKVGGS-PTQSHYQINTQ--------LPQTQAVRTNANYND---QNSLKHSNSA- 437

Query: 467 RRFNYPNRGPXXXXXXXXXXXXXXXXXXXXGPMSNGSNVPFRAGDWKCANCTYHNFAKNV 526
            RFN  N G                        + GSNVPFRAGDWKC  CTYHNFAKN+
Sbjct: 438 YRFN-GNNGGNSPIMNYSNNRFNGQQVNNSNVNNGGSNVPFRAGDWKCPTCTYHNFAKNL 496

Query: 527 VCLRCGGPKXXXXXXXXXXXXXXXXXXXXXXXXKLVSHDDMSVTPSL------------- 573
           VCLRCG  K                           ++DD SV  S+             
Sbjct: 497 VCLRCGAAKVSISDS---------------------NNDDNSVARSISNGNNNNNNNNNG 535

Query: 574 QNSSIYHQNGRINVHNM-----------------SDVNTTGYVSGQVPSF--SGVGLSLN 614
            N SIY++ G  ++ N+                 S+    GY + +V +   + +G++LN
Sbjct: 536 NNGSIYNRYGNGSLGNLVSTASSTASSAATHDLGSNKRGNGYFTKRVGNLNENELGITLN 595

Query: 615 GRSSSEPNW 623
            RSSSEP W
Sbjct: 596 TRSSSEPKW 604

>NCAS0A14150 Chr1 (2780086..2781798) [1713 bp, 570 aa] {ON}
           Anc_7.349 YDL167C
          Length = 570

 Score =  462 bits (1188), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 251/537 (46%), Positives = 316/537 (58%), Gaps = 36/537 (6%)

Query: 1   MFYVLFECETVYSEEAPKDHTMISSIAYQIISVETLKPIWEEARRHSI-DATHSLKNTIQ 59
           MFYV+ E ET +  E PKDH+ I+  +YQ I+ ETL+  +EE +   I D  ++ K+TI 
Sbjct: 1   MFYVVLELETSHQVETPKDHSRITKCSYQFINSETLQATFEEPKSIDIPDMANAFKDTIS 60

Query: 60  SMENAV-MENVAGEEFVLCSLNSTWDLRVTLSRQARDESWLLPSFLQHPKVFDLWREVDR 118
            +E  +  E V   +FVLCSL S WD+RVTL RQA D  ++LPS+L+HP+VF+LW+E D+
Sbjct: 61  QLEADIKAEIVDFSDFVLCSLFSVWDIRVTLPRQAHDLGFILPSYLKHPRVFNLWKEFDK 120

Query: 119 WYRNHPEQYEKGTDRXXXXXXXXXXXXQRNKHKLVKSIDALLVFLNIDLDNKSTTDQRME 178
           W  NHPE                    +    K    I  ++  L ID            
Sbjct: 121 WCGNHPE-----------VIPMRKSNLRVKSPKTAGDISDIVNILEIDTS---------L 160

Query: 179 QVNIDKNSFETLPSIQQCEKVLFKLHRNCTSDNDQTLVLTHPFDSYLDIKNFLLEKSTVL 238
           QV +  ++ +TL SIQ    +L KL + CT+ +D  LVLT P+DSY DIK FL E+S VL
Sbjct: 161 QVPLSTSNPQTLLSIQDSTNILTKLRKKCTTLDDVQLVLTRPYDSYADIKTFLQERSRVL 220

Query: 239 YMNNLPPDTTQSELESWFAQFGSRPVGFWTVKNVVEDXXXXXXXXXXXXXLYVDEQDSIS 298
           YMNNLP DTTQSELESWF QFG+RP+GFWT KN +E+               VDEQD ++
Sbjct: 221 YMNNLPSDTTQSELESWFTQFGARPIGFWTAKNTIEETSSINSNWSLNGNPLVDEQDCVA 280

Query: 299 GFVVYQAHEEALDSLTLNGRSILSNMSNTKQPRVVEHVVEIQPSSNSVLDRAQEILTAFP 358
           GFVV+Q+HEEA ++L LNGRSILSN++NTKQPRVVEH+VEIQPSS  VLD  Q+IL+AFP
Sbjct: 281 GFVVFQSHEEATEALVLNGRSILSNIANTKQPRVVEHIVEIQPSSTRVLDAGQDILSAFP 340

Query: 359 QSKNKPRPGDWTCPSCSFSNFQRRTACFRCSFPMSSALQMSNGNNYNKNSVHGYKARTST 418
           QSKNKPRPGDW+CPSC FSNFQRRTACFRCSFP          NN    ++ G     ST
Sbjct: 341 QSKNKPRPGDWSCPSCGFSNFQRRTACFRCSFPAP--------NNNKGLNISGTSNIAST 392

Query: 419 PQTADYNDNIXXXXXXXFVLNSLSGQLTSASAQDLTQKMKLQMSDTANRRFNYPNRGPXX 478
            Q    N          F +        S + Q   + +    S +  + F +       
Sbjct: 393 NQMPVVN-----RIQSTFPIPQSHQSSISQTFQQYNKPLTPSNSGSRTQNFRHNGSNNTN 447

Query: 479 XXXXXXXXXXXXXXXXXXGPMSNGSNVPFRAGDWKCANCTYHNFAKNVVCLRCGGPK 535
                             G ++ GSNVPFRAGDWKC +CTYHNFAKNVVCLRC  PK
Sbjct: 448 NNNNNRYNTNSQFSMTSGG-ITTGSNVPFRAGDWKCPSCTYHNFAKNVVCLRCRIPK 503

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 4/50 (8%)

Query: 365 RPGDWTCPSCSFSNFQRRTACFRCSFPMSSALQMSNGNNYNKNSV---HG 411
           R GDW CPSC++ NF +   C RC  P  S  Q  NGN  N+++    HG
Sbjct: 476 RAGDWKCPSCTYHNFAKNVVCLRCRIPKISQ-QSHNGNEGNQSTTFTSHG 524

>ACL149W Chr3 (88715..90601) [1887 bp, 628 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL167C (NRP1)
          Length = 628

 Score =  431 bits (1107), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 215/399 (53%), Positives = 261/399 (65%), Gaps = 38/399 (9%)

Query: 1   MFYVLFECETVYSEEAPKDHTMISSIAYQIISVETLKPIWEEARRHSIDATHSLKNTIQS 60
           M+YVLFEC+  + E+ PKDH  +S I YQ+I    L P++ +AR   +     ++     
Sbjct: 1   MYYVLFECDVAHKEDTPKDHARVSKIYYQLIHEPELLPLYADAREIEVGGG-GVQMATGQ 59

Query: 61  MENAVMENVAGEEFVLCSLNSTWDLRVTLSRQARDESWLLPSFLQHPKVFDLWREVDRWY 120
           +E A+ E  A E FVLCSL+STW LRVTL RQA DE  +LP FL H KVFDLW+E DRW 
Sbjct: 60  LEAALQEATASEPFVLCSLHSTWHLRVTLPRQAHDEGSMLPMFLAHAKVFDLWKECDRWC 119

Query: 121 RNHPEQYEKGTDRXXXXXXXXXXXXQRNKHKLVKSIDALLVFLNIDLDNKSTTDQRMEQV 180
            NH                      +R  +   K  D   +F  +DLD +  +       
Sbjct: 120 ANH--------------------VSERACNAGAKG-DVAELFRVLDLDEQLVSHAY---- 154

Query: 181 NIDKNSFETLPSIQQCEKVLFKLHRNCTSDNDQTLVLTHPFDSYLDIKNFLLEKSTVLYM 240
                       IQQ  +VL +LH  CT+  DQ+LVLTHP+DSY D+ +F+ E+S VLYM
Sbjct: 155 ------------IQQATRVLLQLHNKCTTAEDQSLVLTHPYDSYADMTSFIQERSEVLYM 202

