Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D12342g7.350ON38438419590.0
NCAS0A141607.350ON45138116750.0
KLTH0H01254g7.350ON38138016590.0
TBLA0E00390singletonON38338016490.0
Kwal_56.246427.350ON38137816460.0
SAKL0F11374g7.350ON38338216310.0
Kpol_530.317.350ON38037916200.0
Ecym_47237.350ON38138016010.0
YDL168W (SFA1)7.350ON38638015930.0
TDEL0C019807.350ON38538015910.0
Skud_4.897.350ON38538015900.0
Smik_4.707.350ON38638215770.0
CAGL0L01111g7.350ON38137915740.0
Suva_4.787.350ON38538215720.0
TPHA0F029707.350ON38137815560.0
ZYRO0F11704g7.350ON38238115470.0
ACL148C7.350ON38138015260.0
KAFR0B008807.350ON38138015190.0
NDAI0A018907.350ON42238314150.0
KNAG0C037907.350ON38237813650.0
SAKL0A00880gsingletonON38837611351e-154
KLLA0D19929gsingletonON3863472867e-28
KLLA0B00451gsingletonON3863832621e-24
SAKL0C10164g3.118ON3512802557e-24
CAGL0J01441g2.480ON3722762532e-23
TBLA0I011402.480ON3772722514e-23
Ecym_53313.118ON3482602479e-23
AER032W3.118ON3512802461e-22
NCAS0I023503.118ON3512822452e-22
SAKL0F06270gna 1ON3512802407e-22
KLTH0G18986g8.16ON3543812391e-21
KLLA0F21010g3.118ON3502582391e-21
KNAG0K020003.118ON3502722381e-21
YBR145W (ADH5)3.118ON3512792372e-21
KLTH0G15686g3.118ON3512772353e-21
KAFR0G014203.118ON3512782353e-21
NCAS0I01720singletonON3512822353e-21
Suva_4.3943.118ON3512792354e-21
CAGL0I07843g3.118ON3522782338e-21
SAKL0B08184gna 2ON3732722339e-21
KLLA0B09064gna 2ON3742582312e-20
SAKL0B00814g8.16ON3543612302e-20
KLLA0F18260gsingletonON3482582302e-20
KLTH0D05588g2.480ON3892572293e-20
Skud_13.2402.480ON3752692284e-20
Smik_13.520na 3ON3482772274e-20
Skud_13.477na 3ON3482802265e-20
KLTH0E05588gna 1ON3482792266e-20
Ecym_73912.480ON3752722269e-20
ZYRO0B05940g3.118ON3792772251e-19
KLLA0F13530g2.480ON3752572232e-19
KAFR0A007902.480ON3772572232e-19
NDAI0A069303.118ON3512812222e-19
Kpol_1058.118.16ON3532862213e-19
TPHA0G032102.480ON3772572213e-19
YOL086C (ADH1)3.118ON3482772195e-19
TBLA0E03430singletonON3512802186e-19
Skud_15.683.118ON3482772187e-19
KAFR0L02010singletonON3513722171e-18
TBLA0E034403.118ON3512802171e-18
Smik_15.713.118ON3482772161e-18
NDAI0H021602.480ON3812712171e-18
Suva_13.494na 3ON3482772161e-18
Skud_2.2723.118ON3512792161e-18
TDEL0C003908.16ON3532902152e-18
YMR083W (ADH3)2.480ON3752692153e-18
Kwal_56.231983.118ON3512802133e-18
AAR084WsingletonON3852722143e-18
KLTH0D00616g7.3ON3823112144e-18
TPHA0M007303.118ON3502782124e-18
SAKL0E02838g2.480ON3772572135e-18
Smik_2.2843.118ON3512792125e-18
TDEL0D050503.118ON3512572125e-18
Suva_13.2612.480ON3752572117e-18
YMR303C (ADH2)na 3ON3482792107e-18
Smik_13.2662.480ON3752692119e-18
Suva_15.813.118ON3482772091e-17
Kwal_26.77992.480ON3872692101e-17
Kpol_1036.193.118ON3532932091e-17
NCAS0A077802.480ON3732572082e-17
ZYRO0G03388g2.480ON3702892082e-17
KLTH0A00418gsingletonON3562622072e-17
Kpol_431.82.480ON3802492073e-17
YAL060W (BDH1)7.3ON3822412073e-17
KLLA0F00506g7.3ON3852282073e-17
CAGL0D00198g7.3ON3832852064e-17
ABL033C2.480ON3732662054e-17
ZYRO0C12562gna 1ON3482822045e-17
TDEL0A025602.480ON3732572037e-17
Kwal_26.67397.3ON3822342047e-17
Smik_1.67.3ON3822392021e-16
Skud_1.37.3ON3822782011e-16
ZYRO0G03410gsingletonON3733662002e-16
KNAG0K01040singletonON3912382002e-16
KAFR0L02000singletonON3612591992e-16
Kwal_55.19574singletonON3563671974e-16
TDEL0H044607.3ON3822661975e-16
TDEL0F03190na 1ON3512771967e-16
NCAS0J003008.16ON3572891967e-16
Skud_20.2singletonON3573731958e-16
Skud_4.2singletonON3573731958e-16
Suva_1.77.3ON3822411941e-15
Suva_10.1548.16ON3563851931e-15
SAKL0D14872g7.3ON3832351932e-15
Smik_48.1singletonON3573701922e-15
NDAI0H020507.3ON3852741922e-15
ZYRO0F02552g8.16ON3512781903e-15
KNAG0E025902.480ON3742571904e-15
YJR159W (SOR1)na 4ON3573731895e-15
ABR229C8.16ON3532841895e-15
Kwal_26.6684singletonON3562611886e-15
Kwal_55.20564singletonON2162181827e-15
YLR070C (XYL2)8.16ON3563701887e-15
TBLA0A042907.3ON3952401889e-15
YDL246C (SOR2)singletonON3573731861e-14
Suva_12.260singletonON3573751833e-14
Kpol_1049.187.2ON3862421834e-14
SAKL0D14894g7.2ON3852391781e-13
KNAG0I00120singletonON3812691701e-12
NCAS0A076707.2ON4392581693e-12
NCAS0A076607.3ON3862291674e-12
YAL061W (BDH2)7.2ON4172281675e-12
KLLA0D05511g8.16ON3543801647e-12
KAFR0I001607.2ON3853071603e-11
TDEL0D037203.253ON3352521551e-10
Suva_1.67.2ON4172281561e-10
Skud_1.27.2ON4172281542e-10
YBR046C (ZTA1)3.253ON3342451504e-10
Smik_1.57.2ON4172281514e-10
KNAG0D00110singletonON3623431443e-09
Smik_2.1703.253ON3342491415e-09
Kwal_56.229853.253ON3463521407e-09
KLLA0F00528g7.2ON3812701408e-09
TPHA0H03100singletonON3922861363e-08
NDAI0H02950singletonON3633421344e-08
KNAG0E042007.2ON3852791345e-08
NDAI0A063203.253ON3492441345e-08
KAFR0C005803.253ON3342471311e-07
KAFR0I001707.3ON3812941302e-07
SAKL0D03872g3.253ON3483471255e-07
NDAI0G04880singletonON3613431255e-07
NDAI0H020607.2ON3992381231e-06
Kwal_47.17532na 5ON3732391221e-06
Skud_2.1623.253ON3342431193e-06
KLTH0C07854g3.253ON3583491194e-06
NCAS0D01220na 6ON3621571185e-06
KLLA0A10549g3.253ON3533551176e-06
NDAI0A08470singletonON3633831141e-05
KAFR0A08730singletonON3602471141e-05
NCAS0C03020singletonON3623571132e-05
KLLA0E19889gna 7ON3661751113e-05
CAGL0M14047gna 8ON3593441104e-05
KLTH0E07964gna 5ON3742211095e-05
SAKL0H22088gna 5ON3762231088e-05
CAGL0H06853gsingletonON3603431071e-04
ZYRO0A03366g3.253ON3493491061e-04
Suva_4.2793.253ON3342501051e-04
Suva_13.513na 8ON3603461061e-04
Skud_13.494na 8ON3603461033e-04
ABL090W3.253ON3342801024e-04
CAGL0H09944g3.253ON3333391015e-04
KLTH0B04972gna 7ON3603431015e-04
KLLA0F00638gna 9ON3822301016e-04
YMR318C (ADH6)na 8ON360349990.001
Smik_13.535na 8ON360349990.001
NCAS0I017303.253ON349261970.002
Suva_6.13singletonON6859860.003
SAKL0D14938gsingletonON378190930.005
ZYRO0G10318gna 5ON37692930.005
KNAG0B06990singletonON358343930.005
Ecym_1093singletonON383383930.006
KNAG0K02680singletonON359212910.010
Kpol_526.18singletonON361345900.011
NDAI0H02940na 6ON36195880.021
Skud_86.1singletonON8959810.024
SAKL0C00264gsingletonON35981870.027
TDEL0F02300na 5ON379239860.035
KAFR0H03770singletonON365108840.077
TDEL0A00140singletonON405263830.096
SAKL0H00374gsingletonON428102800.21
TPHA0F02090singletonON360125790.26
TBLA0A06640singletonON36196760.56
Kpol_1057.24na 10ON36080741.1
KLTH0C10538gsingletonON273144721.5
TPHA0A00140singletonON36295721.8
Smik_26.3singletonON12583682.0
Smik_14.1932.133ON376303722.1
Kwal_8.605singletonON379216703.8
KAFR0C01550singletonON35982694.0
Kwal_33.12956na 9ON411146694.9
KLTH0F14322g3.473ON90068695.4
Kwal_27.12835singletonON364216686.6
TPHA0E007307.413ON97860687.3
Suva_7.3434.207ON135880688.1
TDEL0E00230singletonON362106669.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D12342g
         (384 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D12342g Chr4 (1050181..1051335) [1155 bp, 384 aa] {ON} high...   759   0.0  
NCAS0A14160 Chr1 complement(2782022..2783377) [1356 bp, 451 aa] ...   649   0.0  
KLTH0H01254g Chr8 (121076..122221) [1146 bp, 381 aa] {ON} highly...   643   0.0  
TBLA0E00390 Chr5 complement(71890..73041) [1152 bp, 383 aa] {ON}      639   0.0  
Kwal_56.24642 s56 complement(1085556..1086701) [1146 bp, 381 aa]...   638   0.0  
SAKL0F11374g Chr6 complement(885478..886629) [1152 bp, 383 aa] {...   632   0.0  
Kpol_530.31 s530 (77132..78274) [1143 bp, 380 aa] {ON} (77132..7...   628   0.0  
Ecym_4723 Chr4 (1415078..1416223) [1146 bp, 381 aa] {ON} similar...   621   0.0  
YDL168W Chr4 (159604..160764) [1161 bp, 386 aa] {ON}  SFA1Bifunc...   618   0.0  
TDEL0C01980 Chr3 (344639..345796) [1158 bp, 385 aa] {ON} Anc_7.3...   617   0.0  
Skud_4.89 Chr4 (155298..156455) [1158 bp, 385 aa] {ON} YDL168W (...   617   0.0  
Smik_4.70 Chr4 (136242..137402) [1161 bp, 386 aa] {ON} YDL168W (...   612   0.0  
CAGL0L01111g Chr12 (133129..134274) [1146 bp, 381 aa] {ON} highl...   610   0.0  
Suva_4.78 Chr4 (147109..148266) [1158 bp, 385 aa] {ON} YDL168W (...   610   0.0  
TPHA0F02970 Chr6 complement(653405..654550) [1146 bp, 381 aa] {O...   603   0.0  
ZYRO0F11704g Chr6 complement(958546..959694) [1149 bp, 382 aa] {...   600   0.0  
ACL148C Chr3 complement(90932..92077) [1146 bp, 381 aa] {ON} Syn...   592   0.0  
KAFR0B00880 Chr2 complement(164475..165620) [1146 bp, 381 aa] {O...   589   0.0  
NDAI0A01890 Chr1 (425090..426358) [1269 bp, 422 aa] {ON} Anc_7.350    549   0.0  
KNAG0C03790 Chr3 complement(745394..746542) [1149 bp, 382 aa] {O...   530   0.0  
SAKL0A00880g Chr1 complement(92246..93412) [1167 bp, 388 aa] {ON...   441   e-154
KLLA0D19929g Chr4 (1694826..1695986) [1161 bp, 386 aa] {ON} weak...   114   7e-28
KLLA0B00451g Chr2 complement(31822..32982) [1161 bp, 386 aa] {ON...   105   1e-24
SAKL0C10164g Chr3 complement(914732..915787) [1056 bp, 351 aa] {...   102   7e-24
CAGL0J01441g Chr10 complement(134383..135501) [1119 bp, 372 aa] ...   102   2e-23
TBLA0I01140 Chr9 (233777..234910) [1134 bp, 377 aa] {ON} Anc_2.4...   101   4e-23
Ecym_5331 Chr5 (676233..677279) [1047 bp, 348 aa] {ON} similar t...   100   9e-23
AER032W Chr5 (696807..697862) [1056 bp, 351 aa] {ON} Syntenic ho...    99   1e-22
NCAS0I02350 Chr9 (444097..445152) [1056 bp, 351 aa] {ON} Anc_3.118     99   2e-22
SAKL0F06270g Chr6 (472877..473932) [1056 bp, 351 aa] {ON} simila...    97   7e-22
KLTH0G18986g Chr7 complement(1639254..1640318) [1065 bp, 354 aa]...    97   1e-21
KLLA0F21010g Chr6 (1962951..1964003) [1053 bp, 350 aa] {ON} unip...    97   1e-21
KNAG0K02000 Chr11 (410263..411315) [1053 bp, 350 aa] {ON} Anc_3....    96   1e-21
YBR145W Chr2 (533762..534817) [1056 bp, 351 aa] {ON}  ADH5Alcoho...    96   2e-21
KLTH0G15686g Chr7 complement(1367997..1369052) [1056 bp, 351 aa]...    95   3e-21
KAFR0G01420 Chr7 complement(314119..315174) [1056 bp, 351 aa] {O...    95   3e-21
NCAS0I01720 Chr9 (318144..319199) [1056 bp, 351 aa] {ON}               95   3e-21
Suva_4.394 Chr4 (702935..703990) [1056 bp, 351 aa] {ON} YBR145W ...    95   4e-21
CAGL0I07843g Chr9 complement(756345..757403) [1059 bp, 352 aa] {...    94   8e-21
SAKL0B08184g Chr2 (698686..699807) [1122 bp, 373 aa] {ON} unipro...    94   9e-21
KLLA0B09064g Chr2 complement(792849..793973) [1125 bp, 374 aa] {...    94   2e-20
SAKL0B00814g Chr2 (74565..75629) [1065 bp, 354 aa] {ON} similar ...    93   2e-20
KLLA0F18260g Chr6 complement(1683417..1684463) [1047 bp, 348 aa]...    93   2e-20
KLTH0D05588g Chr4 complement(502176..503345) [1170 bp, 389 aa] {...    93   3e-20
Skud_13.240 Chr13 (408909..410036) [1128 bp, 375 aa] {ON} YMR083...    92   4e-20
Smik_13.520 Chr13 complement(856008..857054) [1047 bp, 348 aa] {...    92   4e-20
Skud_13.477 Chr13 complement(846790..847836) [1047 bp, 348 aa] {...    92   5e-20
KLTH0E05588g Chr5 complement(494815..495861) [1047 bp, 348 aa] {...    92   6e-20
Ecym_7391 Chr7 (801773..802900) [1128 bp, 375 aa] {ON} similar t...    92   9e-20
ZYRO0B05940g Chr2 (480279..481418) [1140 bp, 379 aa] {ON} highly...    91   1e-19
KLLA0F13530g Chr6 (1251162..1252289) [1128 bp, 375 aa] {ON} unip...    91   2e-19
KAFR0A00790 Chr1 complement(140666..141799) [1134 bp, 377 aa] {O...    91   2e-19
NDAI0A06930 Chr1 (1585575..1586630) [1056 bp, 351 aa] {ON} Anc_3...    90   2e-19
Kpol_1058.11 s1058 (41165..42226) [1062 bp, 353 aa] {ON} (41165....    90   3e-19
TPHA0G03210 Chr7 complement(688137..689270) [1134 bp, 377 aa] {O...    90   3e-19
YOL086C Chr15 complement(159548..160594) [1047 bp, 348 aa] {ON} ...    89   5e-19
TBLA0E03430 Chr5 (850493..851548) [1056 bp, 351 aa] {ON}               89   6e-19
Skud_15.68 Chr15 complement(118795..119841) [1047 bp, 348 aa] {O...    89   7e-19
KAFR0L02010 Chr12 (379623..380678) [1056 bp, 351 aa] {ON}              88   1e-18
TBLA0E03440 Chr5 (852767..853822) [1056 bp, 351 aa] {ON} Anc_3.1...    88   1e-18
Smik_15.71 Chr15 complement(122645..123691) [1047 bp, 348 aa] {O...    88   1e-18
NDAI0H02160 Chr8 (528551..529696) [1146 bp, 381 aa] {ON} Anc_2.480     88   1e-18
Suva_13.494 Chr13 complement(856051..857097) [1047 bp, 348 aa] {...    88   1e-18
Skud_2.272 Chr2 (501260..502315) [1056 bp, 351 aa] {ON} YBR145W ...    88   1e-18
TDEL0C00390 Chr3 (53995..55056) [1062 bp, 353 aa] {ON} Anc_8.16 ...    87   2e-18
YMR083W Chr13 (434788..435915) [1128 bp, 375 aa] {ON}  ADH3Mitoc...    87   3e-18
Kwal_56.23198 s56 (443881..444936) [1056 bp, 351 aa] {ON} YOL086...    87   3e-18
AAR084W Chr1 (494021..495178) [1158 bp, 385 aa] {ON} Non-synteni...    87   3e-18
KLTH0D00616g Chr4 (59883..61031) [1149 bp, 382 aa] {ON} similar ...    87   4e-18
TPHA0M00730 Chr13 complement(137798..138850) [1053 bp, 350 aa] {...    86   4e-18
SAKL0E02838g Chr5 (226264..227397) [1134 bp, 377 aa] {ON} unipro...    87   5e-18
Smik_2.284 Chr2 (518341..519396) [1056 bp, 351 aa] {ON} YBR145W ...    86   5e-18
TDEL0D05050 Chr4 (921065..922120) [1056 bp, 351 aa] {ON} Anc_3.1...    86   5e-18
Suva_13.261 Chr13 (416378..417505) [1128 bp, 375 aa] {ON} YMR083...    86   7e-18
YMR303C Chr13 complement(873291..874337) [1047 bp, 348 aa] {ON} ...    86   7e-18
Smik_13.266 Chr13 (418869..419996) [1128 bp, 375 aa] {ON} YMR083...    86   9e-18
Suva_15.81 Chr15 complement(132739..133785) [1047 bp, 348 aa] {O...    85   1e-17
Kwal_26.7799 s26 complement(515580..516743) [1164 bp, 387 aa] {O...    86   1e-17
Kpol_1036.19 s1036 (51276..52337) [1062 bp, 353 aa] {ON} (51276....    85   1e-17
NCAS0A07780 Chr1 (1548197..1549318) [1122 bp, 373 aa] {ON} Anc_2...    85   2e-17
ZYRO0G03388g Chr7 complement(265952..267064) [1113 bp, 370 aa] {...    85   2e-17
KLTH0A00418g Chr1 complement(34685..35755) [1071 bp, 356 aa] {ON...    84   2e-17
Kpol_431.8 s431 (21043..22185) [1143 bp, 380 aa] {ON} (21043..22...    84   3e-17
YAL060W Chr1 (35155..36303) [1149 bp, 382 aa] {ON}  BDH1NAD-depe...    84   3e-17
KLLA0F00506g Chr6 complement(36518..37675) [1158 bp, 385 aa] {ON...    84   3e-17
CAGL0D00198g Chr4 (27559..28710) [1152 bp, 383 aa] {ON} similar ...    84   4e-17
ABL033C Chr2 complement(337866..338987) [1122 bp, 373 aa] {ON} S...    84   4e-17
ZYRO0C12562g Chr3 (993434..994480) [1047 bp, 348 aa] {ON} highly...    83   5e-17
TDEL0A02560 Chr1 complement(462053..463174) [1122 bp, 373 aa] {O...    83   7e-17
Kwal_26.6739 s26 (46044..47192) [1149 bp, 382 aa] {ON} YAL060W (...    83   7e-17
Smik_1.6 Chr1 (18115..19263) [1149 bp, 382 aa] {ON} YAL060W (REAL)     82   1e-16
Skud_1.3 Chr1 (11174..12322) [1149 bp, 382 aa] {ON} YAL060W (REAL)     82   1e-16
ZYRO0G03410g Chr7 complement(269170..270291) [1122 bp, 373 aa] {...    82   2e-16
KNAG0K01040 Chr11 complement(204636..205811) [1176 bp, 391 aa] {...    82   2e-16
KAFR0L02000 Chr12 (378013..379098) [1086 bp, 361 aa] {ON}              81   2e-16
Kwal_55.19574 s55 complement(32260..33330) [1071 bp, 356 aa] {ON...    80   4e-16
TDEL0H04460 Chr8 complement(769988..771136) [1149 bp, 382 aa] {O...    80   5e-16
TDEL0F03190 Chr6 (583849..584904) [1056 bp, 351 aa] {ON}  possib...    80   7e-16
NCAS0J00300 Chr10 (43719..44792) [1074 bp, 357 aa] {ON} Anc_8.16       80   7e-16
Skud_20.2 Chr20 (1588..2661) [1074 bp, 357 aa] {ON} YJR159W (REAL)     80   8e-16
Skud_4.2 Chr4 complement(6287..7360) [1074 bp, 357 aa] {ON} YJR1...    80   8e-16
Suva_1.7 Chr1 (12310..13458) [1149 bp, 382 aa] {ON} YAL060W (REAL)     79   1e-15
Suva_10.154 Chr10 complement(275737..276807) [1071 bp, 356 aa] {...    79   1e-15
SAKL0D14872g Chr4 complement(1226093..1227244) [1152 bp, 383 aa]...    79   2e-15
Smik_48.1 Chr48 complement(1..1074) [1074 bp, 357 aa] {ON} YJR15...    79   2e-15
NDAI0H02050 Chr8 complement(500914..502071) [1158 bp, 385 aa] {O...    79   2e-15
ZYRO0F02552g Chr6 (203037..204092) [1056 bp, 351 aa] {ON} simila...    78   3e-15
KNAG0E02590 Chr5 complement(513565..514689) [1125 bp, 374 aa] {O...    78   4e-15
YJR159W Chr10 (736044..737117) [1074 bp, 357 aa] {ON}  SOR1Sorbi...    77   5e-15
ABR229C Chr2 complement(831895..832956) [1062 bp, 353 aa] {ON} S...    77   5e-15
Kwal_26.6684 s26 (21910..22980) [1071 bp, 356 aa] {ON} YJR159W (...    77   6e-15
Kwal_55.20564 s55 complement(459253..459903) [651 bp, 216 aa] {O...    75   7e-15
YLR070C Chr12 complement(274141..275211) [1071 bp, 356 aa] {ON} ...    77   7e-15
TBLA0A04290 Chr1 (1063289..1064476) [1188 bp, 395 aa] {ON} Anc_7...    77   9e-15
YDL246C Chr4 complement(8683..9756) [1074 bp, 357 aa] {ON}  SOR2...    76   1e-14
Suva_12.260 Chr12 (427406..428479) [1074 bp, 357 aa] {ON} YJR159...    75   3e-14
Kpol_1049.18 s1049 complement(35191..36351) [1161 bp, 386 aa] {O...    75   4e-14
SAKL0D14894g Chr4 complement(1230497..1231654) [1158 bp, 385 aa]...    73   1e-13
KNAG0I00120 Chr9 (9352..10497) [1146 bp, 381 aa] {ON}                  70   1e-12
NCAS0A07670 Chr1 complement(1527273..1528592) [1320 bp, 439 aa] ...    70   3e-12
NCAS0A07660 Chr1 complement(1525755..1526915) [1161 bp, 386 aa] ...    69   4e-12
YAL061W Chr1 (33448..34701) [1254 bp, 417 aa] {ON}  BDH2Putative...    69   5e-12
KLLA0D05511g Chr4 complement(476363..477427) [1065 bp, 354 aa] {...    68   7e-12
KAFR0I00160 Chr9 (33043..34200) [1158 bp, 385 aa] {ON} Anc_7.2 Y...    66   3e-11
TDEL0D03720 Chr4 (683833..684840) [1008 bp, 335 aa] {ON} Anc_3.2...    64   1e-10
Suva_1.6 Chr1 (10591..11844) [1254 bp, 417 aa] {ON} YAL061W (REAL)     65   1e-10
Skud_1.2 Chr1 (9513..10766) [1254 bp, 417 aa] {ON} YAL061W (REAL)      64   2e-10
YBR046C Chr2 complement(330507..331511) [1005 bp, 334 aa] {ON}  ...    62   4e-10
Smik_1.5 Chr1 (16385..17638) [1254 bp, 417 aa] {ON} YAL061W (REAL)     63   4e-10
KNAG0D00110 Chr4 (3538..4626) [1089 bp, 362 aa] {ON}                   60   3e-09
Smik_2.170 Chr2 complement(312211..313215) [1005 bp, 334 aa] {ON...    59   5e-09
Kwal_56.22985 s56 complement(357501..358541) [1041 bp, 346 aa] {...    59   7e-09
KLLA0F00528g Chr6 complement(40081..41226) [1146 bp, 381 aa] {ON...    59   8e-09
TPHA0H03100 Chr8 complement(736924..738102) [1179 bp, 392 aa] {O...    57   3e-08
NDAI0H02950 Chr8 complement(718762..719853) [1092 bp, 363 aa] {O...    56   4e-08
KNAG0E04200 Chr5 complement(837232..838389) [1158 bp, 385 aa] {O...    56   5e-08
NDAI0A06320 Chr1 (1438393..1439442) [1050 bp, 349 aa] {ON} Anc_3...    56   5e-08
KAFR0C00580 Chr3 (113544..114548) [1005 bp, 334 aa] {ON} Anc_3.2...    55   1e-07
KAFR0I00170 Chr9 (34519..35664) [1146 bp, 381 aa] {ON} Anc_7.3 Y...    55   2e-07
SAKL0D03872g Chr4 (316127..317173) [1047 bp, 348 aa] {ON} highly...    53   5e-07
NDAI0G04880 Chr7 complement(1175518..1176603) [1086 bp, 361 aa] ...    53   5e-07
NDAI0H02060 Chr8 complement(502872..504071) [1200 bp, 399 aa] {O...    52   1e-06
Kwal_47.17532 s47 (444594..445715) [1122 bp, 373 aa] {ON} YMR318...    52   1e-06
Skud_2.162 Chr2 complement(299642..300646) [1005 bp, 334 aa] {ON...    50   3e-06
KLTH0C07854g Chr3 (673945..675021) [1077 bp, 358 aa] {ON} simila...    50   4e-06
NCAS0D01220 Chr4 (223821..224909) [1089 bp, 362 aa] {ON}               50   5e-06
KLLA0A10549g Chr1 (921022..922083) [1062 bp, 353 aa] {ON} highly...    50   6e-06
NDAI0A08470 Chr1 (1954035..1955126) [1092 bp, 363 aa] {ON}             49   1e-05
KAFR0A08730 Chr1 complement(1747657..1748739) [1083 bp, 360 aa] ...    49   1e-05
NCAS0C03020 Chr3 complement(593785..594873) [1089 bp, 362 aa] {O...    48   2e-05
KLLA0E19889g Chr5 (1770061..1771161) [1101 bp, 366 aa] {ON} simi...    47   3e-05
CAGL0M14047g Chr13 complement(1386775..1387854) [1080 bp, 359 aa...    47   4e-05
KLTH0E07964g Chr5 (735214..736338) [1125 bp, 374 aa] {ON} simila...    47   5e-05
SAKL0H22088g Chr8 (1934171..1935301) [1131 bp, 376 aa] {ON} simi...    46   8e-05
CAGL0H06853g Chr8 complement(680184..681266) [1083 bp, 360 aa] {...    46   1e-04
ZYRO0A03366g Chr1 (271779..272828) [1050 bp, 349 aa] {ON} highly...    45   1e-04
Suva_4.279 Chr4 complement(495380..496384) [1005 bp, 334 aa] {ON...    45   1e-04
Suva_13.513 Chr13 complement(894394..895476) [1083 bp, 360 aa] {...    45   1e-04
Skud_13.494 Chr13 complement(884038..885120) [1083 bp, 360 aa] {...    44   3e-04
ABL090W Chr2 (230699..231703) [1005 bp, 334 aa] {ON} Syntenic ho...    44   4e-04
CAGL0H09944g Chr8 complement(971519..972520) [1002 bp, 333 aa] {...    44   5e-04
KLTH0B04972g Chr2 (408153..409235) [1083 bp, 360 aa] {ON} highly...    44   5e-04
KLLA0F00638g Chr6 (51849..52997) [1149 bp, 382 aa] {ON} weakly s...    44   6e-04
YMR318C Chr13 complement(911061..912143) [1083 bp, 360 aa] {ON} ...    43   0.001
Smik_13.535 Chr13 complement(893727..894809) [1083 bp, 360 aa] {...    43   0.001
NCAS0I01730 Chr9 (319449..320498) [1050 bp, 349 aa] {ON} Anc_3.253     42   0.002
Suva_6.13 Chr6 (21861..22031,22035..22067) [204 bp, 68 aa] {ON} ...    38   0.003
SAKL0D14938g Chr4 complement(1235542..1236678) [1137 bp, 378 aa]...    40   0.005
ZYRO0G10318g Chr7 (831554..832684) [1131 bp, 376 aa] {ON} simila...    40   0.005
KNAG0B06990 Chr2 (1393058..1394134) [1077 bp, 358 aa] {ON}             40   0.005
Ecym_1093 Chr1 complement(195854..197005) [1152 bp, 383 aa] {ON}...    40   0.006
KNAG0K02680 Chr11 complement(531173..532252) [1080 bp, 359 aa] {...    40   0.010
Kpol_526.18 s526 (51360..52445) [1086 bp, 361 aa] {ON} (51360..5...    39   0.011
NDAI0H02940 Chr8 complement(717073..718158) [1086 bp, 361 aa] {O...    39   0.021
Skud_86.1 Chr86 complement(469..738) [270 bp, 89 aa] {ON} YJR159...    36   0.024
SAKL0C00264g Chr3 complement(17429..18508) [1080 bp, 359 aa] {ON...    38   0.027
TDEL0F02300 Chr6 complement(421372..422511) [1140 bp, 379 aa] {O...    38   0.035
KAFR0H03770 Chr8 complement(715399..716496) [1098 bp, 365 aa] {O...    37   0.077
TDEL0A00140 Chr1 (23016..24233) [1218 bp, 405 aa] {ON}                 37   0.096
SAKL0H00374g Chr8 (45725..47011) [1287 bp, 428 aa] {ON} weakly s...    35   0.21 
TPHA0F02090 Chr6 (465913..466995) [1083 bp, 360 aa] {ON}               35   0.26 
TBLA0A06640 Chr1 (1621352..1622437) [1086 bp, 361 aa] {ON}             34   0.56 
Kpol_1057.24 s1057 (53467..54549) [1083 bp, 360 aa] {ON} (53467....    33   1.1  
KLTH0C10538g Chr3 complement(873623..874444) [822 bp, 273 aa] {O...    32   1.5  
TPHA0A00140 Chr1 (14857..15945) [1089 bp, 362 aa] {ON}                 32   1.8  
Smik_26.3 Chr26 (2136..2513) [378 bp, 125 aa] {ON} YMR318C (REAL)      31   2.0  
Smik_14.193 Chr14 complement(352041..353171) [1131 bp, 376 aa] {...    32   2.1  
Kwal_8.605 s8 (25017..26156) [1140 bp, 379 aa] {ON} YCR105W - Hy...    32   3.8  
KAFR0C01550 Chr3 complement(318350..319429) [1080 bp, 359 aa] {O...    31   4.0  
Kwal_33.12956 s33 complement(14925..16160) [1236 bp, 411 aa] {ON...    31   4.9  
KLTH0F14322g Chr6 (1174310..1177012) [2703 bp, 900 aa] {ON} simi...    31   5.4  
Kwal_27.12835 s27 complement(1395770..1396864) [1095 bp, 364 aa]...    31   6.6  
TPHA0E00730 Chr5 (139190..142126) [2937 bp, 978 aa] {ON} Anc_7.4...    31   7.3  
Suva_7.343 Chr7 complement(587041..591117) [4077 bp, 1358 aa] {O...    31   8.1  
TDEL0E00230 Chr5 (36310..37398) [1089 bp, 362 aa] {ON}   Added 3...    30   9.8  

>KLLA0D12342g Chr4 (1050181..1051335) [1155 bp, 384 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 384

 Score =  759 bits (1959), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/384 (96%), Positives = 372/384 (96%)

Query: 1   MTSATAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVD 60
           MTSATAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVD
Sbjct: 1   MTSATAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVD 60

Query: 61  PEGAFPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRA 120
           PEGAFPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRA
Sbjct: 61  PEGAFPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRA 120

Query: 121 TQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCG 180
           TQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCG
Sbjct: 121 TQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCG 180

Query: 181 VTTGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDF 240
           VTTGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDF
Sbjct: 181 VTTGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDF 240

Query: 241 GATGFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHKGWGQSXXX 300
           GATGFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHKGWGQS   
Sbjct: 241 GATGFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHKGWGQSIII 300

Query: 301 XXXXXXXXXSTRPFQLITGRVWKGSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPF 360
                    STRPFQLITGRVWKGSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPF
Sbjct: 301 GVAAAGEEISTRPFQLITGRVWKGSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPF 360

Query: 361 TEINNAFEDLHHGDCLRTVLDLAN 384
           TEINNAFEDLHHGDCLRTVLDLAN
Sbjct: 361 TEINNAFEDLHHGDCLRTVLDLAN 384

>NCAS0A14160 Chr1 complement(2782022..2783377) [1356 bp, 451 aa]
           {ON} Anc_7.350
          Length = 451

 Score =  649 bits (1675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/381 (83%), Positives = 346/381 (90%)

Query: 3   SATAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPE 62
           S+T GKPI C AAVAY AGKPLTVE+I+VD PKAHEVR+++ +TAVCHTDAYTLSG+DPE
Sbjct: 70  SSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDPE 129

Query: 63  GAFPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRATQ 122
           GAFPSILGHEG+GIVESVG+GVTNVKVGDHV+ LYTAECGKCKFCKS KTNLCGSVRATQ
Sbjct: 130 GAFPSILGHEGSGIVESVGEGVTNVKVGDHVIALYTAECGKCKFCKSGKTNLCGSVRATQ 189

Query: 123 GKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVT 182
           GKGVMPDGT+RFHN KGEPLLHFMGCSTFSQYTVVADVS+V +DP APL S+ LLGCGVT
Sbjct: 190 GKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTVVADVSVVAVDPKAPLDSISLLGCGVT 249

Query: 183 TGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGA 242
           TGYGAA+KTANVQ+GDTVAVFGAGTVGLSVVQGAKSRGASKIIVVD+N+ KKQWS DFGA
Sbjct: 250 TGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGA 309

Query: 243 TGFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHKGWGQSXXXXX 302
           T FVNP +DLKEGETIV KLI+MTDGGL++TFDCTGNVKVMRDALEACHKGWG+S     
Sbjct: 310 TDFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHKGWGESIIIGV 369

Query: 303 XXXXXXXSTRPFQLITGRVWKGSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPFTE 362
                  STRPFQL+TGRVWKGSAFGGIKGRSEMG L+  YQ G LKVD+FITH+RPFTE
Sbjct: 370 AGAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHRRPFTE 429

Query: 363 INNAFEDLHHGDCLRTVLDLA 383
           IN+AFEDLHHGDCLRTVLDLA
Sbjct: 430 INDAFEDLHHGDCLRTVLDLA 450

>KLTH0H01254g Chr8 (121076..122221) [1146 bp, 381 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 381

 Score =  643 bits (1659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/380 (81%), Positives = 336/380 (88%)

Query: 5   TAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPEGA 64
           + GKPI C AAVAYEAGKPLTVE+I+VD PKAHEVR++V +TAVCHTDAYTLSGVDPEGA
Sbjct: 2   SEGKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGA 61

Query: 65  FPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRATQGK 124
           FPSILGHEGAG+VESVG+GVTNVK GDHV+ LYTAEC +CKFCKS KTNLCGSVRATQGK
Sbjct: 62  FPSILGHEGAGVVESVGEGVTNVKAGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGK 121

Query: 125 GVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTG 184
           GVMPDGT+RFHN KGE LLHFMGCSTFSQYTVVADVS+V IDP APL   CLLGCGVTTG
Sbjct: 122 GVMPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTG 181

Query: 185 YGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATG 244
           YGAAVKTA+VQ+GDTVA+FGAGTVGLSVVQGA  RGASKIIVVD+NDQKKQWS+DFGAT 
Sbjct: 182 YGAAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATD 241

Query: 245 FVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHKGWGQSXXXXXXX 304
           FVNP K LK+G+TIV KL++MTDGGLDFTFDCTGN  VMR ALEACHKGWGQS       
Sbjct: 242 FVNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAA 301

Query: 305 XXXXXSTRPFQLITGRVWKGSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPFTEIN 364
                STRPFQL+TGRVWKGSAFGGIKGRSEMG LV+ Y  G LKVD+FITH+R FT+IN
Sbjct: 302 AGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDIN 361

Query: 365 NAFEDLHHGDCLRTVLDLAN 384
           +AFEDLHHGDCLRTVLDL+ 
Sbjct: 362 SAFEDLHHGDCLRTVLDLSK 381

>TBLA0E00390 Chr5 complement(71890..73041) [1152 bp, 383 aa] {ON} 
          Length = 383