Query: 241 NNLPPDTTQSELESWFAQFGSRPVGFWTVKNVVEDXXXXXXXXXXXXXLYVDEQDSISGF 300
           NNLPPDTTQSELESWF QFG+RPVGFWTVKNVVED              YV+E DSISGF
Sbjct: 203 NNLPPDTTQSELESWFTQFGARPVGFWTVKNVVEDTSNVNNNWSSNNSRYVEEHDSISGF 262

Query: 301 VVYQAHEEALDSLTLNGRSILSNMSNTKQPRVVEHVVEIQPSSNSVLDRAQEILTAFPQS 360
           VV+Q+HE A ++L LNGRSILSNM+NTKQPRVVEHVVE++PSS+ VLD AQEIL+ FPQS
Sbjct: 263 VVFQSHEAASEALNLNGRSILSNMANTKQPRVVEHVVELKPSSSRVLDCAQEILSPFPQS 322

Query: 361 KNKPRPGDWTCPSCSFSNFQRRTACFRCSFPMSSALQMS 399
           KNKPRPGDW CPSC FSNFQRR ACFRCSFP +SA+ +S
Sbjct: 323 KNKPRPGDWNCPSCGFSNFQRRIACFRCSFPATSAVTVS 361

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 29/33 (87%), Positives = 31/33 (93%)

Query: 503 SNVPFRAGDWKCANCTYHNFAKNVVCLRCGGPK 535
           SNVPFRAGDWKC NC+YHNFAKN+VCLRCG PK
Sbjct: 499 SNVPFRAGDWKCLNCSYHNFAKNIVCLRCGNPK 531

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 1/36 (2%)

Query: 360 SKNKP-RPGDWTCPSCSFSNFQRRTACFRCSFPMSS 394
           S N P R GDW C +CS+ NF +   C RC  P ++
Sbjct: 498 SSNVPFRAGDWKCLNCSYHNFAKNIVCLRCGNPKTA 533

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 1/37 (2%)

Query: 498 PMSNGSNVPFRAGDWKCANCTYHNFAKNVVCLRCGGP 534
           P     N P R GDW C +C + NF + + C RC  P
Sbjct: 318 PFPQSKNKP-RPGDWNCPSCGFSNFQRRIACFRCSFP 353

>SAKL0F11352g Chr6 (883590..885341) [1752 bp, 583 aa] {ON} some
           similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 583

 Score =  426 bits (1094), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 213/400 (53%), Positives = 266/400 (66%), Gaps = 38/400 (9%)

Query: 1   MFYVLFECETVYSEEAPKDHTMISSIAYQIISVETLKPIWEEARRHSIDATHSLKNTIQS 60
           M+YV+ E ETV+ EE PKDHT +S I YQ I  +TL+ ++E+     +     L+  +  
Sbjct: 1   MYYVVLEAETVHGEEKPKDHTRVSRICYQFIHSDTLQSVFEQPIIVEVGPGQ-LREQVAQ 59

Query: 61  MENAVMENVAGE--EFVLCSLNSTWDLRVTLSRQARDESWLLPSFLQHPKVFDLWREVDR 118
           ++  V   +  +  EF L SL+STW +RVT+ RQARDE ++LP +LQHPKVFDLW+E DR
Sbjct: 60  LDQLVTSKITSDNHEFALVSLSSTWHIRVTIPRQARDEGFILPPYLQHPKVFDLWKEYDR 119

Query: 119 WYRNHPEQYEKGTDRXXXXXXXXXXXXQRNKHKLVKSIDALLVFLNIDLDNKSTTDQRME 178
           W  NHPE                                 L +  N +L  KS     + 
Sbjct: 120 WCVNHPE--------------------------------TLPLRKNSNLGKKSRDLPELS 147

Query: 179 QVNIDKNSFETLPSIQQCEKVLFKLHRNCTSDNDQTLVLTHPFDSYLDIKNFLLEKSTVL 238
           +V   +   +T P + Q   +L +LH+ C    DQ++VLTHP+DSYLD++ FL E+S VL
Sbjct: 148 RV--LEAPLQTFP-LDQTIGILSQLHKKCLLPEDQSMVLTHPYDSYLDVRTFLQERSKVL 204

Query: 239 YMNNLPPDTTQSELESWFAQFGSRPVGFWTVKNVVEDXXXXXXXXXXXXXLYVDEQDSIS 298
           YMNNLPPDTTQSELESWF QFG+RPVGFWTVKNVVE+              YV+EQDSIS
Sbjct: 205 YMNNLPPDTTQSELESWFTQFGARPVGFWTVKNVVEETSNVNNNWSCNNSSYVEEQDSIS 264

Query: 299 GFVVYQAHEEALDSLTLNGRSILSNMSNTKQPRVVEHVVEIQPSSNSVLDRAQEILTAFP 358
           GFVV+Q HEEA ++L+LNGRSILSNM+NTKQPRVVEHVVE+QPSS  VLDRA E+L+ FP
Sbjct: 265 GFVVFQTHEEATEALSLNGRSILSNMANTKQPRVVEHVVELQPSSTRVLDRAHELLSPFP 324

Query: 359 QSKNKPRPGDWTCPSCSFSNFQRRTACFRCSFPMSSALQM 398
           QSKNKPRPGDW CPSC FSNFQRRTACFRCSFP +SA+ +
Sbjct: 325 QSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPATSAVNV 364

 Score = 85.9 bits (211), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 64/124 (51%), Gaps = 32/124 (25%)

Query: 500 SNGSNVPFRAGDWKCANCTYHNFAKNVVCLRCGGPKXXXXXXXXXXXXXXXXXXXXXXXX 559
             GSNVPFRAGDWKC +CTYHNFAKNVVCLRCGGPK                        
Sbjct: 492 GGGSNVPFRAGDWKCVSCTYHNFAKNVVCLRCGGPK-------------------TVGGA 532

Query: 560 KLVSHDDMSVTPSLQNSSIYHQNGRINVHNMSDVNTTGYVSGQVPSFSGVGLSLNGRSSS 619
            + +  ++ V   L + S   QNG  +  ++S+++  G         S  G+SL  RSSS
Sbjct: 533 GVANQANLDVL--LLDGSC--QNGSASTISLSEMHNGG---------SSFGVSLETRSSS 579

Query: 620 EPNW 623
           EP W
Sbjct: 580 EPAW 583

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 1/37 (2%)

Query: 498 PMSNGSNVPFRAGDWKCANCTYHNFAKNVVCLRCGGP 534
           P     N P R GDW C +C + NF +   C RC  P
Sbjct: 322 PFPQSKNKP-RPGDWNCPSCGFSNFQRRTACFRCSFP 357

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 5/57 (8%)

Query: 336 VVEIQPSSNSVLDRAQEILTAFPQSKNKP-RPGDWTCPSCSFSNFQRRTACFRCSFP 391
           +V+ QP SN+ +       T      N P R GDW C SC++ NF +   C RC  P
Sbjct: 474 IVQRQPYSNNGIGAT----TNNGGGSNVPFRAGDWKCVSCTYHNFAKNVVCLRCGGP 526

>Skud_4.90 Chr4 complement(156704..158827) [2124 bp, 707 aa] {ON}
           YDL167C (REAL)
          Length = 707

 Score =  412 bits (1059), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 205/401 (51%), Positives = 259/401 (64%), Gaps = 14/401 (3%)

Query: 1   MFYVLFECETVYSEEAPKDHTMISSIAYQIISVETLKPIWEEARRHSIDA---THSLKNT 57
           M YV+ E +  Y  ++PKD   I SIAYQI+  ETL   ++      I+      SL++ 
Sbjct: 1   MHYVVLELQVAYLPDSPKDQCRIGSIAYQIVDAETLICHYDIDSLPKIEVDGEAKSLESA 60