 Score =  639 bits (1649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/380 (80%), Positives = 340/380 (89%)

Query: 3   SATAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPE 62
           S T GKPI+C+AAVAY+A +PLTVE+IIV+ P+AHEVR+++THTAVCHTDAYTLSGVDPE
Sbjct: 2   SETQGKPIKCLAAVAYKAAEPLTVEEIIVEPPEAHEVRIKITHTAVCHTDAYTLSGVDPE 61

Query: 63  GAFPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRATQ 122
           GAFP +LGHEG+GIVESVG+GV++VKVGDHV+ LYTAECG CKFCKS KTNLCGSVR TQ
Sbjct: 62  GAFPCVLGHEGSGIVESVGEGVSSVKVGDHVIALYTAECGVCKFCKSGKTNLCGSVRETQ 121

Query: 123 GKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVT 182
           GKGVMPDGT+RF NLKGE LLHFMGCSTFSQYTVVADVS+V I+ +APL SVCLLGCGVT
Sbjct: 122 GKGVMPDGTSRFKNLKGESLLHFMGCSTFSQYTVVADVSVVAINKTAPLQSVCLLGCGVT 181

Query: 183 TGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGA 242
           TGYGAA+KTANVQ+ DTVAVFGAGTVGLSVVQGA++RGASKII+VDVN +K+ +S  FGA
Sbjct: 182 TGYGAAIKTANVQKNDTVAVFGAGTVGLSVVQGAQARGASKIIMVDVNSKKETYSRQFGA 241

Query: 243 TGFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHKGWGQSXXXXX 302
           T F+NP+ DLK GETIVSKL++MTDGGLD TFDCTGNVKVMRDALE CHKGWGQS     
Sbjct: 242 TDFINPMTDLKPGETIVSKLVEMTDGGLDHTFDCTGNVKVMRDALECCHKGWGQSIIIGV 301

Query: 303 XXXXXXXSTRPFQLITGRVWKGSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPFTE 362
                  STRPFQL+TGRVWKGSAFGG+KGRSEMG L+ SYQKGDLKVD FIT+KRPFTE
Sbjct: 302 AAAGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMGGLIESYQKGDLKVDQFITNKRPFTE 361

Query: 363 INNAFEDLHHGDCLRTVLDL 382
           IN AFEDLHHGDCLRTVLDL
Sbjct: 362 INAAFEDLHHGDCLRTVLDL 381

>Kwal_56.24642 s56 complement(1085556..1086701) [1146 bp, 381 aa]
           {ON} YDL168W (SFA1) - Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
           [contig 161] FULL
          Length = 381

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/378 (80%), Positives = 336/378 (88%)

Query: 5   TAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPEGA 64
           + GKPI C+AAVAYEAGKPLT+E+I+VD PKAHEVRV++ +TAVCHTDAYTLSGVDPEGA
Sbjct: 2   SEGKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGA 61

Query: 65  FPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRATQGK 124
           FPSILGHEGAGIVES+G+GVTNVK GDHV+ LYTAEC +CKFCKS KTNLCGSVRATQGK
Sbjct: 62  FPSILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGK 121

Query: 125 GVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTG 184
           GVMPDGTTRFHN KGE +LHFMGCSTFSQYTV+ADVS+V IDP APL   CLLGCGVTTG
Sbjct: 122 GVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTG 181

Query: 185 YGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATG 244
           YGAAVKTANVQ+GDTVAVFGAGTVGLSVVQGAK RGAS+IIVVD+NDQKKQW+ +FGAT 
Sbjct: 182 YGAAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATD 241

Query: 245 FVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHKGWGQSXXXXXXX 304
           FVNP KDLK+G+TIV  L++MTDGGLD+TFDCTGN  VMR ALEACHKGWG+S       
Sbjct: 242 FVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAA 301

Query: 305 XXXXXSTRPFQLITGRVWKGSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPFTEIN 364
                STRPFQL+TGRVWKGSAFGGIKGRSEMG L++ Y  G LKVD+FITH+R FT+IN
Sbjct: 302 AGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDIN 361

Query: 365 NAFEDLHHGDCLRTVLDL 382
           +AFEDLHHGDCLRTVLDL
Sbjct: 362 SAFEDLHHGDCLRTVLDL 379

>SAKL0F11374g Chr6 complement(885478..886629) [1152 bp, 383 aa] {ON}
           highly similar to uniprot|P32771 Saccharomyces
           cerevisiae YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 383

 Score =  632 bits (1631), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/382 (81%), Positives = 339/382 (88%)

Query: 3   SATAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPE 62
           S T GKPI C+AAVAYEAGKPLTVE+IIV+ PKAHEVR+++T+TAVCHTDAYTLSGVDPE
Sbjct: 2   SETVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDPE 61

Query: 63  GAFPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRATQ 122
           GAFPSILGHEGAG+VESVG GVTNVK GDHVV LYTAEC KCKFC S KTNLCGSVRATQ
Sbjct: 62  GAFPSILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRATQ 121

Query: 123 GKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVT 182
           GKGVMPDGT+RF    GE +LHFMGCSTFSQYTVVADVS+V +D  APL  +CLLGCGVT
Sbjct: 122 GKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTVVADVSVVAVDSQAPLDRICLLGCGVT 181

Query: 183 TGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGA 242
           TGYGAA+KTANVQ+GDTVAVFGAGTVGLSVVQGAK+RGAS+IIVVD+NDQKKQW+ DFGA
Sbjct: 182 TGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGA 241

Query: 243 TGFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHKGWGQSXXXXX 302
           T FVNP KDLKEGETIVSKLI++TDGGLDFTFDCTGN KVMRDALEACHKGWGQS     
Sbjct: 242 TDFVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGV 301

Query: 303 XXXXXXXSTRPFQLITGRVWKGSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPFTE 362
                  STRPFQL+TGRVWKGSAFGGIKGRSEMG LV+ Y  G LKVD+FITH+RPFTE
Sbjct: 302 AAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFTE 361

Query: 363 INNAFEDLHHGDCLRTVLDLAN 384
           IN AF+DLHHGDCLRTVLDL+ 
Sbjct: 362 INAAFDDLHHGDCLRTVLDLSK 383

>Kpol_530.31 s530 (77132..78274) [1143 bp, 380 aa] {ON}
           (77132..78274) [1143 nt, 381 aa]
          Length = 380

 Score =  628 bits (1620), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/379 (79%), Positives = 331/379 (87%), Gaps = 1/379 (0%)

Query: 4   ATAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPEG 63
           +T GKPI C AAVAYEA KPL VE+I+VD PKAHEVR+++ +TAVCHTDAYTLSGVDPEG
Sbjct: 2   STVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEG 61

Query: 64  AFPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRATQG 123
            FP +LGHEG+GIVESVGD VT VK GDHVV LYTAECGKCKFC S KTNLCGSVRATQG
Sbjct: 62  LFPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQG 121

Query: 124 KGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTT 183
           KGVMPDGT RFHN KGEPL HFMGCSTFS+YTVVADVS+V IDP+APL SVCLLGCGVTT
Sbjct: 122 KGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTT 181

Query: 184 GYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGAT 243
           GYGAA+KTANVQ+GDTVAVFGAGTVGLSVVQGAKSRGASKIIVVD+N+ KK+WS +FGAT
Sbjct: 182 GYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGAT 241

Query: 244 GFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHKGWGQSXXXXXX 303
            FVNP  +L EG+ IVSKL++MTDGGLDFTFDCTGNV VMRDALEACHKGWGQS      
Sbjct: 242 DFVNP-SELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVA 300

Query: 304 XXXXXXSTRPFQLITGRVWKGSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPFTEI 363
                 STRPFQL+TGRVWKGSAFGGIKGRSEMG L+  YQ G LKVD+FIT++RPF EI
Sbjct: 301 AAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVEI 360

Query: 364 NNAFEDLHHGDCLRTVLDL 382
           N+AFE+LHHG+CLRTVL  
Sbjct: 361 NDAFEELHHGNCLRTVLSF 379

>Ecym_4723 Chr4 (1415078..1416223) [1146 bp, 381 aa] {ON} similar to
           Ashbya gossypii ACL148C
          Length = 381

 Score =  621 bits (1601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/380 (78%), Positives = 327/380 (86%)

Query: 3   SATAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPE 62
           S TAGK I+C AA+AY AG PL +E I VD PKAHEVR+++THTA+CHTDAYTLSGVDPE
Sbjct: 2   SITAGKTIQCKAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPE 61

Query: 63  GAFPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRATQ 122
           G FPSILGHEG+GIVESVG GVTNVKVGDHV+ LYTAEC +CKFC S KTNLCGSVRATQ
Sbjct: 62  GIFPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRATQ 121

Query: 123 GKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVT 182
           GKG+MPDGT+RF N KGE + HFMGCSTFS+YTVVADVS+V ID  APL  VCLLGCGVT
Sbjct: 122 GKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVT 181

Query: 183 TGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGA 242
           TGYGAAVKTA+VQ+GDTVAVFGAGTVGLSVVQGA+SRGASKIIVVD+ND KK+WS DFGA
Sbjct: 182 TGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGA 241

Query: 243 TGFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHKGWGQSXXXXX 302
           T F+NP KDL +GETIVSKLIDMTDGGLD TFDCTGN KVMRDALEACHKGWGQS     
Sbjct: 242 TDFINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGV 301

Query: 303 XXXXXXXSTRPFQLITGRVWKGSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPFTE 362
                  STRPFQL+TGRVWKGSAFGGIKGRSEMG L++ Y  G LKVD+F+TH RPF+E
Sbjct: 302 AAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFSE 361

Query: 363 INNAFEDLHHGDCLRTVLDL 382
           IN+   DLHHGDCLRTVL+ 
Sbjct: 362 INDGLTDLHHGDCLRTVLNF 381

>YDL168W Chr4 (159604..160764) [1161 bp, 386 aa] {ON}
           SFA1Bifunctional enzyme containing both alcohol
           dehydrogenase and glutathione-dependent formaldehyde
           dehydrogenase activities, functions in formaldehyde
           detoxification and formation of long chain and complex
           alcohols, regulated by Hog1p-Sko1p
          Length = 386

 Score =  618 bits (1593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/380 (76%), Positives = 329/380 (86%)

Query: 1   MTSATAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVD 60
           M++AT GKPI+C+AAVAY+A KPL+VE+I VDAPKAHEVR+++ +TAVCHTDAYTLSG D
Sbjct: 1   MSAATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60

Query: 61  PEGAFPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRA 120
           PEG FP +LGHEGAGIVESVGD V  VK GDHV+ LYTAECGKCKFC S KTNLCG+VRA
Sbjct: 61  PEGLFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRA 120

Query: 121 TQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCG 180
           TQGKGVMPDGTTRFHN KGE + HFMGCSTFS+YTVVADVS+V IDP APL + CLLGCG
Sbjct: 121 TQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCG 180

Query: 181 VTTGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDF 240
           VTTG+GAA+KTANVQ+GDTVAVFG GTVGLSV+QGAK RGASKII +D+N++KKQ+   F
Sbjct: 181 VTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAIDINNKKKQYCSQF 240

Query: 241 GATGFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHKGWGQSXXX 300
           GAT FVNP +DL + +TIV KLI+MTDGGLDFTFDCTGN K+MRDALEACHKGWGQS   
Sbjct: 241 GATDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIII 300

Query: 301 XXXXXXXXXSTRPFQLITGRVWKGSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPF 360
                    STRPFQL+TGRVWKGSAFGGIKGRSEMG L+  YQKG LKV++FITH+RPF
Sbjct: 301 GVAAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPF 360

Query: 361 TEINNAFEDLHHGDCLRTVL 380
            EIN AFEDLH+GDCLRTVL
Sbjct: 361 KEINQAFEDLHNGDCLRTVL 380

>TDEL0C01980 Chr3 (344639..345796) [1158 bp, 385 aa] {ON} Anc_7.350
           YDL168W
          Length = 385

 Score =  617 bits (1591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/380 (79%), Positives = 336/380 (88%)

Query: 3   SATAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPE 62
           +AT GK I CVAAVAYEAGKPLTVE+I V+AP+AHEVR+++ +TAVCHTDAYTLSGVDPE
Sbjct: 4   AATEGKSITCVAAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPE 63

Query: 63  GAFPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRATQ 122
           GAFPSILGHEGAGIVESVG+GVTNVK GDHV+ LYTAEC KCKFCKS KTNLC SVRATQ
Sbjct: 64  GAFPSILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQ 123

Query: 123 GKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVT 182
           GKGVMPDGT+RF N KGE L HFMGCSTFSQYTVVADVS+V +DPSAPL S+CLLGCGVT
Sbjct: 124 GKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTVVADVSVVAVDPSAPLESICLLGCGVT 183

Query: 183 TGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGA 242
           TGYGAA KTANVQ+GDTVAVFGAGTVGLSV+QGAK RGAS+II+VD+NDQK+++  +FGA
Sbjct: 184 TGYGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGA 243

Query: 243 TGFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHKGWGQSXXXXX 302
           T F+NP  DLK+G+TIV KLI+MTDGGLD+TFDCTGN KVMRDALEACHKGWG S     
Sbjct: 244 TDFINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGV 303

Query: 303 XXXXXXXSTRPFQLITGRVWKGSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPFTE 362
                  STRPFQL+TGRVWKGSAFGGIKGRSEMG L+  Y+KG LKVD+FIT++RPFTE
Sbjct: 304 AAAEEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTE 363

Query: 363 INNAFEDLHHGDCLRTVLDL 382
           IN AFEDLH GDCLRTVLDL
Sbjct: 364 INKAFEDLHAGDCLRTVLDL 383

>Skud_4.89 Chr4 (155298..156455) [1158 bp, 385 aa] {ON} YDL168W
           (REAL)
          Length = 385

 Score =  617 bits (1590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/380 (77%), Positives = 324/380 (85%)

Query: 1   MTSATAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVD 60
           M +AT GKPI+CVAAVAY A K L+VE+I VD PKAHEVR+++  TAVCHTDAYTLSG D
Sbjct: 1   MLAATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSD 60

Query: 61  PEGAFPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRA 120
           PEG FP ILGHEGAGIVESVGD V  VK GDHV+ LYTAECGKCKFC S KTNLC +VRA
Sbjct: 61  PEGLFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRA 120

Query: 121 TQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCG 180
           TQGKGVMPDGTTRFHN KGE + HFMGCSTFS+YTVVADVS+V IDP APL + CLLGCG
Sbjct: 121 TQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCG 180

Query: 181 VTTGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDF 240
           VTTGYGAA+KTANVQEGDTVAVFG GTVGLSV+QGAKSRGASKII VD+N++K+Q+S +F
Sbjct: 181 VTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNF 240

Query: 241 GATGFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHKGWGQSXXX 300
           GAT F+NP +DL E +TIV KLIDMTDGGLDFTFDCTGN  +MRDALEACHKGWGQS   
Sbjct: 241 GATDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEACHKGWGQSIII 300

Query: 301 XXXXXXXXXSTRPFQLITGRVWKGSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPF 360
                    STRPFQL+TGRVWKGSAFGGIKGRSEMG L+  YQ G LKV++FITH+RPF
Sbjct: 301 GVAAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPF 360

Query: 361 TEINNAFEDLHHGDCLRTVL 380
            EIN AFEDLH+GDCLRTVL
Sbjct: 361 KEINQAFEDLHNGDCLRTVL 380

>Smik_4.70 Chr4 (136242..137402) [1161 bp, 386 aa] {ON} YDL168W
           (REAL)
          Length = 386

 Score =  612 bits (1577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/382 (75%), Positives = 327/382 (85%)

Query: 1   MTSATAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVD 60
           M++AT GKPI+C+AAVAY+A KP +VE+I VDAPKAHEVR+++ +TAVCHTDAYTLSG D
Sbjct: 1   MSAATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60

Query: 61  PEGAFPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRA 120
           PEG FP ILGHEGAGIVESVGDGV  VK GDHV+ LYTAECGKCKFC S KTNLC +VRA
Sbjct: 61  PEGLFPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRA 120

Query: 121 TQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCG 180
           TQGKGVMPDGTTRFHN KG+ + HFMGCSTFS+YTVVADVS+V IDP APL + CLLGCG
Sbjct: 121 TQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCG 180

Query: 181 VTTGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDF 240
           VTTGYGAAVKTANVQ+GDTVAVFG GTVGLSV+QGAK RGASKII VD+N+ KK++   F
Sbjct: 181 VTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQF 240

Query: 241 GATGFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHKGWGQSXXX 300
           GAT F+NP +DL + +TIV KL++MTDGGLDFTFDCTGN K+MRDALEACHKGWGQS   
Sbjct: 241 GATDFINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIII 300

Query: 301 XXXXXXXXXSTRPFQLITGRVWKGSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPF 360
                    STRPFQL+TGRVWKGSAFGGIKGRSEMG L+  YQ G LKV++FITH+RPF
Sbjct: 301 GVAAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPF 360

Query: 361 TEINNAFEDLHHGDCLRTVLDL 382
            EIN+AFEDLH+GDCLRTVL  
Sbjct: 361 KEINHAFEDLHNGDCLRTVLKF 382

>CAGL0L01111g Chr12 (133129..134274) [1146 bp, 381 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168w SFA1 long-chain alcohol dehydrogenase
          Length = 381

 Score =  610 bits (1574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/379 (76%), Positives = 323/379 (85%)

Query: 5   TAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPEGA 64
           T GKPIEC+AAVAYEAGKP  VE+I+VD PKAHEVR+++ +TAVCHTDAYTLSG DPEG 
Sbjct: 2   TEGKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL 61

Query: 65  FPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRATQGK 124
           FP +LGHEGAGIVESVGDGVTNVK GDHV+ LYTAEC KCKFC S KTNLCG+VRATQGK
Sbjct: 62  FPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQGK 121

Query: 125 GVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTG 184
           GVMPDGT+RFHN KGE L HFMGCSTFS+YTVVADVS+V ID +APL SVCLLGCGVTTG
Sbjct: 122 GVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTG 181

Query: 185 YGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATG 244
           YGAAVKTANVQ+GDTVAVFG GTVGLSV+QGA  RGAS+II +D NDQKK +   FGAT 
Sbjct: 182 YGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATD 241

Query: 245 FVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHKGWGQSXXXXXXX 304
           F+NP KDLKE ETIV+KLI+MTDGGLD TFDCTGNV VMR ALEACHKGWGQS       
Sbjct: 242 FINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAA 301

Query: 305 XXXXXSTRPFQLITGRVWKGSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPFTEIN 364
                STRPFQL+TGRVWKGSAFGG+KGRSEM  L+  Y+KG+LKVD+FITH+R F EIN
Sbjct: 302 AGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEIN 361

Query: 365 NAFEDLHHGDCLRTVLDLA 383
            AF+DLH+G CLRTVL  +
Sbjct: 362 EAFDDLHNGLCLRTVLSFS 380

>Suva_4.78 Chr4 (147109..148266) [1158 bp, 385 aa] {ON} YDL168W
           (REAL)
          Length = 385

 Score =  610 bits (1572), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/382 (74%), Positives = 326/382 (85%)

Query: 1   MTSATAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVD 60
           M+++T GKPI+C+AA+AY+A KPL+VE+I VD PKAHEVR+++ +TAVCHTDAYTLSG D
Sbjct: 1   MSASTVGKPIQCIAAIAYDAKKPLSVEEITVDPPKAHEVRIKIEYTAVCHTDAYTLSGSD 60

Query: 61  PEGAFPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRA 120
           PEG FP ILGHEGAGIVESVGD VT VK GDHV+ LYTAECGKCKFC S KTNLC +VRA
Sbjct: 61  PEGLFPCILGHEGAGIVESVGDDVTTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRA 120

Query: 121 TQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCG 180
           TQG+G+MPD TTRFHN KGE + HFMGCSTFS+YTVVADVS+V IDP APL +  LLGCG
Sbjct: 121 TQGRGIMPDETTRFHNGKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAASLLGCG 180

Query: 181 VTTGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDF 240
           VTTGYGAAVKTANVQ+GDTVAVFG GTVGLSV+QGAK+RGASKII +D+N++KKQ+  DF
Sbjct: 181 VTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKARGASKIIGIDINNKKKQYCFDF 240

Query: 241 GATGFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHKGWGQSXXX 300
           GAT F+NP +DL +G+TIV KLI+ TDGGLDFTFDCTGN K+MRDALEACHKGWGQS   
Sbjct: 241 GATDFINPKEDLAKGQTIVEKLIETTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIII 300

Query: 301 XXXXXXXXXSTRPFQLITGRVWKGSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPF 360
                    STRPFQL+TGRVWKGSAFGGIKGRSEMG L+  YQ G LKV++FITH+RPF
Sbjct: 301 GVAAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGALKVEEFITHRRPF 360

Query: 361 TEINNAFEDLHHGDCLRTVLDL 382
            EIN AFEDLH GDCLRTVL  
Sbjct: 361 KEINQAFEDLHQGDCLRTVLKF 382

>TPHA0F02970 Chr6 complement(653405..654550) [1146 bp, 381 aa] {ON}
           Anc_7.350 YDL168W
          Length = 381

 Score =  603 bits (1556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/378 (76%), Positives = 321/378 (84%), Gaps = 1/378 (0%)

Query: 4   ATAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPEG 63
           +  GKPI C AA+AYEA KPLTV +I+VD PKAHEVR+++  TAVCHTDAY+LSGVDPEG
Sbjct: 2   SAVGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEG 61

Query: 64  AFPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRATQG 123
            FP +LGHEG+GIVES+G  VTNVKVGDHV+ LYTAECGKCKFC S KTNLCGSVRATQG
Sbjct: 62  LFPCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQG 121

Query: 124 KGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTT 183
           KGVMPDGTTRFH+  G+P+ HFMGCSTFSQYTVVADVSLV  D S       LLGCGVTT
Sbjct: 122 KGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTT 181

Query: 184 GYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGAT 243
           GYGAA+KTAN+Q+GDTVAVFGAGTVGLSVVQGAKSRGASKIIVVD+N+ KK WS +FGAT
Sbjct: 182 GYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGAT 241

Query: 244 GFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHKGWGQSXXXXXX 303
            FVNP K+LK+ E IVSKLI+MTDGGLDFTFDCTGNV VMR+ALEACHKGWGQS      
Sbjct: 242 DFVNP-KELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVA 300

Query: 304 XXXXXXSTRPFQLITGRVWKGSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPFTEI 363
                 +TRPFQL+TGRVW+GSAFGGIKGRSEMG L+  YQ G LKVD+FIT +RPFTEI
Sbjct: 301 AAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEI 360

Query: 364 NNAFEDLHHGDCLRTVLD 381
           N AFEDLH+G CLRTVLD
Sbjct: 361 NAAFEDLHNGSCLRTVLD 378

>ZYRO0F11704g Chr6 complement(958546..959694) [1149 bp, 382 aa] {ON}
           highly similar to uniprot|P32771 Saccharomyces
           cerevisiae YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 382

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/381 (77%), Positives = 330/381 (86%)

Query: 4   ATAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPEG 63
           +T GKP+  +AAVAYEAGKPL+VE+I VD PKAHEVR++V  TAVCHTDAYTLSG DPEG
Sbjct: 2   STEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEG 61

Query: 64  AFPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRATQG 123
           AFPSILGHEGAGIVESVG+GVT+VK GDHVV LYTAECGKCKFCKS KTNLCGSVRATQG
Sbjct: 62  AFPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQG 121

Query: 124 KGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTT 183
           KGVMPDGT+RF N KGE LLHFMGCSTFS+YTVVADVS+V +DP APL S CLLGCGVTT
Sbjct: 122 KGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTVVADVSVVAVDPKAPLESACLLGCGVTT 181

Query: 184 GYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGAT 243
           GYGAAVKTANVQ+GDTVA+FGAGTVGLSV QGAK+RGAS+II+VD+ND KK++  +FGAT
Sbjct: 182 GYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGAT 241

Query: 244 GFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHKGWGQSXXXXXX 303
            F+NP  DL+ G+TIV KLI+MTDGGLDFTFDCTGNVKVMRDALEACHKGWG S      
Sbjct: 242 DFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEACHKGWGVSVVIGVA 301

Query: 304 XXXXXXSTRPFQLITGRVWKGSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPFTEI 363
                 STRPFQL+TGRVWKGSAFGGIKGRSEMG L+  YQ G LKVD+FIT++RPF +I
Sbjct: 302 ASGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRPFKQI 361

Query: 364 NNAFEDLHHGDCLRTVLDLAN 384
           N AFEDLH GD LRTVL+  +
Sbjct: 362 NEAFEDLHAGDSLRTVLNYTD 382

>ACL148C Chr3 complement(90932..92077) [1146 bp, 381 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL168W
           (SFA1)
          Length = 381

 Score =  592 bits (1526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/380 (76%), Positives = 325/380 (85%)

Query: 3   SATAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPE 62
           S T GKPI+C AAVAY AG+PL +EK+ VD PKAHEVR+++ ++A+CHTDAYTLSG DPE
Sbjct: 2   SETQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDPE 61

Query: 63  GAFPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRATQ 122
           G FP ILGHEG+GIVESVG+GVTNVK GDHVV LYTAEC +CKFC S KTNLCG+VRATQ
Sbjct: 62  GLFPCILGHEGSGIVESVGEGVTNVKPGDHVVPLYTAECQQCKFCVSGKTNLCGAVRATQ 121

Query: 123 GKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVT 182
           GKGVMPDGT+RF N KGE L HFMGCSTFS+YTVVADVS+V +D  APL +VCLLGCGVT
Sbjct: 122 GKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYTVVADVSVVAVDQQAPLETVCLLGCGVT 181

Query: 183 TGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGA 242
           TGYGAAVKTA+VQEGDTVAVFGAGTVGLSVVQGAK+R AS+IIVVD+ND K++W+  FGA
Sbjct: 182 TGYGAAVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGA 241

Query: 243 TGFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHKGWGQSXXXXX 302
           T F+NP  DLKEGETIV++LI+MTDGGLD TFDCTGN KVMRDALEACHKGWGQS     
Sbjct: 242 TDFINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGV 301

Query: 303 XXXXXXXSTRPFQLITGRVWKGSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPFTE 362
                  STRPFQL+TGRVWKGSAFGGIKGRSEMG LV  Y  G LKV +F+THKRPF E
Sbjct: 302 AAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFEE 361

Query: 363 INNAFEDLHHGDCLRTVLDL 382
           IN+ FEDLHHGDCLRTVL L
Sbjct: 362 INSGFEDLHHGDCLRTVLSL 381

>KAFR0B00880 Chr2 complement(164475..165620) [1146 bp, 381 aa] {ON}
           Anc_7.350 YDL168W
          Length = 381

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/380 (73%), Positives = 323/380 (85%)

Query: 3   SATAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPE 62
           S+T GK I+C AAVAYEA KPL V+ +IVDAPKAHEVR+++ +TA+CHTDAYTLSGVDPE
Sbjct: 2   SSTQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPE 61

Query: 63  GAFPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRATQ 122
           G FP ILGHEG+GIVES+G+GVT+VKVGDHV+ LYTAEC KCKFCKS KTNLCG+VR TQ
Sbjct: 62  GLFPCILGHEGSGIVESIGEGVTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRETQ 121

Query: 123 GKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVT 182
           GKGVMPDGT+RFH L+G+ + HFMGCSTFS+YTVVADVS+V ID    L    LLGCGVT
Sbjct: 122 GKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVT 181

Query: 183 TGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGA 242
           TG+GAAVK ANVQ+GDTVAVFGAGTVGLSVVQGA+ RG SK+IVVD+ND+KKQ+S DFGA
Sbjct: 182 TGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGA 241

Query: 243 TGFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHKGWGQSXXXXX 302
           T FVNP+ DLK+GETIV+KLI MTDGGLD+TFDCTGNV VMR+ALEACHKGWGQS     
Sbjct: 242 TDFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIGV 301

Query: 303 XXXXXXXSTRPFQLITGRVWKGSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPFTE 362
                  STRPFQL+TGRVW+G+AFG IKGR++M QL+  Y+KG LK+D+FITH+R F E
Sbjct: 302 AAAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDE 361

Query: 363 INNAFEDLHHGDCLRTVLDL 382
           IN+ FEDLH G CLRTVL  
Sbjct: 362 INDGFEDLHMGTCLRTVLKF 381

>NDAI0A01890 Chr1 (425090..426358) [1269 bp, 422 aa] {ON} Anc_7.350
          Length = 422

 Score =  549 bits (1415), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/383 (70%), Positives = 297/383 (77%), Gaps = 46/383 (12%)

Query: 1   MTSATAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVD 60
           + S T GKPI C AAVAYEAGKPLTVE I+VD PKAHEVR+++ +TAVCHTDAYTLSGVD
Sbjct: 85  IMSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVD 144

Query: 61  PEGAFPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRA 120
           PEGAFPSILGHEG+GIVESVG+GVTNVKVGDHV+ LYTAECG+CKFCKS           
Sbjct: 145 PEGAFPSILGHEGSGIVESVGEGVTNVKVGDHVIALYTAECGECKFCKSGXXX------- 197

Query: 121 TQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCG 180
                                                       +D +AP+ S+CLLGCG
Sbjct: 198 ---------------------------------------XXXXAVDKNAPMDSICLLGCG 218

Query: 181 VTTGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDF 240
           VTTGYGAA+KTANVQ+GDTVAVFGAGTVGLSVVQGAK+RGASKIIVVDVNDQKKQWSMDF
Sbjct: 219 VTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDF 278

Query: 241 GATGFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHKGWGQSXXX 300
           GAT F+NP  DLKEGETIVSKLI+MTDGGL++TFDCTGN KVMRDALEACHKGWG+S   
Sbjct: 279 GATDFINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALEACHKGWGESIII 338

Query: 301 XXXXXXXXXSTRPFQLITGRVWKGSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPF 360
                    STRPFQL+TGRVWKGSAFGGIKGRSEMG L+  YQ G+LKVD+FITH+RPF
Sbjct: 339 GVAAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGNLKVDEFITHRRPF 398

Query: 361 TEINNAFEDLHHGDCLRTVLDLA 383
           TEINNAFEDLHHGDCLRTVLDL+
Sbjct: 399 TEINNAFEDLHHGDCLRTVLDLS 421

>KNAG0C03790 Chr3 complement(745394..746542) [1149 bp, 382 aa] {ON}
           Anc_7.350 YDL168W
          Length = 382

 Score =  530 bits (1365), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/378 (69%), Positives = 300/378 (79%), Gaps = 1/378 (0%)

Query: 5   TAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQ-VTHTAVCHTDAYTLSGVDPEG 63
           T G+ I C AAVAY AGKPLTVE+I V+AP       Q   H  + H   +++       
Sbjct: 4   TEGQTITCTAAVAYAAGKPLTVEQITVEAPTGARGAYQDHQHCYLPHGCVHSVWFGSEVR 63

Query: 64  AFPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRATQG 123
                 G  GAG+VESVG  VT+VKVGDHV+ LYTAEC +CK CKS KTNLC +VRATQG
Sbjct: 64  CVSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSAVRATQG 123

Query: 124 KGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTT 183
           KGVMPDGT+RF N KGEPLLHFMGCSTF++YTVVADVS+V ID  APL  VCLLGCGVTT
Sbjct: 124 KGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTT 183

Query: 184 GYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGAT 243
           GYGAA+KTANVQ+GDTVAVFGAGT+GLSVVQGAK+R ASKIIVVD+ND KK+++ DFGAT
Sbjct: 184 GYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGAT 243

Query: 244 GFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHKGWGQSXXXXXX 303
            FVNP  DLK+G+TIV KL++MTDGGLDFTFD TGNV+VMRDALEACHKGWGQS      
Sbjct: 244 DFVNPKTDLKDGQTIVEKLVEMTDGGLDFTFDGTGNVQVMRDALEACHKGWGQSIIIGVA 303

Query: 304 XXXXXXSTRPFQLITGRVWKGSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPFTEI 363
                 STRPFQL+TGRVWKGSAFGG+KGRSEMG L+  Y KG+LK+D+FIT+KRPF EI
Sbjct: 304 AAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRPFKEI 363

Query: 364 NNAFEDLHHGDCLRTVLD 381
           N  FEDLHHGDCLRTVL+
Sbjct: 364 NEGFEDLHHGDCLRTVLN 381

>SAKL0A00880g Chr1 complement(92246..93412) [1167 bp, 388 aa] {ON}
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione- dependent formaldehyde dehydrogenase)
          Length = 388

 Score =  441 bits (1135), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 211/376 (56%), Positives = 269/376 (71%), Gaps = 3/376 (0%)

Query: 7   GKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPEGAFP 66
           G+PI C AAVAY   KPL +E+IIVD P+ HEVRV+VT+TA+C TD +TL G++PEG FP
Sbjct: 6   GEPIRCTAAVAYSINKPLVLEQIIVDPPQEHEVRVKVTNTALCRTDLFTLKGLNPEGKFP 65

Query: 67  SILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRATQGKGV 126
            +LGHEG+GIVES G  V  VK GDHV+LLY  ECG C  CKS K+NLC  ++ATQ +GV
Sbjct: 66  CVLGHEGSGIVESCGSKVETVKKGDHVLLLYIPECGHCADCKSEKSNLCSVIKATQAQGV 125

Query: 127 MPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYG 186
           MP G++R HNL+ + L HFMGCS+FSQY VV+D+S V I   APL  +CLLGCGVTTG+G
Sbjct: 126 MPQGSSRLHNLENKTLWHFMGCSSFSQYAVVSDISCVKIRDDAPLDKICLLGCGVTTGFG 185

Query: 187 AAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFV 246
           A +    V+ GD VAVFG+GTVGLSVVQ        ++IVVDV D K++W++ FGAT F+
Sbjct: 186 API-AKGVKAGDRVAVFGSGTVGLSVVQSCSQLKCFQVIVVDVQDNKREWALGFGATDFI 244

Query: 247 NPLKDLKEGETIVSKLIDMTDG-GLDFTFDCTGNVKVMRDALEACHKGWGQSXXXXXXXX 305
           NP K + + ++++  LID + G G DFTFDCTG+  VMR ALE+C KGWG S        
Sbjct: 245 NPQK-IPKNKSLLQTLIDKSGGDGFDFTFDCTGSTSVMRTALESCRKGWGTSVIIGLAGA 303

Query: 306 XXXXSTRPFQLITGRVWKGSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPFTEINN 365
               ST P+ LI GR W+G AFGG+KGRSE+  LV  Y   ++K+D++IT+KRP  EIN 
Sbjct: 304 GEEISTLPYNLIVGRSWEGCAFGGVKGRSELPTLVERYMNNEIKLDEYITNKRPLKEINE 363

Query: 366 AFEDLHHGDCLRTVLD 381
           A ++L  G  L+TVLD
Sbjct: 364 ALKELEDGLVLKTVLD 379

>KLLA0D19929g Chr4 (1694826..1695986) [1161 bp, 386 aa] {ON} weakly
           similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase
          Length = 386

 Score =  114 bits (286), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 97/347 (27%), Positives = 157/347 (45%), Gaps = 48/347 (13%)

Query: 41  VQVTHTAVCHTDAYTLSGVDPE---------GAFP-SILGHEGAGIVESVGDGVTNVKVG 90
           +++THT++C TD     G +PE         G+F   ILGHEG GI++ VGD V N K G
Sbjct: 60  IKMTHTSICGTDLGIWKGKNPEIEQTAQTKEGSFNGRILGHEGIGIIDEVGDAVHNFKKG 119

Query: 91  DHVVLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCST 150
           D V++   + CG C+ C  +  + C     T G G                +L +M   T
Sbjct: 120 DRVIVSCISRCGTCENCAKSLYSHC-----TNGGGW---------------ILGYMIDGT 159

Query: 151 FSQY--TVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVFGAGTV 208
            ++Y  T  AD SL ++  +    +  +L   + T +   V+  NV+ GDTVA+ GAG V
Sbjct: 160 QAEYVRTPFADTSLYSVPENLSDEAAVMLSDALPTAHEIGVQMGNVKPGDTVAIVGAGPV 219

Query: 209 GLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDG 268
           G+  V  ++    S +IVVD++D +   + + G+T  +N  K     E  VSK+++ T+G
Sbjct: 220 GMGCVLTSQLYSPSLLIVVDIDDNRLAMAKEMGSTHTINSAK-----EDAVSKILEYTNG 274

Query: 269 -GLDFTFDCTGNVKVMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLITGRVW--KGS 325
            G+D   +  G  +   D  +   K  G                +P      ++W    +
Sbjct: 275 RGVDCVMEAVG-AQATWDICQRVIKEGGH-------LANVGVHGKPVNFEIDKLWIKNLT 326

Query: 326 AFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPFTEINNAFEDLHH 372
              G+   +  G L+ S   G LK +  +TH   F E++  +    H
Sbjct: 327 ITSGLVNTNTTGMLMKSCCSGKLKSERLVTHHCNFGEMSGNYNIFKH 373

>KLLA0B00451g Chr2 complement(31822..32982) [1161 bp, 386 aa] {ON}
           weakly similar to uniprot|P35497 Saccharomyces
           cerevisiae YJR159W SOR1 Sorbitol dehydrogenase
          Length = 386

 Score =  105 bits (262), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 98/383 (25%), Positives = 162/383 (42%), Gaps = 50/383 (13%)

Query: 6   AGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPE--- 62
           A +P    A V Y A      ++ I       +  +++T+T++C TD     G  PE   
Sbjct: 25  ANQPGMMKAMVYYGANDLRFEDRAIPKIIDQRDAIIKMTNTSICGTDVGIWKGKSPEIEE 84