Query: 58  IQSMENAVMENVAGEEFVLCSLNSTWDLRVTLSRQARDESWLLPSFLQHPKVFDLWREVD 117
           +  ++  + + +  +EFVL SL STW +RVTLSRQARD+ ++L S+LQHP++FDLW+E D
Sbjct: 61  MIQLDKDIHDVIGNDEFVLVSLCSTWHIRVTLSRQARDDGFILTSYLQHPRLFDLWKEFD 120

Query: 118 RWYRNHPEQYEKGTDRXXXXXXXXXXXXQRNKHKLVKSIDALLVFLNIDLDNKSTTDQRM 177
           RW  NHPE  E+                     K  K  + ++  L +   ++       
Sbjct: 121 RWCVNHPELLEQRKATSNNNSNTKAGGSNGALAKNTKDFNEMIRILEVSTPSEGADFIPE 180

Query: 178 EQVNIDKNSFETLPSIQQCEKVLFKLHRNCTSDNDQTLVLTHPFDSYLDIKNFLLEKSTV 237
           EQ             +++   +L +LH+ C+S  D   VLT P+DSY DI+ FL E+S V
Sbjct: 181 EQ-----------SLLRRTTDILLQLHKKCSSPEDMKSVLTQPYDSYTDIRTFLQERSKV 229

Query: 238 LYMNNLPPDTTQSELESWFAQFGSRPVGFWTVKNVVEDXXXXXXXXXXXXXLYVDEQDSI 297
           LYMNNLPPDTTQSELESWF Q+G RPVGFWTVKN+VED              YV+EQDSI
Sbjct: 230 LYMNNLPPDTTQSELESWFTQYGVRPVGFWTVKNIVEDTSNVNNNWSLNNSPYVEEQDSI 289

Query: 298 SGFVVYQAHEEALDSLTLNGRSILSNMSNTKQPRVVEHVVEIQPSSNSVLDRAQEILTAF 357
           SGFVV+Q HEEA + L LNGRSILSN++NTKQPRVVEHV+E+QPSS  VLD+AQEIL+ F
Sbjct: 290 SGFVVFQTHEEATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPF 349

Query: 358 PQSKNKPRPGDWTCPSCSFSNFQRRTACFRCSFPMSSALQM 398
           PQSKNKPRPGDW CPSC FSNFQRRTACFRCSFP  S +QM
Sbjct: 350 PQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPAPSNIQM 390

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 30/31 (96%)

Query: 505 VPFRAGDWKCANCTYHNFAKNVVCLRCGGPK 535
           +PFRAGDWKC+ CTYHNFAKNVVCLRCGGPK
Sbjct: 580 IPFRAGDWKCSTCTYHNFAKNVVCLRCGGPK 610

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 21/40 (52%)

Query: 365 RPGDWTCPSCSFSNFQRRTACFRCSFPMSSALQMSNGNNY 404
           R GDW C +C++ NF +   C RC  P S     +  N+Y
Sbjct: 583 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADANETNHY 622

 Score = 39.7 bits (91), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 1/37 (2%)

Query: 498 PMSNGSNVPFRAGDWKCANCTYHNFAKNVVCLRCGGP 534
           P     N P R GDW C +C + NF +   C RC  P
Sbjct: 348 PFPQSKNKP-RPGDWNCPSCGFSNFQRRTACFRCSFP 383

>TBLA0E02060 Chr5 (502492..504186) [1695 bp, 564 aa] {ON} Anc_7.349
           YDL167C
          Length = 564

 Score =  406 bits (1044), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 211/398 (53%), Positives = 261/398 (65%), Gaps = 39/398 (9%)

Query: 1   MFYVLFECETVYSEEAPKDHTMISSIAYQIISVETLKPIWEEARRHSIDATH-SLKNTIQ 59
           M+Y L E +T +  EAPKDHT I +I+YQ I+  TL+  + + +  +ID T   L  +I 
Sbjct: 1   MYYTLIELQTAHDAEAPKDHTKIINISYQFINQSTLQASFPDDKIPNIDCTTLPLSESIA 60

Query: 60  SMENAVMENVA-GEEFVLCSLNSTWDLRVTLSRQARDESWLLPSFLQHPKVFDLWREVDR 118
            ++  +  N+  GE+FVLCSLNSTWDLRVT+SRQA+DE + LP+F ++P++FDLW+E DR
Sbjct: 61  LLQKDLELNLPNGEDFVLCSLNSTWDLRVTISRQAKDEQYTLPTFFKYPRIFDLWKEFDR 120

Query: 119 WYRNHPEQYEKGTDRXXXXXXXXXXXXQRNKHKLVKSIDALLVFLNIDLDNKSTTDQRME 178
           W  NH E  +                  R+  KL K +  L   L+I             
Sbjct: 121 WCVNHKELVQT-----------------RDPRKL-KDLKQLATLLHIP------------ 150

Query: 179 QVNIDKNSFETLPSIQQCEKVLFKLHRNCTSDNDQTLVLTHPFDSYLDIKNFLLEKSTVL 238
                  S ETL SI    KVL +LH  CT+++DQ  VLT P+DS LD   F+   STVL
Sbjct: 151 -------SVETLSSISLASKVLVQLHEKCTTEDDQEKVLTSPYDSKLDWDIFIETSSTVL 203

Query: 239 YMNNLPPDTTQSELESWFAQFGSRPVGFWTVKNVVEDXXXXXXXXXXXXXLYVDEQDSIS 298
           YMNNLPPDTTQSELE+WF QFG RP+GFWTVKN++ED              YV+E DSIS
Sbjct: 204 YMNNLPPDTTQSELETWFTQFGVRPIGFWTVKNILEDTSIINNNWCVNNSPYVEEIDSIS 263

Query: 299 GFVVYQAHEEALDSLTLNGRSILSNMSNTKQPRVVEHVVEIQPSSNSVLDRAQEILTAFP 358
           GF+V+  H+EA+D LTLNG SILSN++NTKQPRVVEHVVEIQPSS  V++R Q ILT FP
Sbjct: 264 GFIVFSTHKEAIDVLTLNGHSILSNIANTKQPRVVEHVVEIQPSSPKVMERIQSILTPFP 323

Query: 359 QSKNKPRPGDWTCPSCSFSNFQRRTACFRCSFPMSSAL 396
           QSKNKPRPGDW CPSC FSNFQRRTACFRCSFP   A+
Sbjct: 324 QSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPQQQAV 361

 Score = 79.3 bits (194), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 32/36 (88%)

Query: 500 SNGSNVPFRAGDWKCANCTYHNFAKNVVCLRCGGPK 535
           SNGSNVPFRAGDWKC  C YHNFAKN+VCLRC GPK
Sbjct: 472 SNGSNVPFRAGDWKCLTCGYHNFAKNIVCLRCSGPK 507

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 1/38 (2%)

Query: 498 PMSNGSNVPFRAGDWKCANCTYHNFAKNVVCLRCGGPK 535
           P     N P R GDW C +C + NF +   C RC  P+
Sbjct: 321 PFPQSKNKP-RPGDWNCPSCGFSNFQRRTACFRCSFPQ 357

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 17/29 (58%)

Query: 365 RPGDWTCPSCSFSNFQRRTACFRCSFPMS 393
           R GDW C +C + NF +   C RCS P S
Sbjct: 480 RAGDWKCLTCGYHNFAKNIVCLRCSGPKS 508

>Smik_4.71 Chr4 complement(137635..139914) [2280 bp, 759 aa] {ON}
           YDL167C (REAL)
          Length = 759

 Score =  410 bits (1055), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 209/400 (52%), Positives = 263/400 (65%), Gaps = 15/400 (3%)

Query: 1   MFYVLFECETVYSEEAPKDHTMISSIAYQIISVETLKPIWEEARRHSIDA---THSLKNT 57
           M YV+ E +  +   +PKD   I +IAYQ +  ETL   +E     +I+    T SL+  
Sbjct: 1   MHYVVLELQVAHLPNSPKDQCRIVNIAYQFVDAETLACHYENNSLPNIEVDRETRSLETA 60

Query: 58  IQSMENAVMENVAGEEFVLCSLNSTWDLRVTLSRQARDESWLLPSFLQHPKVFDLWREVD 117
           +  ++ A+ + +  +EFVL SL STW +RVTL RQARD+ ++L S+LQHPK+FDLW+E D
Sbjct: 61  MIQLDKAIQDILGNDEFVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPKLFDLWKEFD 120

Query: 118 RWYRNHPEQYEKGTDRXXXXXXXXXXXXQRNKHKLVKSIDALLVFLNIDLDNKSTTDQRM 177
           RW  NHPE  E+                + N   L K+   L   + I L+  S+T+   
Sbjct: 121 RWCVNHPEILEQ----MKTASNNNNSGTKGNSGGLAKNAKDLDEMIRI-LEISSSTE--- 172

Query: 178 EQVNIDKNSFETLPSIQQCEKVLFKLHRNCTSDNDQTLVLTHPFDSYLDIKNFLLEKSTV 237
           E V++     E    +++   +L  LHR C S  D   VLT P+DS+ DI+ FL E+S V
Sbjct: 173 EAVSVP----EEYSLLRRTTDILIHLHRKCCSSEDMKFVLTQPYDSHTDIRTFLQERSKV 228

Query: 238 LYMNNLPPDTTQSELESWFAQFGSRPVGFWTVKNVVEDXXXXXXXXXXXXXLYVDEQDSI 297
           LYMNNLPPDTTQSELESWF Q+G RPVGFWTVKN+VED              YV++QDSI
Sbjct: 229 LYMNNLPPDTTQSELESWFTQYGVRPVGFWTVKNIVEDTSNINNNWSLNNSPYVEDQDSI 288

Query: 298 SGFVVYQAHEEALDSLTLNGRSILSNMSNTKQPRVVEHVVEIQPSSNSVLDRAQEILTAF 357
           SGFVV+Q HEEA + L LNGRSILSN++NTKQPRVVEHV+E+QPSS  VLD+AQEIL+ F
Sbjct: 289 SGFVVFQTHEEATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPF 348

Query: 358 PQSKNKPRPGDWTCPSCSFSNFQRRTACFRCSFPMSSALQ 397
           PQSKNKPRPGDW CPSC FSNFQRRTACFRCSFP  S +Q
Sbjct: 349 PQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPAPSNIQ 388

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 35/39 (89%)

Query: 497 GPMSNGSNVPFRAGDWKCANCTYHNFAKNVVCLRCGGPK 535
           G   +GSN+PFRAGDWKC+ CTYHNFAKNVVCLRCGGPK
Sbjct: 610 GMGGSGSNIPFRAGDWKCSTCTYHNFAKNVVCLRCGGPK 648

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 22/40 (55%)

Query: 365 RPGDWTCPSCSFSNFQRRTACFRCSFPMSSALQMSNGNNY 404
           R GDW C +C++ NF +   C RC  P S +   +  N+Y
Sbjct: 621 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVSTDANETNHY 660

 Score = 39.7 bits (91), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 1/37 (2%)

Query: 498 PMSNGSNVPFRAGDWKCANCTYHNFAKNVVCLRCGGP 534
           P     N P R GDW C +C + NF +   C RC  P
Sbjct: 347 PFPQSKNKP-RPGDWNCPSCGFSNFQRRTACFRCSFP 382

>YDL167C Chr4 complement(160995..163154) [2160 bp, 719 aa] {ON}
           NRP1Putative RNA binding protein of unknown function;
           localizes to stress granules induced by glucose
           deprivation; predicted to be involved in ribosome
           biogenesis
          Length = 719

 Score =  409 bits (1052), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 206/405 (50%), Positives = 264/405 (65%), Gaps = 24/405 (5%)

Query: 1   MFYVLFECETVYSEEAPKDHTMISSIAYQIISVETLKPIWEEARRHSIDA---THSLKNT 57
           M YV+ E +  +  + PKD   I++IA+QI++ ETL   +      SI+    T SL++ 
Sbjct: 1   MHYVVLELQVAHLPDTPKDQCRIANIAFQIVNAETLVCHYGTNSLPSIEVNGTTKSLESA 60

Query: 58  IQSMENAVMENVAGEEFVLCSLNSTWDLRVTLSRQARDESWLLPSFLQHPKVFDLWREVD 117
           +  ++  + + +  ++FVL SL STW +RVTL RQARD+ ++L S+LQHPKVFDLW+E D
Sbjct: 61  MVQLDKDIHDVIGNDDFVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPKVFDLWKEFD 120

Query: 118 RWYRNHPEQYEKGTDRXXXXXXXXXXXXQRNKHKLVKSIDALLVFLNIDLDNKSTTDQRM 177
           RW  NHPE    G  +              N  K  K +D ++               R+
Sbjct: 121 RWCVNHPEIL--GQKKAISNNNCNTKSISINAAKNTKDLDEIV---------------RI 163

Query: 178 EQVNIDKNSFETLPSI----QQCEKVLFKLHRNCTSDNDQTLVLTHPFDSYLDIKNFLLE 233
            +V+I      ++P I    ++   +L +LH+ CTS  D   VLT P+DS+ DI+ FL E
Sbjct: 164 LEVSIPTEEAGSVPEIYSLLKRTTDILIQLHKKCTSPEDMESVLTKPYDSHTDIRAFLQE 223

Query: 234 KSTVLYMNNLPPDTTQSELESWFAQFGSRPVGFWTVKNVVEDXXXXXXXXXXXXXLYVDE 293
           KS +LYMNNLPPDTTQSELESWF Q+G RPVGFWTVKN+VED              YV++
Sbjct: 224 KSKILYMNNLPPDTTQSELESWFTQYGVRPVGFWTVKNIVEDTSNVNNNWSLNNSPYVED 283

Query: 294 QDSISGFVVYQAHEEALDSLTLNGRSILSNMSNTKQPRVVEHVVEIQPSSNSVLDRAQEI 353
           QDSISGFVV+Q HEEA + L LNGRSILSN++NTKQPRVVEHV+E+QPSS  VLD+AQEI
Sbjct: 284 QDSISGFVVFQTHEEATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEI 343

Query: 354 LTAFPQSKNKPRPGDWTCPSCSFSNFQRRTACFRCSFPMSSALQM 398
           L+ FPQSKNKPRPGDW CPSC FSNFQRRTACFRCSFP  S  Q+
Sbjct: 344 LSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPAPSNSQI 388

 Score = 80.1 bits (196), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 33/34 (97%)

Query: 502 GSNVPFRAGDWKCANCTYHNFAKNVVCLRCGGPK 535
           GSN+PFRAGDWKC+ CTYHNFAKNVVCLRCGGPK
Sbjct: 575 GSNMPFRAGDWKCSTCTYHNFAKNVVCLRCGGPK 608

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 31/63 (49%)

Query: 365 RPGDWTCPSCSFSNFQRRTACFRCSFPMSSALQMSNGNNYNKNSVHGYKARTSTPQTADY 424
           R GDW C +C++ NF +   C RC  P S +   S  N+Y  +S  G  +RT +      
Sbjct: 581 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSISGDASETNHYIDSSTFGPASRTPSNNNISV 640

Query: 425 NDN 427
           N N
Sbjct: 641 NTN 643

 Score = 39.3 bits (90), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 1/37 (2%)

Query: 498 PMSNGSNVPFRAGDWKCANCTYHNFAKNVVCLRCGGP 534
           P     N P R GDW C +C + NF +   C RC  P
Sbjct: 346 PFPQSKNKP-RPGDWNCPSCGFSNFQRRTACFRCSFP 381

>Suva_4.79 Chr4 complement(148569..150695) [2127 bp, 708 aa] {ON}
           YDL167C (REAL)
          Length = 708

 Score =  405 bits (1040), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 203/410 (49%), Positives = 263/410 (64%), Gaps = 27/410 (6%)