Query: 63  ------GAFP-SILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLC 115
                 G+F   +LGHEG GIV  VGD V N+K GD V++     CG C+ C       C
Sbjct: 85  IAVKNEGSFNGRVLGHEGTGIVTEVGDAVRNIKKGDKVIISCITRCGTCENCARGMYAHC 144

Query: 116 GSVRATQGKGVMPDGTTRF-HNLKGEPLLHFMGCSTFSQY--TVVADVSLVTIDPSAPLS 172
                      M DG     +++ G          T ++Y  T  AD SL  +       
Sbjct: 145 -----------MNDGGWALGYSIDG----------TQAEYVRTPFADTSLYALPEGLSDE 183

Query: 173 SVCLLGCGVTTGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQ 232
           +  LL   + T +   V+  NV+ GD+VA+ GAG VG+  V  ++    S +IVVD++D 
Sbjct: 184 NAVLLSDALPTAHEIGVQMGNVKPGDSVAILGAGPVGMGCVLTSQLYSPSLLIVVDMDDN 243

Query: 233 KKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDG-GLDFTFDCTGNVKVMRDALEACH 291
           + + + + GAT  +N  K     E  V+K++++T+G G+D   +  G     +   + C 
Sbjct: 244 RLEMAKEMGATHTINSGK-----EDAVAKILEITNGRGVDCAMEAVG----AQPTWDICQ 294

Query: 292 KGWGQSXXXXXXXXXXXXSTRPFQLITGRVW--KGSAFGGIKGRSEMGQLVTSYQKGDLK 349
               Q               +P      ++W    +   G+   +    L+ +   G L+
Sbjct: 295 ----QIIKEGGHLANVGVHGKPVDFAIDKLWIKNLTITSGLVNTNTTSMLMKNCCSGKLQ 350

Query: 350 VDDFITHKRPFTEINNAFEDLHH 372
            D  ++H   F ++ N +    H
Sbjct: 351 SDKLVSHHCNFKDMANNYNIFKH 373

>SAKL0C10164g Chr3 complement(914732..915787) [1056 bp, 351 aa] {ON}
           uniprot|Q6XQ74 Saccharomyces kluyveri ADH1 Alcohol
           dehydrogenase 1
          Length = 351

 Score =  102 bits (255), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 83/280 (29%), Positives = 132/280 (47%), Gaps = 37/280 (13%)

Query: 14  AAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDP-EGAFPSILGHE 72
           A + YE G  L  + I V  PK++E+ + + ++ VCHTD +   G  P     P + GHE
Sbjct: 12  AVIFYENGGELQYKDIPVPKPKSNEILINIKYSGVCHTDLHAWKGDWPLPTKLPLVGGHE 71

Query: 73  GAGIVESVGDGVTNVKVGDHVVLLY-TAECGKCKFCK-SNKTNLCGSVRATQGKGVMPDG 130
           GAGIV  +G+ V   K+GD+  + +    C  C++C+ SN++N              PD 
Sbjct: 72  GAGIVVGMGENVKGWKIGDYAGIKWLNGSCMSCEYCELSNESNC-------------PDA 118

Query: 131 TTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVK 190
               +   G          +F QY     V    I P   L+ V  + C   T Y  A+K
Sbjct: 119 DLSGYTHDG----------SFQQYATADAVQAARIAPGTDLAEVAPVLCAGITVY-KALK 167

Query: 191 TANVQEGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPL 249
           +AN++ G+ VA+ GA G +G   +Q AK+ G  +++ +D  D+K     + G   F+   
Sbjct: 168 SANLRAGEWVAISGACGGLGSLAIQYAKAMG-YRVLGIDGGDEKAALFKELGGEVFI--- 223

Query: 250 KDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEA 289
            D  + + +V  ++D T+GG         NV V   A+EA
Sbjct: 224 -DFTKTKDVVKAVVDATNGGAHGVI----NVSVSEAAIEA 258

>CAGL0J01441g Chr10 complement(134383..135501) [1119 bp, 372 aa]
           {ON} highly similar to uniprot|P07246 Saccharomyces
           cerevisiae YMR083w ADH3 or uniprot|P00330 Saccharomyces
           cerevisiae YOL086c ADH1 or uniprot|P00331 Saccharomyces
           cerevisiae YMR303c ADH2
          Length = 372

 Score =  102 bits (253), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 78/276 (28%), Positives = 130/276 (47%), Gaps = 31/276 (11%)

Query: 16  VAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPEGA-FPSILGHEGA 74
           + YE G  L  + + V  PK +E+ + V ++ VCHTD +   G  P GA  P + GHEGA
Sbjct: 35  IFYEHGGKLEYKDLPVPKPKPNEILINVRYSGVCHTDLHAWHGDWPLGAKLPLVGGHEGA 94

Query: 75  GIVESVGDGVTNVKVGDHV-VLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTR 133
           G+V + G  VTN ++GD+  +      C  C+FC+    + C     +   G   DG   
Sbjct: 95  GVVVAKGSSVTNFEIGDYAGIKWLNGSCMSCEFCEQGNESNCAKADLS---GYTHDG--- 148

Query: 134 FHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTAN 193
                           +F QY     +    I     L+ V  + C   T Y  A+K ++
Sbjct: 149 ----------------SFQQYATADAIQAAQIPKGTDLAQVAPILCAGVTVY-KALKDSD 191

Query: 194 VQEGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDL 252
           V+ G  VA+ G AG +G   VQ AK+ G  +++ +D  D+K++     G   FV    D 
Sbjct: 192 VKPGQWVAISGAAGGLGSLAVQYAKAMGM-RVLGIDAGDEKRKLFESLGGNHFV----DF 246

Query: 253 KEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALE 288
            + + +VS++ ++T+GG     + + + K +  ++E
Sbjct: 247 TKTKDLVSEIQEITEGGPHGVINVSVSEKAIGQSVE 282

>TBLA0I01140 Chr9 (233777..234910) [1134 bp, 377 aa] {ON} Anc_2.480
           YMR083W
          Length = 377

 Score =  101 bits (251), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 86/272 (31%), Positives = 126/272 (46%), Gaps = 32/272 (11%)

Query: 2   TSATAGK-PIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVD 60
           T+AT+ K P    A V YE G PL    I V  PK +E+ + V ++ VCHTD +   G  
Sbjct: 25  TTATSFKIPTTQKAVVFYENGGPLKYTTIPVPKPKPNEILINVKYSGVCHTDLHAWKGDW 84

Query: 61  PEGA-FPSILGHEGAGIVESVGDGVTNVKVGDHV-VLLYTAECGKCKFCKSNKTNLCGSV 118
           P     P + GHEGAG+V + G  V N ++GD+  +      C  C+ C+    + C   
Sbjct: 85  PLAVKLPLVGGHEGAGVVVAKGSEVKNFEIGDYAGIKWLNGSCMSCELCEKGFESNCEQA 144

Query: 119 RATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLG 178
             +   G   DG                   +F QY     V    I  +  L+ V  + 
Sbjct: 145 DLS---GYTHDG-------------------SFQQYATADAVQAAHIPKNVDLAEVAPIL 182

Query: 179 CGVTTGYGAAVKTANVQEGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDVNDQKKQWS 237
           C   T Y  A+KTA+V+ G  VA+ GA G +G   VQ AK+ G  +++ +D  D+KK+  
Sbjct: 183 CAGVTVY-KALKTADVKPGQWVAISGACGGLGSLAVQYAKAMGL-RVVGIDGGDEKKKLF 240

Query: 238 MDFGATGFVNPLKDLKEGETIVSKLIDMTDGG 269
              G   FV    D  +  +IV  + D+T+GG
Sbjct: 241 HSLGGDIFV----DFTKTHSIVKDIQDVTNGG 268

>Ecym_5331 Chr5 (676233..677279) [1047 bp, 348 aa] {ON} similar to
           Ashbya gossypii AER032W
          Length = 348

 Score = 99.8 bits (247), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 80/260 (30%), Positives = 123/260 (47%), Gaps = 33/260 (12%)

Query: 14  AAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDP-EGAFPSILGHE 72
           A + YE G  L    I V  PK  E+ + V ++ VCHTD +   G  P     P + GHE
Sbjct: 9   AVIFYENGGELKYTDIPVPKPKPSELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHE 68

Query: 73  GAGIVESVGDGVTNVKVGDHV-VLLYTAECGKCKFC-KSNKTNLCGSVRATQGKGVMPDG 130
           GAG+V ++G+ V   K+GD   +      C  C++C KSN++N              PD 
Sbjct: 69  GAGVVVAMGENVRGWKIGDFAGIKWLNGSCMTCEYCEKSNESNC-------------PDA 115

Query: 131 TTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVK 190
               +   G          +F QY     V    I     L+ V  + C   T Y  A+K
Sbjct: 116 DLSGYTHDG----------SFQQYATADAVHAAKIPQGTDLAQVAPVLCAGITVY-KALK 164

Query: 191 TANVQEGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPL 249
           +A +Q G+ VA+ GA G +G   VQ AK+ G  +I+ +D  ++KK+   + G   F+   
Sbjct: 165 SARLQAGEWVAISGASGGLGSLAVQYAKAMG-YRILGIDSGEEKKKLFKELGGEYFI--- 220

Query: 250 KDLKEGETIVSKLIDMTDGG 269
            D  E + +V+++I +T+GG
Sbjct: 221 -DFAESKDVVAEVIKVTNGG 239

>AER032W Chr5 (696807..697862) [1056 bp, 351 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL086C (ADH1) and
           YBR145W (ADH5)
          Length = 351

 Score = 99.4 bits (246), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 83/280 (29%), Positives = 130/280 (46%), Gaps = 37/280 (13%)

Query: 14  AAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDP-EGAFPSILGHE 72
           A + YE G PL    I V  PKA E+ + V ++ VCHTD +   G  P     P + GHE
Sbjct: 12  AVIFYENGGPLQYTDIEVPKPKATELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHE 71

Query: 73  GAGIVESVGDGVTNVKVGDHV-VLLYTAECGKCKFC-KSNKTNLCGSVRATQGKGVMPDG 130
           GAG+V ++G+ V   K+GD   +      C  C++C KSN++N              P+ 
Sbjct: 72  GAGVVVAMGENVRGWKIGDLAGIKWLNGSCMACEYCEKSNESNC-------------PEA 118

Query: 131 TTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVK 190
               +   G          +F QY     V    I     L+ V  + C   T Y  A+K
Sbjct: 119 DLSGYTHDG----------SFQQYATADAVQAAHIPAGTDLAQVAPILCAGITVY-KALK 167

Query: 191 TANVQEGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPL 249
           +AN++ GD VA+ GA G +G   +Q A + G  +++ +D  ++K+Q     G   F+   
Sbjct: 168 SANLRAGDWVAISGACGGLGSLAIQYATAMG-YRVLGIDGGEEKEQLFRQLGGEVFI--- 223

Query: 250 KDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEA 289
            D ++ + IV+ ++  T+GG         NV V   A+E+
Sbjct: 224 -DFRKSKDIVADVVKATNGGAHGVI----NVSVSEAAIES 258

>NCAS0I02350 Chr9 (444097..445152) [1056 bp, 351 aa] {ON} Anc_3.118
          Length = 351

 Score = 99.0 bits (245), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 84/282 (29%), Positives = 132/282 (46%), Gaps = 36/282 (12%)

Query: 15  AVAYEA-GKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDP-EGAFPSILGHE 72
           AV +E  G  L  + I V  PK++E+ + V ++ VCHTD +   G  P     P + GHE
Sbjct: 12  AVIFETNGGKLEYKDIPVPTPKSNEILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHE 71

Query: 73  GAGIVESVGDGVTNVKVGDHVVLLY-TAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGT 131
           GAG+V ++GD V   K+GD+  + +    C  C++C+    + C     +   G   DG 
Sbjct: 72  GAGVVVAMGDAVKGWKIGDYAGIKWLNGSCMSCEYCELGNESNCPHADLS---GYTHDG- 127

Query: 132 TRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKT 191
                             +F QY     V    I P + L+ V  + C   T Y  A+K+
Sbjct: 128 ------------------SFQQYATADAVQAARIAPGSDLAEVAPVLCAGITVY-KALKS 168

Query: 192 ANVQEGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLK 250
           AN++ G+ VA+ GA G +G   +Q AK+ G  +++ +D  D+K +   D G   F+    
Sbjct: 169 ANLRAGEWVAISGACGGLGSLAIQFAKAMG-YRVVGIDGGDEKAKMFKDLGGEVFI---- 223

Query: 251 DLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHK 292
           D  + + IV  +I  T+GG         NV V   A++A  K
Sbjct: 224 DFTKTKDIVGDIIKATNGGAHGVI----NVSVSEQAIDASVK 261

>SAKL0F06270g Chr6 (472877..473932) [1056 bp, 351 aa] {ON} similar
           to uniprot|P00331 Saccharomyces cerevisiae YMR303C ADH2
           Glucose-repressible alcohol dehydrogenase II
          Length = 351

 Score = 97.1 bits (240), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 80/280 (28%), Positives = 132/280 (47%), Gaps = 37/280 (13%)

Query: 14  AAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDP-EGAFPSILGHE 72
           A + YE G  L  + I V  PK++E+ + V ++ VCHTD +   G  P     P + GHE
Sbjct: 12  AVIFYENGGELQYKDIPVPKPKSNEILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHE 71

Query: 73  GAGIVESVGDGVTNVKVGDHVVLLY-TAECGKCKFCK-SNKTNLCGSVRATQGKGVMPDG 130
           GAG+V ++G+ V   K+GD+  + +    C  C++C+ SN++N              P+ 
Sbjct: 72  GAGVVVAIGENVKGWKIGDYAGIKWLNGSCMACEYCELSNESNC-------------PEA 118

Query: 131 TTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVK 190
               +   G          +F QY     V    I     L+ V  + C   T Y  A+K
Sbjct: 119 DLSGYTHDG----------SFQQYATADAVQAARIPAGTDLAEVAPVLCAGITVY-KALK 167

Query: 191 TANVQEGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPL 249
           +AN++ G+ VA+ GA G +G   +Q AK+ G  +++ +D  ++K     + G   F+   
Sbjct: 168 SANLRAGEWVAISGACGGLGSLAIQYAKAMG-YRVLGIDGGEEKAALFKELGGEVFI--- 223

Query: 250 KDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEA 289
            D  + + +V  ++D T+GG         NV V   A+EA
Sbjct: 224 -DFTKTKDVVKAVVDATNGGAHGVI----NVSVSEAAIEA 258

>KLTH0G18986g Chr7 complement(1639254..1640318) [1065 bp, 354 aa]
           {ON} similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase expression is
           induced in the presence of sorbitol
          Length = 354

 Score = 96.7 bits (239), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 110/381 (28%), Positives = 169/381 (44%), Gaps = 51/381 (13%)

Query: 14  AAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDA-YTLSGVDPEGAF----PSI 68
           A V  + G+     K + +    H V++Q+  T +C +D  Y ++G    G F    P I
Sbjct: 7   AIVLVQKGEIAVESKPVPEITDPHYVKLQIKKTGICGSDVHYYVAGAI--GDFVVKKPMI 64

Query: 69  LGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMP 128
           LGHE +G+V  VG  V+ V+VGD V +            K+ + NLC  ++      +  
Sbjct: 65  LGHESSGLVVEVGSEVSRVRVGDRVAIEPGVPSRYSDETKAGRYNLCPHMQFAATPPI-- 122

Query: 129 DGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAA 188
           DGT   + L  E  L          +    + +LV      PLS       GV      A
Sbjct: 123 DGTLVKYYLAPEDFL-----VKLPDHVSYEEGALVE-----PLS------VGVH-----A 161

Query: 189 VKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNP 248
            K A V     VAVFGAG VGL     A++ GAS+++ +DV + K   S +FG T FVN 
Sbjct: 162 NKLAGVAFNQRVAVFGAGPVGLLTGAVARAFGASEVVYIDVFEHKLSLSSNFGGTQFVNS 221

Query: 249 LKDLKEGETIVSKLIDMTDGGL--DFTFDCTGNVKVMRDALEACHKGWGQSXXXXXXXXX 306
             ++K+ + +V K I+   GG   D  FDCTG    +R  ++ C+ G             
Sbjct: 222 -ANIKDEDDLV-KEIERVLGGARPDVVFDCTGAEICIRTGIKVCNSGG----TYVQVGMG 275

Query: 307 XXXSTRPFQLITGRVWK-----GSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPFT 361
                 P   I  +  K       AFG  +   +  QL+ S   GD+ V   +TH+  F 
Sbjct: 276 HDDVNFPIGAIGAKELKVLGCFRYAFGDYR---DAVQLIAS---GDVNVKPLVTHRFKFE 329

Query: 362 EINNAFE-DLHHG-DCLRTVL 380
           +   A+E ++ HG + ++T++
Sbjct: 330 DAEAAYEFNIKHGSEVIKTII 350

>KLLA0F21010g Chr6 (1962951..1964003) [1053 bp, 350 aa] {ON}
           uniprot|P20369 Kluyveromyces lactis KLLA0F21010g ADH1
           Alcohol dehydrogenase 1
          Length = 350

 Score = 96.7 bits (239), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 79/258 (30%), Positives = 123/258 (47%), Gaps = 33/258 (12%)

Query: 16  VAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDP-EGAFPSILGHEGA 74
           + YE G  L  + I V  PKA+E+ + V ++ VCHTD +   G  P     P + GHEGA
Sbjct: 13  IFYENGGELQYKDIPVPKPKANELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGA 72

Query: 75  GIVESVGDGVTNVKVGDHV-VLLYTAECGKCKFCK-SNKTNLCGSVRATQGKGVMPDGTT 132
           G+V ++G+ V   K+GD   +      C  C++C+ SN++N C     +   G   DG  
Sbjct: 73  GVVVAMGENVKGWKIGDFAGIKWLNGSCMSCEYCELSNESN-CPEADLS---GYTHDG-- 126

Query: 133 RFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTA 192
                            +F QY     V    I     L+ V  + C   T Y  A+K+A
Sbjct: 127 -----------------SFQQYATADAVQAAKIPVGTDLAEVAPVLCAGVTVY-KALKSA 168

Query: 193 NVQEGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKD 251
           N++ GD VA+ G AG +G   VQ AK+ G  +++ +D  ++K +   D G   F+    D
Sbjct: 169 NLKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDAGEEKAKLFKDLGGEYFI----D 223

Query: 252 LKEGETIVSKLIDMTDGG 269
             + + I  ++I+ T GG
Sbjct: 224 FTKSKNIPEEVIEATKGG 241

>KNAG0K02000 Chr11 (410263..411315) [1053 bp, 350 aa] {ON} Anc_3.118
           YBR145W
          Length = 350

 Score = 96.3 bits (238), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 79/272 (29%), Positives = 127/272 (46%), Gaps = 35/272 (12%)