Query: 1   MFYVLFECETVYSEEAPKDHTMISSIAYQIISVETLKPIWEEARRHSIDA---THSLKNT 57
           M YV+ E +  +  ++PKD   I ++AYQI+  ETL   +E     SID      SL++ 
Sbjct: 1   MHYVVLELQVAHLPDSPKDQCRIVNMAYQIVDAETLASHYENGSSPSIDVDGEKKSLESA 60

Query: 58  IQSMENAVMENVAGEEFVLCSLNSTWDLRVTLSRQARDESWLLPSFLQHPKVFDLWREVD 117
           +  ++  +   +  ++FVL SL STW +RVTL RQARD+ ++L S+LQHP++FDLW+E +
Sbjct: 61  MGQLDKDIQHIIGNDDFVLVSLCSTWHIRVTLPRQARDDGFILTSYLQHPRLFDLWKEFE 120

Query: 118 RWYRNHPEQYEKGTDRXXXXXXXXXXXXQRNKHKLVKSIDALLVFLNIDLDNKSTTDQRM 177
           RW  NHPE                       K+ L  + +     +   + N    ++ M
Sbjct: 121 RWCINHPE------------------IMGLRKNILNNNSNTKSSSIGTLIKNTKDLNEMM 162

Query: 178 EQVNI------DKNSFETLPSIQQCEKVLFKLHRNCTSDNDQTLVLTHPFDSYLDIKNFL 231
             + I      D  + +    +Q+   VL +LH+ C+S  D   VLT P+DS+ DI++FL
Sbjct: 163 RILEIPNTVEEDDFALDNHSLLQRTIDVLLQLHKKCSSAEDMKSVLTQPYDSHTDIRSFL 222

Query: 232 LEKSTVLYMNNLPPDTTQSELESWFAQFGSRPVGFWTVKNVVEDXXXXXXXXXXXXXLYV 291
            E+S VLYMNNLPPDTTQSELESWF Q+G+RPVGFWTVKN+VED              YV
Sbjct: 223 QERSKVLYMNNLPPDTTQSELESWFTQYGARPVGFWTVKNIVEDTSNVNNNWSLNNSPYV 282

Query: 292 DEQDSISGFVVYQAHEEALDSLTLNGRSILSNMSNTKQPRVVEHVVEIQPSSNSVLDRAQ 351
           ++QDSISGFVV+Q HEEA + L LNGRSILSN++NTKQPRVVEHV+E+QPSS  VLD+AQ
Sbjct: 283 EDQDSISGFVVFQTHEEATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQ 342

Query: 352 EILTAFPQSKNKPRPGDWTCPSCSFSNFQRRTACFRCSFPMSSALQMSNG 401
           EIL+ FPQSKNKPRPGDW CPSC FSNFQRRTACFRCSFP  S  QM N 
Sbjct: 343 EILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPAPSNSQMHNA 392

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 35/39 (89%)

Query: 497 GPMSNGSNVPFRAGDWKCANCTYHNFAKNVVCLRCGGPK 535
           G   +GSN+PFRAGDWKC+ CTYHNFAKNVVCLRCGGPK
Sbjct: 552 GMGGSGSNIPFRAGDWKCSTCTYHNFAKNVVCLRCGGPK 590

 Score = 44.3 bits (103), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 22/40 (55%)

Query: 365 RPGDWTCPSCSFSNFQRRTACFRCSFPMSSALQMSNGNNY 404
           R GDW C +C++ NF +   C RC  P S    +S  N+Y
Sbjct: 563 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADVSETNHY 602

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 1/37 (2%)

Query: 498 PMSNGSNVPFRAGDWKCANCTYHNFAKNVVCLRCGGP 534
           P     N P R GDW C +C + NF +   C RC  P
Sbjct: 347 PFPQSKNKP-RPGDWNCPSCGFSNFQRRTACFRCSFP 382

>Kpol_530.32 s530 complement(78552..80606) [2055 bp, 684 aa] {ON}
           complement(78552..80606) [2055 nt, 685 aa]
          Length = 684

 Score =  393 bits (1010), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 201/413 (48%), Positives = 264/413 (63%), Gaps = 21/413 (5%)

Query: 1   MFYVLFECETVYSEEAPKDHTMISSIAYQIISVETLKPIW--EEARRHSID--ATHSLKN 56
           M+Y++ E +T++S E PKDHT IS ++YQ +  E+L+  +  +E +  SID  +  S K+
Sbjct: 1   MYYIVIETDTLHSVETPKDHTRISKLSYQFVDAESLECYYGKDEVKVISIDDESAISFKD 60

Query: 57  TIQSMENAVMENVAGEEFVLCSLNSTWDLRVTLSRQARDESWLLPSFLQHPKVFDLWREV 116
            I+ ++  +   V  +EFV CSLNS WDLRVT+ RQARDE   LP +LQ  KVFDLW+E 
Sbjct: 61  MIKQLDEDIKTVVGDDEFVFCSLNSVWDLRVTIPRQARDEIVTLPDYLQEVKVFDLWKEF 120

Query: 117 DRWYRNHPEQYEKGTDRXXXXXXXXXXXXQRNKHKLVKSIDALLVFLNIDLDNKSTTDQR 176
           +RW +NH +       +            +    K   +++   +  N D +++   +  
Sbjct: 121 NRWAKNHSDTVTVKKSKNLRDLEELLRVLELTAEKT--TVETKEIEENSDKEDEVHANTG 178

Query: 177 MEQ---------------VNIDKNSFETLPSIQQCEKVLFKLHRNCTSDNDQTLVLTHPF 221
            E+                +  K   ET   I +  ++L  +H+ CT++ D TLVLT P+
Sbjct: 179 AEESGNATITTAADDDNNEDDSKEMKETPLEINRVTEILTTIHKKCTTEEDITLVLTKPY 238

Query: 222 DSYLDIKNFLLEKSTVLYMNNLPPDTTQSELESWFAQFGSRPVGFWTVKNVVEDXXXXXX 281
           DS  D K F  E S +LYMNNLPPDTTQSELESWFAQFGS+PV FWTVKN+VE+      
Sbjct: 239 DSNSDFKAFKEEASKLLYMNNLPPDTTQSELESWFAQFGSKPVSFWTVKNIVEETSNVNN 298

Query: 282 XXXXXXXLYVDEQDSISGFVVYQAHEEALDSLTLNGRSILSNMSNTKQPRVVEHVVEIQP 341
                   YV+EQDSISGFV +Q+H+EA D+L LNGRSILSNM+NTKQPRVVEH+VEIQP
Sbjct: 299 NWSMNNSPYVEEQDSISGFVSFQSHKEATDALLLNGRSILSNMANTKQPRVVEHIVEIQP 358

Query: 342 SSNSVLDRAQEILTAFPQSKNKPRPGDWTCPSCSFSNFQRRTACFRCSFPMSS 394
           SS +VL+R Q+I   FPQSKNKPRPGDW C SC FSNFQRRTACFRCS+P +S
Sbjct: 359 SSVTVLERVQDISAPFPQSKNKPRPGDWNCMSCGFSNFQRRTACFRCSYPAAS 411

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 29/31 (93%)

Query: 505 VPFRAGDWKCANCTYHNFAKNVVCLRCGGPK 535
           VPFRAGDWKC  C+YHNFAKNVVCLRCGGPK
Sbjct: 540 VPFRAGDWKCIACSYHNFAKNVVCLRCGGPK 570

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 17/29 (58%)

Query: 365 RPGDWTCPSCSFSNFQRRTACFRCSFPMS 393
           R GDW C +CS+ NF +   C RC  P S
Sbjct: 543 RAGDWKCIACSYHNFAKNVVCLRCGGPKS 571

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 18/38 (47%), Gaps = 1/38 (2%)

Query: 497 GPMSNGSNVPFRAGDWKCANCTYHNFAKNVVCLRCGGP 534
            P     N P R GDW C +C + NF +   C RC  P
Sbjct: 372 APFPQSKNKP-RPGDWNCMSCGFSNFQRRTACFRCSYP 408

>KNAG0C03780 Chr3 (743477..745093) [1617 bp, 538 aa] {ON} Anc_7.349
           YDL167C
          Length = 538

 Score =  381 bits (979), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 198/408 (48%), Positives = 263/408 (64%), Gaps = 34/408 (8%)

Query: 1   MFYVLFECETVYSEEAPKDHTMISSIAYQII---SVETLKPIWEEARRHSIDATHSLKNT 57
           MFYVL E ++    ++ KD T +  + YQII   S+E  K    E R+ +++ ++ L++T
Sbjct: 1   MFYVLIELQSEQPRDSLKDQTKLKRLDYQIIDADSLEKRKINGNEIRQLAVEGSN-LQDT 59

Query: 58  IQSMENAVMENVAGEEFVLCSLNSTWDLRVTLSRQARDESWLLPSFLQHPKVFDLWREVD 117
           +   E  +   + GEEFVLCS+ STW+LRV L R+A DE   LP+ L++P V DLW+E D
Sbjct: 60  VLLFEKEINSVINGEEFVLCSMFSTWELRVVLPREANDEQVELPTILKYPIVLDLWKEFD 119

Query: 118 RWYRNHPE--QYEKGTDRXXXXXXXXXXXXQRNKHKLVKSIDALLVFLNIDLDNKSTTDQ 175
           RW  NHP+  Q  KG +R               K K +  +  +L             +Q
Sbjct: 120 RWCTNHPDALQSVKGYNR---------------KCKNLPMVHQVL-----------GVEQ 153

Query: 176 RMEQVNIDKNSFETLPSIQQCEKVLFKLHRNCTSDNDQTLVLTHPFDSYLDIKNFLLEKS 235
           R+ + +++ N + T   +     +L +LH+ C+SD+D   VLT P++S LD + F  E+S
Sbjct: 154 RLNE-SVNANGY-TRKEVGITSDILLQLHKKCSSDDDTNTVLTQPYNSKLDYETFTEEQS 211

Query: 236 TVLYMNNLPPDTTQSELESWFAQFGSRPVGFWTVKNVVEDXXXXXXXXXXXXXLYVDEQD 295
           TVLY+NNLPPDTTQ ELE+WF QFGSRPV FWT KN+VED              YV+EQD
Sbjct: 212 TVLYLNNLPPDTTQGELETWFGQFGSRPVSFWTFKNIVEDTSNINNNWNLNNSYYVEEQD 271

Query: 296 SISGFVVYQAHEEALDSLTLNGRSILSNMSNTKQPRVVEHVVEIQPSSNSVLDRAQEILT 355
           S+SGF  +Q  EEA ++L L+GRSILSN++NTKQPR+VEHVVEI PSS  +L  ++EIL+
Sbjct: 272 SVSGFATFQTFEEAFNALKLSGRSILSNVANTKQPRIVEHVVEIHPSSARILHSSEEILS 331

Query: 356 AFPQSKNKPRPGDWTCPSCSFSNFQRRTACFRCSFPMSSALQMSNGNN 403
           AFPQSKNKPRPGDW CPSC FSNFQRRTACFRCSFP+ SA+Q S G N
Sbjct: 332 AFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPVPSAVQNSTGFN 379

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 25/33 (75%), Positives = 29/33 (87%)

Query: 503 SNVPFRAGDWKCANCTYHNFAKNVVCLRCGGPK 535
           + +PFRAGDWKCA C YHNFAKN++CLRC GPK
Sbjct: 440 TTIPFRAGDWKCAACAYHNFAKNIICLRCSGPK 472

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 5/52 (9%)

Query: 365 RPGDWTCPSCSFSNFQRRTACFRCSFPMSSALQMSNGNNYNKNSVHGYKART 416
           R GDW C +C++ NF +   C RCS P     + S+ +N   +S +G +A T
Sbjct: 445 RAGDWKCAACAYHNFAKNIICLRCSGP-----KTSHPHNLRSHSNYGQEANT 491

 Score = 38.9 bits (89), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 508 RAGDWKCANCTYHNFAKNVVCLRCGGP 534
           R GDW C +C + NF +   C RC  P
Sbjct: 341 RPGDWNCPSCGFSNFQRRTACFRCSFP 367

>KAFR0B00870 Chr2 (162698..164326) [1629 bp, 542 aa] {ON} Anc_7.349
           YDL167C
          Length = 542

 Score =  377 bits (968), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 194/397 (48%), Positives = 247/397 (62%), Gaps = 16/397 (4%)

Query: 1   MFYVLFECETVYSEEAPKDHTMISSIAYQIISVETLKPIWEEARRHSIDA-THSLKNTIQ 59
           MFYV+ E +T++  E PKDHT I+ + +Q+++   L  +  +  +  ID    S K   +
Sbjct: 1   MFYVILELDTLHQVETPKDHTRITKVTFQLVNANALGEVPTKVDQIVIDEQAESFKAAFE 60

Query: 60  SMENAVMENVAGEEFVLCSLNSTWDLRVTLSRQARDESWLLPSFLQHPKVFDLWREVDRW 119
            +  ++        F+LCSL STWD+RVTL+RQARD    +P FLQ+PK+FDL +E  RW
Sbjct: 61  KLNESITSITRDSSFILCSLFSTWDIRVTLNRQARDLGVSMPYFLQYPKIFDLMKEYQRW 120

Query: 120 YRNHPE--QYEKGTDRXXXXXXXXXXXXQRNKHKLVKSIDALLVFLNIDLDNKSTTDQRM 177
             NHPE   ++   +                   ++   D      N   +N    D +M
Sbjct: 121 CLNHPEVMSWKPKLESDKTINMDKKKLGLLELLTVLGLED----MYNFKEENDGAIDDKM 176

Query: 178 EQVNIDKNSFETLPSIQQCEKVLFKLHRNCTSDNDQTLVLTHPFDSYLDIKNFLLEKSTV 237
                    F+    +     VL +L   CT+ +D   VLT P+DS  D+++FL E+S V
Sbjct: 177 ---------FKNERDMTISTSVLLQLLIRCTTSDDTKNVLTCPYDSDTDVRSFLQERSRV 227

Query: 238 LYMNNLPPDTTQSELESWFAQFGSRPVGFWTVKNVVEDXXXXXXXXXXXXXLYVDEQDSI 297
           LYMNNLP DTTQSELESWF QFG+RPVGFWT KNVV D              YV+E DSI
Sbjct: 228 LYMNNLPSDTTQSELESWFTQFGTRPVGFWTFKNVVGDTSSLANTWNSNNSPYVEELDSI 287

Query: 298 SGFVVYQAHEEALDSLTLNGRSILSNMSNTKQPRVVEHVVEIQPSSNSVLDRAQEILTAF 357
            GFVV+Q HEEA++ L LNGR+ILSN++NTKQPRVVEHVVEIQPSS SVLD+A EIL++F
Sbjct: 288 PGFVVFQTHEEAIEVLALNGRAILSNVANTKQPRVVEHVVEIQPSSTSVLDKAHEILSSF 347

Query: 358 PQSKNKPRPGDWTCPSCSFSNFQRRTACFRCSFPMSS 394
           PQSKNKPRPGDW+CPSC FSNFQRRTACFRCSFP  S
Sbjct: 348 PQSKNKPRPGDWSCPSCGFSNFQRRTACFRCSFPAPS 384

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (96%)

Query: 505 VPFRAGDWKCANCTYHNFAKNVVCLRCGGPK 535
           +PFRAGDW CA+CTYHNFAKNV+CLRCGGPK
Sbjct: 455 IPFRAGDWNCASCTYHNFAKNVLCLRCGGPK 485

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 19/32 (59%)