Query: 21  GKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPEGA-FPSILGHEGAGIVES 79
           G PL  ++I V  PKA+E+ + V ++ VCHTD +   G  P     P + GHEGAGIV +
Sbjct: 18  GGPLEYKEIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGAGIVVA 77

Query: 80  VGDGVTNVKVGDHV-VLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLK 138
           +GD V N  +GD+  +      C  C+ C+    + C     +   G   DG        
Sbjct: 78  MGDSVKNWNIGDYAGIKWLNGSCMNCESCELANESNCPQADLS---GYTHDG-------- 126

Query: 139 GEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQEGD 198
                      +F QY     V    I     L+ V  + C   T Y  A+K+AN++ GD
Sbjct: 127 -----------SFQQYATADAVQAAKIPHGTDLAEVAPILCAGVTVY-KALKSANLKAGD 174

Query: 199 TVAVFGA-GTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGET 257
            VA+ GA G +G   +Q A + G  +++ +D  ++K +     G   F+    D  + + 
Sbjct: 175 WVAISGACGGLGSLAIQYATAMG-YRVLGIDGGEEKAELFKKLGGEYFI----DFTKCKD 229

Query: 258 IVSKLIDMTDGGLDFTFDCTGNVKVMRDALEA 289
           ++++++++TDGG         NV V   A+EA
Sbjct: 230 VIAEILEVTDGGAHGVI----NVSVSEAAIEA 257

>YBR145W Chr2 (533762..534817) [1056 bp, 351 aa] {ON}  ADH5Alcohol
           dehydrogenase isoenzyme V; involved in ethanol
           production
          Length = 351

 Score = 95.9 bits (237), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 85/279 (30%), Positives = 123/279 (44%), Gaps = 35/279 (12%)

Query: 14  AAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDP-EGAFPSILGHE 72
           A V YE    L  + + V  PK +E+ V V ++ VCH+D +   G  P +  FP I GHE
Sbjct: 12  AIVFYETDGKLEYKDVTVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQLKFPLIGGHE 71

Query: 73  GAGIVESVGDGVTNVKVGDHV-VLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGT 131
           GAG+V  +G  V   KVGD   +      C  C++C+    + C  +          DGT
Sbjct: 72  GAGVVVKLGSNVKGWKVGDFAGIKWLNGTCMSCEYCEVGNESQCPYL----------DGT 121

Query: 132 TRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKT 191
              H+             TF +Y     V    I P+  L+ V  + C   T Y  A+K 
Sbjct: 122 GFTHD------------GTFQEYATADAVQAAHIPPNVNLAEVAPILCAGITVY-KALKR 168

Query: 192 ANVQEGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLK 250
           ANV  G  V + GA G +G   +Q A + G  ++I +D  + K++     G   F+    
Sbjct: 169 ANVIPGQWVTISGACGGLGSLAIQYALAMG-YRVIGIDGGNAKRKLFEQLGGEIFI---- 223

Query: 251 DLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEA 289
           D  E + IV  +I  T+GG         NV V   A+EA
Sbjct: 224 DFTEEKDIVGAIIKATNGGSHGVI----NVSVSEAAIEA 258

>KLTH0G15686g Chr7 complement(1367997..1369052) [1056 bp, 351 aa]
           {ON} highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086C ADH1 Alcohol dehydrogenase involved
           in the production of certain carboxylate esters
          Length = 351

 Score = 95.1 bits (235), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 83/277 (29%), Positives = 127/277 (45%), Gaps = 35/277 (12%)

Query: 16  VAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPEGA-FPSILGHEGA 74
           + YE G  L  + I V  PKA+E+ V V ++ VCHTD +   G  P     P + GHEGA
Sbjct: 14  IFYETGGKLEYKDIDVPTPKANELLVNVKYSGVCHTDLHAYHGDWPLPVKLPLVGGHEGA 73

Query: 75  GIVESVGDGVTNVKVGDHVVLLY-TAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTR 133
           G+V ++G+ V   KVGD   + +    C  C+ C+    + C            P+    
Sbjct: 74  GVVVAMGENVKGWKVGDLAGIKWLNGSCMSCESCELGNESNC------------PEADLS 121

Query: 134 FHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTAN 193
            +   G          +F QY     V    I   A L+ +  + C   T Y  A+K+AN
Sbjct: 122 GYTHDG----------SFQQYATADAVQAAKIPAGADLAEIAPILCAGITVY-KALKSAN 170

Query: 194 VQEGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDL 252
           +Q GD VA+ G AG +G   VQ AK+ G  +++ +D  ++K+Q     G   F+    D 
Sbjct: 171 LQAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEEKEQLFRQLGGEVFI----DF 225

Query: 253 KEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEA 289
           +  + I  ++I  T+GG         NV V   A+E+
Sbjct: 226 RTCKDIEGEIIKATNGGAHGVI----NVSVSEAAIES 258

>KAFR0G01420 Chr7 complement(314119..315174) [1056 bp, 351 aa] {ON}
           Anc_3.118 YBR145W
          Length = 351

 Score = 95.1 bits (235), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 81/278 (29%), Positives = 131/278 (47%), Gaps = 37/278 (13%)

Query: 16  VAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDP-EGAFPSILGHEGA 74
           + YE G  L  + I V  PKA+E+ + V ++ VCHTD +   G  P +   P + GHEGA
Sbjct: 14  IFYENGGKLEYKDIPVPTPKANELLINVKYSGVCHTDLHAWKGDWPLDVKLPLVGGHEGA 73

Query: 75  GIVESVGDGVTNVKVGDHVVLLY-TAECGKCKFCK-SNKTNLCGSVRATQGKGVMPDGTT 132
           G+V ++G+ V   K+GD+  + +    C  C++C+ SN++N              P+   
Sbjct: 74  GVVVAMGENVRGWKIGDYAGIKWLNGSCMSCEYCELSNESNC-------------PEADL 120

Query: 133 RFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTA 192
             +   G          +F QY     V    I     L+ V  + C   T Y  A+K+A
Sbjct: 121 SGYTHDG----------SFQQYATADAVQAAKIPQGTDLAQVAPILCAGITVY-KALKSA 169

Query: 193 NVQEGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKD 251
           N+  G+ VA+ GA G +G   +Q AK+ G  +I+ +D  D+K     + G   F+    D
Sbjct: 170 NLSAGEWVAISGACGGLGSLAIQYAKAMG-YRILGIDGGDEKAALFKELGGEVFI----D 224

Query: 252 LKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEA 289
             + + I + +I+ T+GG         NV V   A+E+
Sbjct: 225 FTKTKDIEAAVIEATNGGAHGVI----NVSVSEAAIES 258

>NCAS0I01720 Chr9 (318144..319199) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 95.1 bits (235), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 82/282 (29%), Positives = 131/282 (46%), Gaps = 36/282 (12%)

Query: 15  AVAYEA-GKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDP-EGAFPSILGHE 72
           A+ +E+ G PL  + I V  PK++E+ V + ++ VCHTD +   G  P +   P + GHE
Sbjct: 12  AIIFESNGGPLEYKDIPVPTPKSNEILVNIKYSGVCHTDLHAWKGDWPLDTKLPLVGGHE 71

Query: 73  GAGIVESVGDGVTNVKVGDHV-VLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGT 131
           GAGIV ++GD V   K+GD+  V      C  C++C+    + C +   +   G   DG 
Sbjct: 72  GAGIVVAIGDNVKGWKIGDYAGVKWLNGSCMACEYCELGNESNCPNADLS---GYTHDG- 127

Query: 132 TRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKT 191
                             +F QY     V    I     LS V  + C   T Y  A+K+
Sbjct: 128 ------------------SFQQYATADAVQAARIPAGTNLSEVAPILCAGMTVY-KALKS 168

Query: 192 ANVQEGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLK 250
           AN++ G+ VA+ GA G +G   +Q A + G  +++ +D  D K +         F+    
Sbjct: 169 ANLRAGEWVAISGACGGLGSLCIQYANAMG-YRVLGIDGGDDKAKLFKQLHGEVFI---- 223

Query: 251 DLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHK 292
           D  + + ++S++  +T+GG         NV V   A+EA  K
Sbjct: 224 DFTKTKDVISEVNKVTNGGAHGVI----NVSVSEAAIEASTK 261

>Suva_4.394 Chr4 (702935..703990) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 95.1 bits (235), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 86/279 (30%), Positives = 123/279 (44%), Gaps = 35/279 (12%)

Query: 14  AAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDP-EGAFPSILGHE 72
           A V YE    L  + I V  PKA+E+ V V ++ VCH+D +   G  P +  FP I GHE
Sbjct: 12  AIVFYETNGKLEYKDIAVPEPKANEILVHVKYSGVCHSDLHAWRGDWPFQLKFPLIGGHE 71

Query: 73  GAGIVESVGDGVTNVKVGDHV-VLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGT 131
           GAG+V  +G  V   KVGD   +      C  C++C+    + C  +          DGT
Sbjct: 72  GAGVVVKLGSNVKGWKVGDLAGIKWLNGTCMSCEYCEVGNESQCPHL----------DGT 121

Query: 132 TRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKT 191
              H+             TF +Y     V    +  +  L+ V  + C   T Y  A+K 
Sbjct: 122 GFTHD------------GTFQEYATADAVQAAHLPENVDLAEVAPILCAGVTVY-KALKR 168

Query: 192 ANVQEGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLK 250
           AN+  G  V + GA G +G   +Q A + G  ++I +D  + KKQ     G   F+    
Sbjct: 169 ANLIPGQWVTISGACGGLGSLAIQYATAMG-YRVIGIDEGETKKQLFEGLGGEVFI---- 223

Query: 251 DLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEA 289
           D  + + IV  +I  TDGG         NV V   A+EA
Sbjct: 224 DFTKEKDIVGAVIKATDGGSHGVI----NVSVSEAAIEA 258

>CAGL0I07843g Chr9 complement(756345..757403) [1059 bp, 352 aa] {ON}
           highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086c ADH1 alcohol dehydrogenase I or
           uniprot|P00331 Saccharomyces cerevisiae YMR303c ADH2
          Length = 352

 Score = 94.4 bits (233), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 84/278 (30%), Positives = 128/278 (46%), Gaps = 37/278 (13%)

Query: 16  VAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPEGA-FPSILGHEGA 74
           + YE    L  + I V  PKA+E+ + V ++ VCHTD +   G  P     P + GHEGA
Sbjct: 15  IFYENNGKLEYKDIPVPKPKANEILINVKYSGVCHTDLHAWHGDWPLATKLPLVGGHEGA 74

Query: 75  GIVESVGDGVTNVKVGDHVVLLY-TAECGKCKFC-KSNKTNLCGSVRATQGKGVMPDGTT 132
           G+V  +G+ V   K+GD+  + +    C  C++C KSN++N C     +   G   DG  
Sbjct: 75  GVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCEKSNESN-CPEADLS---GYTHDG-- 128

Query: 133 RFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTA 192
                            +F QY     V    I     L+ V  + C   T Y  A+K+A
Sbjct: 129 -----------------SFQQYATADYVQAARIPQGTDLAQVAPILCAGITVY-KALKSA 170

Query: 193 NVQEGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKD 251
           N+  G+ VA+ G AG +G   VQ AK+ G  +I+ +D  D+KK    + G   FV    D
Sbjct: 171 NLNAGEWVAISGAAGGLGSLAVQYAKAMG-YRILGIDGGDEKKALFHELGGEIFV----D 225

Query: 252 LKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEA 289
             + + +   ++  T+GG         NV V   A+E+
Sbjct: 226 FTKSKNVEQDILVATNGGAHGVI----NVSVSEAAIES 259

>SAKL0B08184g Chr2 (698686..699807) [1122 bp, 373 aa] {ON}
           uniprot|Q9P8S5 Saccharomyces kluyveri Alcohol
           dehydrogenase isozyme 3
          Length = 373

 Score = 94.4 bits (233), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 83/272 (30%), Positives = 126/272 (46%), Gaps = 33/272 (12%)

Query: 2   TSATAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDP 61
           T ATA  P +    + YE G  L  E I V  PK +E+ + V ++ VCHTD +   G  P
Sbjct: 22  TMATASIPEKQKGIIFYENGGELKYEDIPVPKPKPNELLINVKYSGVCHTDLHAWKGDWP 81

Query: 62  -EGAFPSILGHEGAGIVESVGDGVTNVKVGDHV-VLLYTAECGKCKFC-KSNKTNLCGSV 118
                P + GHEGAG+V ++G+ V   K+GD   +      C  C++C KSN++N C   
Sbjct: 82  LPTKLPLVGGHEGAGVVVAMGENVKGWKIGDLAGIKWLNGSCLSCEYCEKSNESN-CPHA 140

Query: 119 RATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLG 178
             +   G   DG                   +F QY     V    I     L+ V  + 
Sbjct: 141 DLS---GYTHDG-------------------SFQQYATADYVQAARIPEGTDLAEVSPIL 178

Query: 179 CGVTTGYGAAVKTANVQEGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWS 237
           C   T Y  A+K+AN++ GD VA+ G AG +G   VQ AK+ G  +++ +D   +K +  
Sbjct: 179 CAGVTVY-KALKSANLKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGAEKGELV 236

Query: 238 MDFGATGFVNPLKDLKEGETIVSKLIDMTDGG 269
              G   F+    D  + + +V  + + T+GG
Sbjct: 237 KKLGGEVFI----DFTKHKNLVEAVQEATNGG 264

>KLLA0B09064g Chr2 complement(792849..793973) [1125 bp, 374 aa] {ON}
           uniprot|P49384 Kluyveromyces lactis KLLA0B09064g ADH3
           Alcohol dehydrogenase III mitochondrial precursor
          Length = 374

 Score = 93.6 bits (231), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 76/258 (29%), Positives = 124/258 (48%), Gaps = 33/258 (12%)

Query: 16  VAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDP-EGAFPSILGHEGA 74
           + YE G  L  + I V  PK +E+ + V ++ VCHTD +   G  P     P + GHEGA
Sbjct: 37  IFYENGGKLEYKDIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGA 96

Query: 75  GIVESVGDGVTNVKVGDHVVLLY-TAECGKCKFCK-SNKTNLCGSVRATQGKGVMPDGTT 132
           G+V ++G+ V    +GD   + +    C  C++C+ SN++N C            PD   
Sbjct: 97  GVVVAMGENVKGWNIGDFAGIKWLNGSCMSCEYCELSNESN-C------------PDADL 143

Query: 133 RFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTA 192
             +   G          +F QY     V    I     L+ V  + C   T Y  A+K+A
Sbjct: 144 SGYTHDG----------SFQQYATADAVQAARIPKGTDLAEVAPILCAGVTVY-KALKSA 192

Query: 193 NVQEGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKD 251
           N++ GD VA+ G AG +G   VQ AK+ G  +++ +D  ++K +     G   FV    D
Sbjct: 193 NLKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVVGIDGGEEKGKLVKQLGGEAFV----D 247

Query: 252 LKEGETIVSKLIDMTDGG 269
             + + +V+++ ++T+GG
Sbjct: 248 FTKTKDMVAEIQEITNGG 265

>SAKL0B00814g Chr2 (74565..75629) [1065 bp, 354 aa] {ON} similar to
           uniprot|P35497 Saccharomyces cerevisiae YJR159W SOR1
           Sorbitol dehydrogenase expression is induced in the
           presence of sorbitol
          Length = 354

 Score = 93.2 bits (230), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 111/361 (30%), Positives = 159/361 (44%), Gaps = 55/361 (15%)

Query: 37  HEVRVQVTHTAVCHTDA-YTLSGVDPEGAF----PSILGHEGAGIVESVGDGVTNVKVGD 91
           H V++ +  T +C +D  Y  +G    G F    P +LGHE +G+V  VG  VT+VKVGD
Sbjct: 30  HYVKLAIKKTGICGSDVHYYKTGAI--GNFVVKDPMVLGHESSGVVVEVGSKVTSVKVGD 87

Query: 92  HVVLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCS-T 150
            V +         K  KS   NLC S+       +  DGT   + L  E  L  +  S +
Sbjct: 88  RVAIEPGVPSRYSKATKSGHYNLCPSMAFAATPPI--DGTLLKYYLSPEDFLVKLPDSVS 145

Query: 151 FSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVFGAGTVGL 210
           F +   V            PLS       GV      A K A+V+ G  V VFGAG VGL
Sbjct: 146 FEEGACV-----------EPLS------VGV-----HANKLADVRFGSKVVVFGAGPVGL 183

Query: 211 SVVQGAKSR--GASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDG 268
             + GA SR  GA+ ++ VDV D K + + +FGAT  VN  K  K  + +V ++  +  G
Sbjct: 184 --LAGAVSRAFGATDVVFVDVFDHKLERTNEFGATQTVNSSK-FKSEDDLVKEIQRVLSG 240

Query: 269 GL-DFTFDCTGNVKVMRDALEACHKG-----WGQSXXXXXXXXXXXXSTRPFQLITGRVW 322
              +  F+C+G    +R  ++AC  G      G              S     L T R  
Sbjct: 241 EQPEVVFECSGAEVCIRAGIKACKAGGRYVQVGMGKDNVNFPISEVVSKELQVLGTFRYC 300

Query: 323 KGSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPFTEINNAFE-DLHHG-DCLRTVL 380
            G     +K  SE          G + V   ITH+  F +   A+E ++ HG D ++T++
Sbjct: 301 FGDYNDSVKLISE----------GKVNVKPLITHRFKFQDAIKAYEFNIEHGEDVVKTII 350

Query: 381 D 381
           D
Sbjct: 351 D 351

>KLLA0F18260g Chr6 complement(1683417..1684463) [1047 bp, 348 aa]
           {ON} uniprot|P49383 Kluyveromyces lactis KLLA0F18260g
           ADH2 Alcohol dehydrogenase 2
          Length = 348

 Score = 93.2 bits (230), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 74/258 (28%), Positives = 121/258 (46%), Gaps = 33/258 (12%)

Query: 16  VAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDP-EGAFPSILGHEGA 74
           + YE G  L  + I V  PKA+E+ + V ++ VCHTD +   G  P     P + GHEGA
Sbjct: 11  IFYENGGELQYKDIPVPKPKANELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGA 70

Query: 75  GIVESVGDGVTNVKVGDHV-VLLYTAECGKCKFCK-SNKTNLCGSVRATQGKGVMPDGTT 132
           G+V ++G+ V    +GD   +      C  C++C+ SN++N              PD   
Sbjct: 71  GVVVAMGENVKGWNIGDFAGIKWLNGSCMSCEYCELSNESNC-------------PDADL 117

Query: 133 RFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTA 192
             +   G          +F QY     V    I     L+ V  + C   T Y  A+K+A
Sbjct: 118 SGYTHDG----------SFQQYATADAVQAARIPKGTDLAEVAPILCAGVTVY-KALKSA 166

Query: 193 NVQEGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKD 251
           +++ GD VA+ GA G +G   +Q AK+ G  +++ +D   +K +   + G   FV    D
Sbjct: 167 DLKAGDWVAISGACGGLGSLAIQYAKAMG-YRVLGIDTGAEKAKLFKELGGEYFV----D 221

Query: 252 LKEGETIVSKLIDMTDGG 269
               + ++ +++D T+GG
Sbjct: 222 YAVSKDLIKEIVDATNGG 239

>KLTH0D05588g Chr4 complement(502176..503345) [1170 bp, 389 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3 Alcohol dehydrogenase isoenzyme III
          Length = 389

 Score = 92.8 bits (229), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 74/257 (28%), Positives = 117/257 (45%), Gaps = 31/257 (12%)

Query: 16  VAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPEGA-FPSILGHEGA 74
           + YE G  L  + + V  PK +E+ + V ++ VCHTD +   G  P     P + GHEGA
Sbjct: 52  IFYEHGGELHYKDLPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLAVKLPLVGGHEGA 111

Query: 75  GIVESVGDGVTNVKVGDHVVLLY-TAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTR 133
           G+V + G+ VTN ++GD+  + +    C  C+ C+      C     +   G   DG   
Sbjct: 112 GVVVAKGENVTNFEIGDYAGIKWLNGSCMSCELCEQGNEPNCEHADLS---GYTHDG--- 165

Query: 134 FHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTAN 193
                           +F QY     V    I     L+ +  + C   T Y  A+KTA+
Sbjct: 166 ----------------SFQQYATADAVQAAQIPKGTDLAQIAPILCAGVTVY-KALKTAD 208

Query: 194 VQEGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDL 252
           V+ G  VA+ G AG +G   VQ AK+ G  +++ +D  + KK+   D G   F+    D 
Sbjct: 209 VRPGQWVAISGAAGGLGSLAVQYAKAMGL-RVLGIDGGEDKKKLFHDLGGETFI----DF 263

Query: 253 KEGETIVSKLIDMTDGG 269
           +  + +V  + + T GG
Sbjct: 264 RTTKDMVGAIQEATQGG 280

>Skud_13.240 Chr13 (408909..410036) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 92.4 bits (228), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 77/269 (28%), Positives = 119/269 (44%), Gaps = 31/269 (11%)

Query: 4   ATAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPEG 63
           +TA  P      + YE    L  + I V  PK +E+ + V ++ VCHTD +   G  P  
Sbjct: 26  STAAIPKTQKGVIFYENNGKLHYKDIPVPQPKPNEILINVKYSGVCHTDLHAWHGDWPLA 85

Query: 64  A-FPSILGHEGAGIVESVGDGVTNVKVGDHV-VLLYTAECGKCKFCKSNKTNLCGSVRAT 121
              P + GHEGAG+V  +G  V   KVGD   +      C  C+FC+S   + C     +
Sbjct: 86  VKLPLVGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNCPEADLS 145

Query: 122 QGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGV 181
              G   DG                   +F Q+     +    I P   L+ V  + C  
Sbjct: 146 ---GYTHDG-------------------SFQQFATADAIQAAKIQPGTDLAEVAPILCAG 183

Query: 182 TTGYGAAVKTANVQEGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDF 240
            T Y  A+K AN++ GD VA+ G AG +G   VQ A + G  +++ +D  ++K++     
Sbjct: 184 VTVY-KALKEANLKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGEEKEKLFKQL 241

Query: 241 GATGFVNPLKDLKEGETIVSKLIDMTDGG 269
           G   F+    D  + + +VS + + T GG
Sbjct: 242 GGEVFI----DFTKTKDMVSDIQEATKGG 266

>Smik_13.520 Chr13 complement(856008..857054) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 92.0 bits (227), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 82/277 (29%), Positives = 126/277 (45%), Gaps = 35/277 (12%)

Query: 16  VAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDP-EGAFPSILGHEGA 74
           + YE+   L  + I V  PK +E+ + V ++ VCHTD +   G  P     P + GHEGA
Sbjct: 11  IFYESNGKLEHKDIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPLVGGHEGA 70

Query: 75  GIVESVGDGVTNVKVGDHVVLLY-TAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTR 133
           G+V ++GD V   KVGD   + +  + C  C++C+    + C     +   G   DG   
Sbjct: 71  GVVVAIGDNVRGWKVGDLAGIKWLNSSCMACEYCELGNESNCPHADLS---GYTHDG--- 124

Query: 134 FHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTAN 193
                           +F QY     V    I     L+ V  + C   T Y  A+K+AN
Sbjct: 125 ----------------SFQQYATADAVQAARIPEGTDLAQVAPILCAGITVY-KALKSAN 167

Query: 194 VQEGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDL 252
           ++ G  VA+ G AG +G   VQ AK+ G  +++ +D  + K++     G   F+    D 
Sbjct: 168 LRAGHWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEGKEELFTSLGGEVFI----DF 222

Query: 253 KEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEA 289
            + + IVS ++  TDGG         NV V   A+EA
Sbjct: 223 TKEKDIVSAVVKATDGGAHGIV----NVSVSEAAIEA 255

>Skud_13.477 Chr13 complement(846790..847836) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 91.7 bits (226), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 82/280 (29%), Positives = 125/280 (44%), Gaps = 35/280 (12%)

Query: 16  VAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDP-EGAFPSILGHEGA 74
           + YE+   L  + I V  PK +E+ + V ++ VCHTD +   G  P     P + GHEGA
Sbjct: 11  IFYESNGKLEHKNIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPLVGGHEGA 70

Query: 75  GIVESVGDGVTNVKVGDHV-VLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTR 133
           G+V ++GD V   KVGD   V    + C  C++C+    + C     +   G   DG   
Sbjct: 71  GVVVAIGDNVRGWKVGDLAGVKWLNSSCMACEYCELGNESNCPHADLS---GYTHDG--- 124

Query: 134 FHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTAN 193
                           +F QY     V    I     L+ V  + C   T Y  A+K+AN
Sbjct: 125 ----------------SFQQYATADAVQAARIPEGTDLAEVAPILCAGITVY-KALKSAN 167

Query: 194 VQEGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDL 252
           ++ G+ VA+ G AG +G   VQ AK+ G  +++ +D    K++     G   F+    D 
Sbjct: 168 LRAGNWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGPGKQELFTSLGGEVFI----DF 222

Query: 253 KEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHK 292
            + + I+  ++  TDGG         NV V   A+EA  K
Sbjct: 223 TKEKDIIGAVVKATDGGAHGII----NVSVSEAAIEASTK 258

>KLTH0E05588g Chr5 complement(494815..495861) [1047 bp, 348 aa] {ON}
           highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086C ADH1 Alcohol dehydrogenase involved
           in the production of certain carboxylate esters
          Length = 348

 Score = 91.7 bits (226), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 82/279 (29%), Positives = 130/279 (46%), Gaps = 36/279 (12%)

Query: 15  AVAYEA-GKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPEGA-FPSILGHE 72
           AV +E  G  L  + I V  P A+E+ + V ++ VCHTD +   G  P     P + GHE
Sbjct: 9   AVVFETNGGELEYKDIPVPKPAANEILINVKYSGVCHTDLHAWKGDWPLATKLPLVGGHE 68

Query: 73  GAGIVESVGDGVTNVKVGDHVVLLY-TAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGT 131
           GAG+V  +G+ V   K+GD   + +    C  C+ C+ +  + C     +   G   DG 
Sbjct: 69  GAGVVVGIGENVKGWKLGDLAGIKWLNGSCMACESCELSNESNCPHADLS---GYTHDG- 124

Query: 132 TRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKT 191
                             +F QY     V    I     L+ V  + C   T Y  A+K+
Sbjct: 125 ------------------SFQQYATADAVQAARIPEGTDLAEVAPILCAGITVY-KALKS 165

Query: 192 ANVQEGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLK 250
           AN++ G+ VA+ G AG +G   VQ AK+ G  ++I +D  D+K+Q     G   FV    
Sbjct: 166 ANLRAGNWVAISGAAGGLGSLAVQYAKAMG-YRVIGIDGGDEKEQLFKKLGGEYFV---- 220

Query: 251 DLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEA 289
           D ++ + +V++++++T GG         NV V   A+E+
Sbjct: 221 DFRKSKDVVAEILEVTGGGAHGVV----NVSVSEAAIES 255

>Ecym_7391 Chr7 (801773..802900) [1128 bp, 375 aa] {ON} similar to
           Ashbya gossypii ABL033C
          Length = 375

 Score = 91.7 bits (226), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 80/272 (29%), Positives = 122/272 (44%), Gaps = 31/272 (11%)

Query: 1   MTSATAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVD 60
           ++S ++G P+   A + YE G  L  + I V  PK +E+ V V ++ VCHTD +   G  
Sbjct: 23  LSSTSSGIPLTQKAVIFYEHGDKLHYKDIPVPKPKPNEILVNVKYSGVCHTDIHAWKGDW 82

Query: 61  PEGA-FPSILGHEGAGIVESVGDGVTNVKVGDHV-VLLYTAECGKCKFCKSNKTNLCGSV 118
           P     P + GHEGAGIV + G  VTN ++GD+  V      C  C++C++   + C   
Sbjct: 83  PLATKLPLVGGHEGAGIVVAKGSNVTNFEIGDYAGVKWLNKSCMSCEYCETGHESNCAEA 142

Query: 119 RATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLG 178
             +   G   DG                   +F QY     V    I     L+ V  + 
Sbjct: 143 DLS---GYTRDG-------------------SFQQYATADAVQAAKIPQGTDLAQVAPIL 180

Query: 179 CGVTTGYGAAVKTANVQEGDTVAV-FGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWS 237
           C   T Y  A+KTAN+  G  VA+    G +G   VQ AK+ G  +++ +D    K    
Sbjct: 181 CAGVTVY-KALKTANLDPGQWVAISGAGGGLGSLAVQYAKAMGL-RVVGIDGGAAKDALF 238

Query: 238 MDFGATGFVNPLKDLKEGETIVSKLIDMTDGG 269
              G   F+    D  + + IV+ + + T+GG
Sbjct: 239 KKLGGEVFI----DFTKSKDIVADIQEATNGG 266

>ZYRO0B05940g Chr2 (480279..481418) [1140 bp, 379 aa] {ON} highly
           similar to uniprot|P00330 Saccharomyces cerevisiae
           YOL086C ADH1 Alcohol dehydrogenase involved in the
           production of certain carboxylate esters
          Length = 379

 Score = 91.3 bits (225), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 81/277 (29%), Positives = 123/277 (44%), Gaps = 35/277 (12%)

Query: 19  EAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDP-EGAFPSILGHEGAGIV 77
           E+  PL  ++I V  PK +E+ + V ++ VCHTD +   G  P     P + GHEGAG V
Sbjct: 45  ESNGPLEYKEIPVPTPKPNEILIHVRYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGAGEV 104

Query: 78  ESVGDGVTNVKVGDHV-VLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHN 136
            ++G  V N KVGD   +      C  C+ C+ +  + C            PD     + 
Sbjct: 105 IALGSNVKNWKVGDLAGIKWLNGSCMSCESCEQSNESNC------------PDADLSGYT 152

Query: 137 LKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQE 196
             G          +F QY     V    I P   L+ V  + C   T Y  A+K+AN++ 
Sbjct: 153 HDG----------SFQQYATADAVQAAHIPPGTDLAEVAPVLCAGITVY-KALKSANLKA 201

Query: 197 GDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEG 255
           G  VA+ G AG +G   VQ AK+ G  +++ +D    K++     G   F+    D ++ 
Sbjct: 202 GQWVAISGAAGGLGSLAVQFAKAMGL-RVVGIDGGPGKEELFKTLGGEVFI----DFQKE 256

Query: 256 ETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHK 292
             IV  +++ T+GG         NV V   A+ A  K
Sbjct: 257 SDIVGAVVNATNGGAHGVV----NVSVSEGAISASTK 289

>KLLA0F13530g Chr6 (1251162..1252289) [1128 bp, 375 aa] {ON}
           uniprot|P49385 Kluyveromyces lactis ADH4 Alcohol
           dehydrogenase IV, mitochondrial precursor
          Length = 375

 Score = 90.5 bits (223), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 72/257 (28%), Positives = 120/257 (46%), Gaps = 31/257 (12%)

Query: 16  VAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPEGA-FPSILGHEGA 74
           + YE G  L  + + V  PKA+E+ + V ++ VCHTD +   G  P     P + GHEGA
Sbjct: 38  IFYENGGKLEYKDLPVPKPKANEILINVKYSGVCHTDLHAWKGDWPLPVKLPLVGGHEGA 97

Query: 75  GIVESVGDGVTNVKVGDHV-VLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTR 133
           GIV + G+ V N ++GD+  +      C  C+ C+    + C          +  D +  
Sbjct: 98  GIVVAKGENVKNFEIGDYAGIKWLNGSCMSCELCEQGYESNC----------LQADLSGY 147

Query: 134 FHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTAN 193
            H+             +F QY     V    I     L+ +  + C   T Y  A+KTA+
Sbjct: 148 THD------------GSFQQYATADAVQAAQIPKGTDLAEIAPILCAGVTVY-KALKTAD 194

Query: 194 VQEGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDL 252
           ++ G  VA+ G AG +G   VQ AK+ G  +++ +D  D K++     G   F+    D 
Sbjct: 195 LKPGQWVAISGAAGGLGSLAVQYAKAMGL-RVLGIDGGDGKEELFKQCGGEVFI----DF 249

Query: 253 KEGETIVSKLIDMTDGG 269
           ++ + +V+ + + T+GG
Sbjct: 250 RKSKDMVADIQEATNGG 266

>KAFR0A00790 Chr1 complement(140666..141799) [1134 bp, 377 aa] {ON}
           Anc_2.480 YMR083W
          Length = 377

 Score = 90.5 bits (223), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 73/257 (28%), Positives = 114/257 (44%), Gaps = 28/257 (10%)

Query: 16  VAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPEGA-FPSILGHEGA 74
           + YE G PLT + + V  PK +E+ + V ++ VCHTD +   G  P     P + GHEGA
Sbjct: 37  IFYENGGPLTYKDMPVPVPKPNEILINVKYSGVCHTDLHAWKGDWPLPVKLPLVGGHEGA 96

Query: 75  GIVESVGDGVTNVKVGDHV-VLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTR 133
           GIV + G  V N ++GD   +      C  C+ C+    + C     +   G   DG   
Sbjct: 97  GIVVAKGSNVKNFEIGDLAGIKWLNGSCMACELCEKGYESNCEHADLS---GYTHDG--- 150

Query: 134 FHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTAN 193
                           +F QY          I     L+ V  + C   T Y  A+KTA 
Sbjct: 151 ----------------SFQQYATADATQAAQIPRGTDLAEVAPILCAGVTVY-KALKTAA 193

Query: 194 VQEGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDL 252
           +Q G+ VA+ GA G +G   +Q AK+ G  +++ +D  + K +   + G   F++     
Sbjct: 194 LQPGEWVAISGACGGLGSLAIQYAKAMGL-RVLGIDGGEAKAKMFKELGGETFID-FTKY 251

Query: 253 KEGETIVSKLIDMTDGG 269
           K  E ++  + + T GG
Sbjct: 252 KNNEAMIKDIQEATKGG 268

>NDAI0A06930 Chr1 (1585575..1586630) [1056 bp, 351 aa] {ON}
           Anc_3.118
          Length = 351

 Score = 90.1 bits (222), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 81/281 (28%), Positives = 128/281 (45%), Gaps = 32/281 (11%)

Query: 15  AVAYEA-GKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPEGA-FPSILGHE 72
           AV +E  G  L  + I V  PK+ E+ + V ++ VCHTD +   G  P     P + GHE
Sbjct: 12  AVIFETNGGKLEYKDIPVPVPKSTEILINVKYSGVCHTDLHAWKGDWPLATKLPLVGGHE 71

Query: 73  GAGIVESVGDGVTNVKVGDHVVLLY-TAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGT 131
           GAGIV  VG+ V   KVGD   + +    C  C++C+    + C +   +   G   DG 
Sbjct: 72  GAGIVVQVGENVQGWKVGDLAGIKWLNGSCMACEYCELGNESNCPNADLS---GYTHDG- 127

Query: 132 TRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKT 191
                             +F QY     V    I     L+ V  + C   T Y  A+K+
Sbjct: 128 ------------------SFQQYATADAVQAARIPQGTDLAEVAPVLCAGITVY-KALKS 168

Query: 192 ANVQEGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLK 250
           AN++ G+ VA+ G AG +G   VQ AK+ G  +I+ +D  ++K++   + G   F+    
Sbjct: 169 ANLRAGEWVAISGAAGGLGSLAVQYAKAMG-YRILGIDGGEEKEKLFRELGGEIFI---- 223

Query: 251 DLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACH 291
           D  + + IV  +I  T+GG     + + +   +  + E C 
Sbjct: 224 DFTKTKDIVGDIIKATNGGAHGVINVSVSEAAIGASTEYCR 264

>Kpol_1058.11 s1058 (41165..42226) [1062 bp, 353 aa] {ON}
           (41165..42226) [1062 nt, 354 aa]
          Length = 353

 Score = 89.7 bits (221), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 87/286 (30%), Positives = 126/286 (44%), Gaps = 33/286 (11%)

Query: 14  AAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAY--TLSGVDPEGAF----PS 67
           A +  E GK +   + I      H V+VQ+  T +C +D +  T   +   G+F    P 
Sbjct: 8   AVILEEKGKIVFGNRPIPSIEDQHFVKVQIKATGICGSDVHFCTHGAI---GSFIVKEPM 64

Query: 68  ILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVM 127
           +LGHE +GIV  VG  VT V VGD V +         +   S   NLC  ++      V 
Sbjct: 65  VLGHESSGIVVEVGSEVTKVAVGDRVAIEPGYPSRYSEETVSGHYNLCPGMKFAATPPV- 123

Query: 128 PDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGA 187
            DGT          LL +        Y +  DV+        PL+               
Sbjct: 124 -DGT----------LLKYFQVPEDFVYKLPDDVTFEEGALVEPLAVAV-----------H 161

Query: 188 AVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVN 247
           AVK A V+ GD V VFGAG VGL V    K+ GA++++ +DV D+K   S++ G+T  +N
Sbjct: 162 AVKLAGVKFGDKVVVFGAGPVGLLVGSVCKAFGATEVVSIDVVDKKLDKSLEMGSTIAIN 221

Query: 248 PLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHKG 293
             KD+ E    +    D+     +   DCTG    +R ++ AC  G
Sbjct: 222 S-KDMAEEALALEIQNDLNGQHPNKVIDCTGAEPCLRSSILACKPG 266

>TPHA0G03210 Chr7 complement(688137..689270) [1134 bp, 377 aa] {ON}
           Anc_2.480 YMR083W
          Length = 377

 Score = 89.7 bits (221), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 77/257 (29%), Positives = 116/257 (45%), Gaps = 31/257 (12%)

Query: 16  VAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPEGA-FPSILGHEGA 74
           + YE   PL  + I V  PK++E+ + V ++ VCHTD +   G  P     P + GHEGA
Sbjct: 40  IFYENNGPLEYKDIPVPKPKSNEILINVEYSGVCHTDLHAWKGDWPLPVKLPLVGGHEGA 99