Query: 365 RPGDWTCPSCSFSNFQRRTACFRCSFPMSSAL 396
           R GDW C SC++ NF +   C RC  P +S +
Sbjct: 458 RAGDWNCASCTYHNFAKNVLCLRCGGPKTSTI 489

 Score = 39.3 bits (90), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 508 RAGDWKCANCTYHNFAKNVVCLRCGGP 534
           R GDW C +C + NF +   C RC  P
Sbjct: 355 RPGDWSCPSCGFSNFQRRTACFRCSFP 381

>NDAI0A01900 Chr1 complement(426743..428440) [1698 bp, 565 aa] {ON}
           Anc_7.349 YDL167C
          Length = 565

 Score =  282 bits (721), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 157/394 (39%), Positives = 225/394 (57%), Gaps = 45/394 (11%)

Query: 1   MFYVLFECETVYSEEAPKDHTMISSIAYQIISVETLKPIWEEARRHSI---DATHSLKNT 57
           M YV+ E E+ + E   KD T I +++YQI++++    + +     SI   + + + ++ 
Sbjct: 1   MHYVVLEVESFHEEGTLKDQTRIINLSYQIVNIDDSTLLAQTNPVASIAISNDSENFQDA 60

Query: 58  IQSMENAVMENVAGEEFVLCSLNSTWDLRVTLSRQARDESWLLPSFLQHPKVFDLWREVD 117
           +  +++ +   +   EFV+C+LNS  +LRVTL RQA D    LP +L++PK+FDLW E  
Sbjct: 61  LVQLDSDIKTTIGQNEFVICTLNSLTNLRVTLRRQALDIGVNLPQYLRYPKLFDLWVEFK 120

Query: 118 RWYRNHPEQYEKGTDRXXXXXXXXXXXXQRNKHKLVKSIDALLVFLNIDLDNKSTTDQRM 177
           ++  NHPE                      N+ ++V S D  ++   + L + +T     
Sbjct: 121 KFCANHPE-------------------LDLNE-EMVTSKDVAILTDILGLQSNNT----- 155

Query: 178 EQVNIDKNSFETLPSIQQCEKVLFKLHRNCTSDNDQTLVLTHPFDSYLDIKNFLLEKSTV 237
           E   ID ++            VL  L++ C+S  D   VLT P+D  +DIK F  E++ V
Sbjct: 156 ENYTIDIST-----------DVLLSLYKKCSSSEDIKFVLTQPYDLQMDIKTFYEEEARV 204

Query: 238 LYMNNLPPDTTQSELESWFAQFGSRPVGFWTVKNVVEDXXXXXXXXXXXXXLYVDEQDSI 297
           ++++NLPPD TQ+ELE+WFA   S+P+ +WT K   E               YV  Q SI
Sbjct: 205 IFISNLPPDITQNELETWFANHNSKPICYWTSKTPDE------YSRNFHNNTYVMNQHSI 258

Query: 298 SGFVVYQAHEEALDSLTLNGRSILSNMSNTKQPRVVEHVVEIQPSSNSVLDRAQEILTAF 357
            GF+++Q HEEA  SL LNG+SI S+  + KQ   VEH++E+ PSS  VLD  Q+IL  F
Sbjct: 259 IGFIIFQTHEEAKQSLLLNGKSISSSTLHMKQLYPVEHIIEVAPSSTKVLDHTQDILIPF 318

Query: 358 PQSKNKPRPGDWTCPSCSFSNFQRRTACFRCSFP 391
           PQSKNKPR GDW CPSC FSNFQRRTACFRCSFP
Sbjct: 319 PQSKNKPRLGDWNCPSCGFSNFQRRTACFRCSFP 352

 Score = 77.0 bits (188), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 29/35 (82%), Positives = 32/35 (91%)

Query: 501 NGSNVPFRAGDWKCANCTYHNFAKNVVCLRCGGPK 535
           NGS+VPFRAGDWKC +CTYHNFAKN+ CLRCG PK
Sbjct: 442 NGSSVPFRAGDWKCPSCTYHNFAKNIACLRCGDPK 476

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 20/33 (60%)

Query: 365 RPGDWTCPSCSFSNFQRRTACFRCSFPMSSALQ 397
           R GDW CPSC++ NF +  AC RC  P  S + 
Sbjct: 449 RAGDWKCPSCTYHNFAKNIACLRCGDPKLSGIH 481

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 1/37 (2%)

Query: 498 PMSNGSNVPFRAGDWKCANCTYHNFAKNVVCLRCGGP 534
           P     N P R GDW C +C + NF +   C RC  P
Sbjct: 317 PFPQSKNKP-RLGDWNCPSCGFSNFQRRTACFRCSFP 352

>CAGL0I03344g Chr9 complement(285637..287448) [1812 bp, 603 aa] {ON}
           similar to uniprot|P32770 Saccharomyces cerevisiae
           YDL167c ARP1
          Length = 603

 Score =  229 bits (584), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 132/386 (34%), Positives = 206/386 (53%), Gaps = 40/386 (10%)

Query: 34  ETLKPIWEEARRHSIDATHSLKNTIQSMENAVMENVAGEEFVLCSLNSTWDLRVTLSRQA 93
           E +  + E+ + H+  A H      +S + +   +   +EFV C+LN +W ++V L   A
Sbjct: 50  EFIAKLDEDLKSHATVANHQ-----ESQDGSQSGSDVEKEFVFCTLNPSWSVKVGLVSSA 104

Query: 94  RDESWLLPSFLQHPKVFDLWREVDRWYRNHPEQYEKGTDRXXXXXXXXXXXXQRNKHKL- 152
            D    LP +L++P  FD+W+E   W +NH +  E                 Q N   + 
Sbjct: 105 NDLGVELPEYLRYPVFFDIWKEYSIWKKNHSDSSES-------------PQTQANGESID 151

Query: 153 --VKSIDALLVFLNIDLDNKSTTDQRMEQVNIDKNSFETLPSIQQCEKVLFKLHRNCTSD 210
                I+ L+  L++     ST    ++Q N D  +F+    ++    VL  LH+ C + 
Sbjct: 152 SFAGKIEELVRTLDV-----STEYDELKQKN-DDPTFD----VRLATLVLTALHKKCVTP 201

Query: 211 NDQTLVLTHPFDSYLDIKNFLLEKSTVLYMNNLPPDTTQSELESWFAQFGSRPVGFWTVK 270
            D T VLT P+D  +D KNF+ E+S +LY++N+P +  Q++LE WF Q G   VGFWT+K
Sbjct: 202 VDDTTVLTVPYDLGMDYKNFIEEQSKILYISNIPSELNQTDLEGWFQQKGVASVGFWTLK 261

Query: 271 NVVEDXXXXXXXXXXXXXLYVDEQDSISGFVVYQAHEEALDSLTLNGRSILSNMSNTKQP 330
           N+ +D               +   DS+ GF ++Q+H +A  +L L+G   +  +   K  
Sbjct: 262 NISDDATLASQRNHGKM---LSIPDSMFGFAIFQSHNDAEYALNLHG--TVMKIVAPKGN 316

Query: 331 RVVEHVVEIQPSSNSVLDRAQEILTAFPQSKNKPRPGDWTCPSCSFSNFQRRTACFRCSF 390
           + +E +++IQPSS  +L++ Q+ L   PQ+KNKPRPGDW CPSC FSNFQRRTACFRC+F
Sbjct: 317 KHIEQLLDIQPSSMRLLEKVQDNLILLPQNKNKPRPGDWNCPSCGFSNFQRRTACFRCAF 376

Query: 391 PMSSALQMSNGN----NYNKNSVHGY 412
           P+ + +  + G     +   N V GY
Sbjct: 377 PVPNGVSGNAGKLPMTSVTNNMVSGY 402

 Score = 79.7 bits (195), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 31/37 (83%), Positives = 32/37 (86%)

Query: 499 MSNGSNVPFRAGDWKCANCTYHNFAKNVVCLRCGGPK 535
           M  GSNVPFRAGDWKC  C YHNFAKN+VCLRCGGPK
Sbjct: 526 MIGGSNVPFRAGDWKCPGCFYHNFAKNIVCLRCGGPK 562

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 15/27 (55%)

Query: 365 RPGDWTCPSCSFSNFQRRTACFRCSFP 391
           R GDW CP C + NF +   C RC  P
Sbjct: 535 RAGDWKCPGCFYHNFAKNIVCLRCGGP 561

 Score = 38.9 bits (89), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 508 RAGDWKCANCTYHNFAKNVVCLRCGGP 534
           R GDW C +C + NF +   C RC  P
Sbjct: 351 RPGDWNCPSCGFSNFQRRTACFRCAFP 377

>TPHA0F02960 Chr6 (651108..653072) [1965 bp, 654 aa] {ON} Anc_7.349
           YDL167C
          Length = 654

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (96%)

Query: 505 VPFRAGDWKCANCTYHNFAKNVVCLRCGGPK 535
           VPFRAGDWKC+ C+YHNFAKN+VCLRCGGPK
Sbjct: 547 VPFRAGDWKCSACSYHNFAKNIVCLRCGGPK 577

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 32/64 (50%), Gaps = 6/64 (9%)

Query: 365 RPGDWTCPSCSFSNFQRRTACFRCSFPMSSALQMSNGNNYNKNSVH--GYKARTSTPQTA 422
           R GDW C +CS+ NF +   C RC  P + A+     N+ NK+  H  G K    +   +
Sbjct: 550 RAGDWKCSACSYHNFAKNIVCLRCGGPKTQAIL----NDMNKSMSHNSGQKYNGHSNHKS 605

Query: 423 DYND 426
            YND
Sbjct: 606 QYND 609

>KLLA0B08976g Chr2 complement(786122..787039) [918 bp, 305 aa] {ON}
           similar to uniprot|P32605 Saccharomyces cerevisiae
           YBR119W MUD1 U1 snRNP A protein homolog of human U1-A
           involved in nuclear mRNA splicing
          Length = 305

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%)

Query: 237 VLYMNNLPPDTTQSELESWFAQFGSRPVGFWTVKNV 272
           VL + NLP D TQ ELE  F   G + V   +V+N+
Sbjct: 234 VLLVQNLPKDVTQQELEKLFVSDGFKEVRLVSVRNL 269

>CAGL0D05236g Chr4 (499006..500337) [1332 bp, 443 aa] {ON} weakly
           similar to uniprot|P43607 Saccharomyces cerevisiae
           YFR032c
          Length = 443

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 39/75 (52%), Gaps = 8/75 (10%)

Query: 206 NCTSDNDQTL--VLTHPF---DSYLDIKNFLLEKST---VLYMNNLPPDTTQSELESWFA 257
           N T+D +Q L  V+  P    D+    +N   EK+     +Y   LP +TT ++L ++F 
Sbjct: 145 NGTTDEEQQLANVINDPVTNADAPGTEQNISKEKAISEDTVYCAFLPKETTDNDLRNYFT 204

Query: 258 QFGSRPVGFWTVKNV 272
            +GSR +  +  KNV
Sbjct: 205 DYGSREIWIFRTKNV 219

>Ecym_5419 Chr5 (864517..865164) [648 bp, 215 aa] {ON} similar to
           Ashbya gossypii AFL224W
          Length = 215

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 38/83 (45%), Gaps = 10/83 (12%)

Query: 178 EQVNIDKNSFETLPSIQQCEKVLFKLHRNCTSDNDQTLVLTHPFDSYLDIKNFLLEKSTV 237
           EQ NID NS E          +L KL  N +  N+             D KN  L  S++
Sbjct: 39  EQRNIDSNSAEIEIKSNGGGHILKKL--NQSKQNNSKKAKAE------DKKNAEL--SSI 88

Query: 238 LYMNNLPPDTTQSELESWFAQFG 260
           +Y++ LP    + EL  +F+QFG
Sbjct: 89  IYISRLPKGFHERELSKYFSQFG 111

>NDAI0F02720 Chr6 (668516..669196) [681 bp, 226 aa] {ON} Anc_2.167
          Length = 226

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 22/33 (66%)

Query: 228 KNFLLEKSTVLYMNNLPPDTTQSELESWFAQFG 260
           KN L + S+++Y++ LP    + EL  +F+QFG
Sbjct: 89  KNALADYSSIIYVSRLPHGFHEKELSKYFSQFG 121

>NCAS0G02580 Chr7 complement(461003..461677) [675 bp, 224 aa] {ON}
           Anc_2.167
          Length = 224

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 20/30 (66%)

Query: 231 LLEKSTVLYMNNLPPDTTQSELESWFAQFG 260
           L E S++LY++ LP    + EL  +F+QFG
Sbjct: 89  LAEYSSILYVSRLPQGFHERELSKYFSQFG 118

>KNAG0J00360 Chr10 (56847..58169) [1323 bp, 440 aa] {ON} Anc_8.822
           YMR268C
          Length = 440

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 36/67 (53%), Gaps = 7/67 (10%)

Query: 299 GFVVYQAHEEALDSLT-----LNGRSILSNMSNTKQPRVVEHVVEIQPSSNSVLDRAQEI 353
            F+ Y+ HEEAL +++     LNGR+I   +++ K     + +  I  +SNS   R+  I
Sbjct: 256 AFITYKIHEEALAAVSLNNTDLNGRTITVALADRKSYLERQEIKHILNNSNS--GRSLNI 313

Query: 354 LTAFPQS 360
            + +P S
Sbjct: 314 FSLYPLS 320

>TDEL0A00940 Chr1 complement(156781..158829) [2049 bp, 682 aa] {ON}
           Anc_2.52 YNL197C
          Length = 682

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 237 VLYMNNLPPDTTQSELESWF-AQFGSRPVGF 266
            LY+ NLPPDTT+ EL   F  Q G R + F
Sbjct: 554 TLYVGNLPPDTTEQELRHLFSGQQGFRRLSF 584

>NCAS0G04280 Chr7 (796093..797400) [1308 bp, 435 aa] {ON} Anc_1.408
          Length = 435

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 19/28 (67%)

Query: 233 EKSTVLYMNNLPPDTTQSELESWFAQFG 260
           E++T++Y +NLPP T +S+L   F   G
Sbjct: 354 ERNTLIYCSNLPPSTARSDLYDLFESIG 381

>SAKL0H11330g Chr8 (972836..974929) [2094 bp, 697 aa] {ON} similar
           to uniprot|P37838 Saccharomyces cerevisiae YPL043W NOP4
           Nucleolar protein essential for processing and
           maturation of 27S pre-rRNA and large ribosomal subunit
           biogenesis contains four RNA recognition motifs (RRMs)
          Length = 697

 Score = 31.6 bits (70), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 2/34 (5%)

Query: 233 EKSTVLYMNNLPPDTTQSELESWFAQFGSRPVGF 266
           ++S  +++ N+P D TQ  LES F +FG  PV +
Sbjct: 295 QESFSIFVRNVPYDATQESLESHFGKFG--PVKY 326

>KNAG0F01120 Chr6 complement(199529..201436) [1908 bp, 635 aa] {ON}
           Anc_2.52 YNL197C
          Length = 635

 Score = 31.2 bits (69), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 237 VLYMNNLPPDTTQSELESWF-AQFGSRPVGF 266
            LY+ NLPPD T+ EL   F AQ G R + F
Sbjct: 498 TLYVGNLPPDATEQELRHLFSAQQGFRRLSF 528

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.129    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 61,396,520
Number of extensions: 2449773
Number of successful extensions: 8460
Number of sequences better than 10.0: 47
Number of HSP's gapped: 8618
Number of HSP's successfully gapped: 103
Length of query: 631
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 515
Effective length of database: 40,180,143
Effective search space: 20692773645
Effective search space used: 20692773645
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)