Query: 75  GIVESVGDGVTNVKVGDHV-VLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTR 133
           G+V  +GD V N K+GD   +      C  C+ C++     C     +   G   DG   
Sbjct: 100 GVVVGMGDNVKNWKIGDLAGIKWLNGSCMSCELCENGFEANCEHADLS---GYTHDG--- 153

Query: 134 FHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTAN 193
                           +F QY     V    I     L++V  + C   T Y  A+KTA+
Sbjct: 154 ----------------SFQQYATADAVQAARIPAGTDLANVAPILCAGVTVY-KALKTAD 196

Query: 194 VQEGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDL 252
           ++ GD VA+ G AG +G   VQ A + G  ++I +D  + KK+     G   F+    D 
Sbjct: 197 LKPGDWVAISGAAGGLGSLAVQYAAAMGL-RVIGIDGGEDKKKLFEKCGGEVFI----DF 251

Query: 253 KEGETIVSKLIDMTDGG 269
            + + IV  + + T GG
Sbjct: 252 TKSKDIVKDIQEATHGG 268

>YOL086C Chr15 complement(159548..160594) [1047 bp, 348 aa] {ON}
           ADH1Alcohol dehydrogenase, fermentative isozyme active
           as homo- or heterotetramers; required for the reduction
           of acetaldehyde to ethanol, the last step in the
           glycolytic pathway
          Length = 348

 Score = 89.0 bits (219), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 80/277 (28%), Positives = 124/277 (44%), Gaps = 35/277 (12%)

Query: 16  VAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPEGA-FPSILGHEGA 74
           + YE+   L  + I V  PKA+E+ + V ++ VCHTD +   G  P     P + GHEGA
Sbjct: 11  IFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGA 70

Query: 75  GIVESVGDGVTNVKVGDHVVLLY-TAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTR 133
           G+V  +G+ V   K+GD+  + +    C  C++C+    + C     +   G   DG   
Sbjct: 71  GVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNCPHADLS---GYTHDG--- 124

Query: 134 FHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTAN 193
                           +F QY     V    I     L+ V  + C   T Y  A+K+AN
Sbjct: 125 ----------------SFQQYATADAVQAAHIPQGTDLAQVAPILCAGITVY-KALKSAN 167

Query: 194 VQEGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDL 252
           +  G  VA+ G AG +G   VQ AK+ G  +++ +D  + K++     G   F+    D 
Sbjct: 168 LMAGHWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEGKEELFRSIGGEVFI----DF 222

Query: 253 KEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEA 289
            + + IV  ++  TDGG         NV V   A+EA
Sbjct: 223 TKEKDIVGAVLKATDGGAHGVI----NVSVSEAAIEA 255

>TBLA0E03430 Chr5 (850493..851548) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 88.6 bits (218), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 80/280 (28%), Positives = 130/280 (46%), Gaps = 37/280 (13%)

Query: 14  AAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDP-EGAFPSILGHE 72
           A + YE+G  L  + + V  PK +E+ + + ++ VCHTD +   G  P +   P I GHE
Sbjct: 12  AVIFYESGGALEYKDVPVPTPKPNEILINIKYSGVCHTDLHAWKGDWPLDTKLPLIGGHE 71

Query: 73  GAGIVESVGDGVTNVKVGDHV-VLLYTAECGKCKFCK-SNKTNLCGSVRATQGKGVMPDG 130
           GAG+V  +G  V   K+GD+  V      C  C+ C+ SN++N              P+ 
Sbjct: 72  GAGVVVGMGANVRGWKIGDYAGVKWLNGSCMSCEECELSNESNC-------------PEA 118

Query: 131 TTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVK 190
               +   G          +F +Y     V    I   A L+ V  + C   T Y  A+K
Sbjct: 119 DLSGYTHDG----------SFQEYCTADAVQAARIPQGADLAEVAPILCAGVTVY-KALK 167

Query: 191 TANVQEGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPL 249
           +A++  G+ VA+ GA G +G   VQ AK+ G  +++ +D  ++KK+   + G   F+   
Sbjct: 168 SADLAAGEWVAISGACGGLGSLAVQFAKAMGL-RVLGIDGGEEKKKMFHEMGGEVFL--- 223

Query: 250 KDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEA 289
            D +  + + + +I  T+GG         NV V   A+EA
Sbjct: 224 -DFRLEKDMEAAVIKATNGGAHGVI----NVSVSEAAIEA 258

>Skud_15.68 Chr15 complement(118795..119841) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 88.6 bits (218), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 80/277 (28%), Positives = 124/277 (44%), Gaps = 35/277 (12%)

Query: 16  VAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDP-EGAFPSILGHEGA 74
           + YE+   L  + I V  PKA+E+ + V ++ VCHTD +   G  P     P + GHEGA
Sbjct: 11  IFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPTKLPLVGGHEGA 70

Query: 75  GIVESVGDGVTNVKVGDHVVLLY-TAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTR 133
           G+V ++G+ V    +GD   + +    C  C++C+    + C     +   G   DG   
Sbjct: 71  GVVVAMGENVKGWNIGDFAGIKWLNGSCMACEYCELGNESNCPHADLS---GYTHDG--- 124

Query: 134 FHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTAN 193
                           +F QY     V    + P   L+ V  + C   T Y  A+K+AN
Sbjct: 125 ----------------SFQQYATADAVQAAHVAPGTDLAEVAPVLCAGITVY-KALKSAN 167

Query: 194 VQEGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDL 252
           +  G  VA+ G AG +G   VQ AK+ G  ++I +D  + K++     G   FV    D 
Sbjct: 168 LMAGHWVAISGAAGGLGSLAVQYAKAMG-YRVIGIDGGEGKEELFRSIGGEVFV----DF 222

Query: 253 KEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEA 289
            + + IV  ++  T+GG         NV V   A+EA
Sbjct: 223 TKEKDIVGAVLKATNGGAHGVI----NVSVSEAAIEA 255

>KAFR0L02010 Chr12 (379623..380678) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 88.2 bits (217), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 89/372 (23%), Positives = 159/372 (42%), Gaps = 39/372 (10%)

Query: 14  AAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSG-VDPEGAFPSILGHE 72
           A +  E G  L  + I V  PK++E+ + V ++ VCH+D +   G +      P + GHE
Sbjct: 12  AIIFSEVGGKLEYKDIPVPVPKSNELLINVLYSGVCHSDLHIWQGDLPLPLKLPLVGGHE 71

Query: 73  GAGIVESVGDGVTNVKVGDHV-VLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGT 131
           GAG+V  +G  V   K+GD+  +      C  C+FC+ +    C     T   G + DG 
Sbjct: 72  GAGVVVGMGSNVKGWKLGDYAGIKFLNGTCNACEFCEQSFEISCPHADFT---GTVHDG- 127

Query: 132 TRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKT 191
                             +F QY     V    I     L+++  L C   T Y  A+K+
Sbjct: 128 ------------------SFQQYATADAVQAARIPQGTDLAAIAPLLCAGLTAY-KALKS 168

Query: 192 ANVQEGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLK 250
           AN++ G  VA+ GA G +G   +Q A + G  +++ +D  ++K ++    G   F+    
Sbjct: 169 ANMRPGQWVAISGACGGLGTYAIQYATAMG-YRVLGIDSGEEKAKYFKTLGGEVFI---- 223

Query: 251 DLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHKGWGQSXXXXXXXXXXXXS 310
           D K+ + +V+ +I  TDGG     +   + + +  + +      G S            S
Sbjct: 224 DYKKSKDVVADVIKATDGGAHGVLNIAVDPRAISMSTKYVRSN-GTSVLVSLPKDAVCES 282

Query: 311 TRPFQLITGRVWKGSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPFTEINNAFEDL 370
               Q++      GS  G    R++  + +  + +G +K+     H  P + +   ++ L
Sbjct: 283 EVFTQVVKSTSIVGSCVG---NRADTREAIDFFTRGLIKIP---IHMAPLSSLPQIYDKL 336

Query: 371 HHGDCL-RTVLD 381
              + + R V+D
Sbjct: 337 MQNEVVGRFVVD 348

>TBLA0E03440 Chr5 (852767..853822) [1056 bp, 351 aa] {ON} Anc_3.118
           YBR145W
          Length = 351

 Score = 88.2 bits (217), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 78/280 (27%), Positives = 128/280 (45%), Gaps = 37/280 (13%)

Query: 14  AAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDP-EGAFPSILGHE 72
           A + Y+ G PL  + + V  PK +E+ + + ++ VCHTD +   G  P +   P I GHE
Sbjct: 12  AVIFYKNGGPLEYKDVPVPTPKPNEILINIKYSGVCHTDLHAWKGDWPLDTKLPLIGGHE 71

Query: 73  GAGIVESVGDGVTNVKVGDHV-VLLYTAECGKCKFCK-SNKTNLCGSVRATQGKGVMPDG 130
           GAG+V  +G  V   K+GD+  V      C  C+ C+ SN++N              P+ 
Sbjct: 72  GAGVVVGMGSNVKGWKIGDYAGVKWLNGSCMSCEECELSNESNC-------------PEA 118

Query: 131 TTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVK 190
               +   G          +F +Y     V    I     L+ V  L C   T Y  A+K
Sbjct: 119 DLSGYTHDG----------SFQEYCTADAVQAARIPQGTDLAQVAPLLCAGVTVY-KALK 167

Query: 191 TANVQEGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPL 249
           +A++  G  VA+ GA G +G   +Q AK+ G  +++ +D  ++KK+   + G   F+   
Sbjct: 168 SADLAAGQWVAISGACGGLGSLAIQFAKAMGL-RVLGIDGGEEKKKMFHELGGEVFL--- 223

Query: 250 KDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEA 289
            D +  + + + +I  T+GG         NV V   A+E+
Sbjct: 224 -DFRLEKDMEAAIIKATNGGAHGVI----NVSVSEAAIES 258

>Smik_15.71 Chr15 complement(122645..123691) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 87.8 bits (216), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 79/277 (28%), Positives = 125/277 (45%), Gaps = 35/277 (12%)

Query: 16  VAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDP-EGAFPSILGHEGA 74
           + YE+   L  + I V  PKA+E+ + V ++ VCHTD +   G  P     P + GHEGA
Sbjct: 11  IFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPTKLPLVGGHEGA 70

Query: 75  GIVESVGDGVTNVKVGDHVVLLY-TAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTR 133
           G+V ++G+ V    +GD+  + +    C  C++C+    + C     +   G   DG   
Sbjct: 71  GVVVAMGENVKGWNIGDYAGIKWLNGSCMACEYCELGNESNCPHADLS---GYTHDG--- 124

Query: 134 FHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTAN 193
                           +F QY     V    I     L+ V  + C   T Y  A+K+AN
Sbjct: 125 ----------------SFQQYATADAVQAAHIPQGTDLAEVAPVLCAGITVY-KALKSAN 167

Query: 194 VQEGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDL 252
           +  G  VA+ G AG +G   VQ AK+ G  +++ +D  + K++     G   F+    D 
Sbjct: 168 LMAGHWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEGKEELFRSIGGEVFI----DF 222

Query: 253 KEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEA 289
            + + IV+ ++  TDGG         NV V   A+EA
Sbjct: 223 TKEKDIVNAVLKATDGGAHGVI----NVSVSEAAIEA 255

>NDAI0H02160 Chr8 (528551..529696) [1146 bp, 381 aa] {ON} Anc_2.480
          Length = 381

 Score = 88.2 bits (217), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 78/271 (28%), Positives = 118/271 (43%), Gaps = 31/271 (11%)

Query: 2   TSATAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDP 61
           ++A    P    A V YE G PL  + I V  PKA+E+ + V ++ VCHTD +   G  P
Sbjct: 30  STAAGSIPKTQKAVVFYENGGPLHYKDIPVPKPKANEILINVKYSGVCHTDLHAWKGDWP 89

Query: 62  -EGAFPSILGHEGAGIVESVGDGVTNVKVGDHV-VLLYTAECGKCKFCKSNKTNLCGSVR 119
                P + GHEG+G+V  VG+ V   KVGD   +      C  C+ C++   + C    
Sbjct: 90  LPTKLPLVGGHEGSGVVMQVGENVKGWKVGDLAGIKWLNGSCMACELCETGNESNCEHAD 149

Query: 120 ATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGC 179
            +   G   DG                   +F QY     V    I     L+ V  + C
Sbjct: 150 LS---GYTHDG-------------------SFQQYATADAVQAARIPEGTNLAEVAPILC 187

Query: 180 GVTTGYGAAVKTANVQEGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSM 238
              T Y  A+K A+++ G  V + G AG +G   VQ AK+ G  ++I +D    K++   
Sbjct: 188 AGITVY-KALKEADLKAGQWVCISGAAGGLGSLAVQYAKAMG-YRVIGIDGGKAKEELFK 245

Query: 239 DFGATGFVNPLKDLKEGETIVSKLIDMTDGG 269
             G   F+    D  + + +V  + + T GG
Sbjct: 246 SMGGEVFI----DFTKSKDMVKDIQEATKGG 272

>Suva_13.494 Chr13 complement(856051..857097) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 87.8 bits (216), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 81/277 (29%), Positives = 124/277 (44%), Gaps = 35/277 (12%)

Query: 16  VAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPEGA-FPSILGHEGA 74
           + YE+   L  + I V  PK +E+ + V ++ VCHTD +   G  P     P + GHEGA
Sbjct: 11  IFYESNGKLEHKDIPVPTPKPNELLINVKYSGVCHTDLHAWHGDWPLATKLPLVGGHEGA 70

Query: 75  GIVESVGDGVTNVKVGDHVVLLY-TAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTR 133
           G+V ++G+ V   KVGD   + +  + C  C++C+    + C     +   G   DG   
Sbjct: 71  GVVVAMGENVRGWKVGDLAGIKWLNSSCMACEYCELGNESNCPHADLS---GYTHDG--- 124

Query: 134 FHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTAN 193
                           +F QY     V    I     L+ V  + C   T Y  A+K+AN
Sbjct: 125 ----------------SFQQYATADAVQAAHIPEGTDLAEVAPILCAGITVY-KALKSAN 167

Query: 194 VQEGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDL 252
           ++ G  VA+ G AG +G   VQ AK+ G  +++ +D    K++     G   F+    D 
Sbjct: 168 LRAGHWVAISGAAGGLGSLAVQYAKAMG-YRVVGIDGGPGKEELFTSLGGEVFI----DF 222

Query: 253 KEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEA 289
            + + IV  +I  TDGG         NV V   A+EA
Sbjct: 223 TKEKDIVGAVIKATDGGAHGIV----NVSVSEAAIEA 255

>Skud_2.272 Chr2 (501260..502315) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 87.8 bits (216), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 82/279 (29%), Positives = 122/279 (43%), Gaps = 35/279 (12%)

Query: 14  AAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDP-EGAFPSILGHE 72
           A V YE    L  + + V  PK +E+ V V ++ VCH+D +   G  P +  FP I GHE
Sbjct: 12  AIVFYETDGKLEYKDVAVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQLKFPLIGGHE 71

Query: 73  GAGIVESVGDGVTNVKVGDHV-VLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGT 131
           GAG+V  +G  V   KVGD   +      C  C++C+    + C  +          DGT
Sbjct: 72  GAGVVVKLGSNVKGWKVGDIAGIKWLNGTCMSCEYCEVGNESQCPHL----------DGT 121

Query: 132 TRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKT 191
              H+             TF +Y     V    I  +  L+ V  + C   T Y  A+K 
Sbjct: 122 GFTHD------------GTFQEYATADAVQAAHIPQNVDLAEVAPILCAGITVY-KALKR 168

Query: 192 ANVQEGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLK 250
           AN+  G  V + GA G +G   VQ A + G  ++I +D  + K++   +     F+    
Sbjct: 169 ANLMPGQWVTISGACGGLGSLAVQYALAMG-YRVIGIDGGEAKQKLFEELHGEIFI---- 223

Query: 251 DLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEA 289
           D  + + +V  +I  TDGG         NV V   A+EA
Sbjct: 224 DFTKEKDVVGAVIKATDGGSHGVI----NVSVSEAAIEA 258

>TDEL0C00390 Chr3 (53995..55056) [1062 bp, 353 aa] {ON} Anc_8.16
           YLR070C
          Length = 353

 Score = 87.4 bits (215), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 82/290 (28%), Positives = 131/290 (45%), Gaps = 41/290 (14%)

Query: 15  AVAYEAGKPLTVE-KIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPEGAF-------P 66
           AV  E  + + +E + I +    H+V++Q+  T +C +D +  +    +G+        P
Sbjct: 6   AVVLEKKELIQIESRPIPEIKNPHDVKIQIKATGICGSDVHYFT----QGSIGDFVVKSP 61

Query: 67  SILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRATQGKGV 126
            +LGHE AG+V  VGD V++VKVGD V +         K   S   NLC  +        
Sbjct: 62  LVLGHESAGVVVEVGDAVSSVKVGDRVAVEPGVPSRYSKETMSGHYNLCPHMAFAATPPY 121

Query: 127 MPDGTTRFHNLKGEPLLHFMGCS-TFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGY 185
             DGT   + L  E  ++ +    +F +  VV  +S+                       
Sbjct: 122 --DGTLVKYYLSPEDFVYKLADHISFEEGAVVEPLSVAV--------------------- 158

Query: 186 GAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGF 245
             A + AN   G  V V GAG VGL     AK+ GA+ ++ VD+ + K + +  FGAT  
Sbjct: 159 -HANRLANTAFGQAVLVLGAGPVGLLAGAVAKAFGATDVVFVDIFESKLEKAKQFGATRT 217

Query: 246 VNPLKDLKEGETIVSKLIDMTDGGL--DFTFDCTGNVKVMRDALEACHKG 293
           V    D  E + +   L+  + GGL  D  F+C+G  K +R A+++  +G
Sbjct: 218 VLFKPDSDENDLV--SLVTKSLGGLHPDVVFECSGAEKCIRAAVKSVKRG 265

>YMR083W Chr13 (434788..435915) [1128 bp, 375 aa] {ON}
           ADH3Mitochondrial alcohol dehydrogenase isozyme III;
           involved in the shuttling of mitochondrial NADH to the
           cytosol under anaerobic conditions and ethanol
           production
          Length = 375

 Score = 87.4 bits (215), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 75/269 (27%), Positives = 118/269 (43%), Gaps = 31/269 (11%)

Query: 4   ATAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPEG 63
           +TA  P      + YE    L  + I V  PK +E+ + V ++ VCHTD +   G  P  
Sbjct: 26  STAAIPKTQKGVIFYENKGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWPLP 85

Query: 64  A-FPSILGHEGAGIVESVGDGVTNVKVGDHV-VLLYTAECGKCKFCKSNKTNLCGSVRAT 121
              P + GHEGAG+V  +G  V   KVGD   +      C  C+FC+S   + C      
Sbjct: 86  VKLPLVGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNC------ 139

Query: 122 QGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGV 181
                 PD     +   G          +F Q+     +    I     L+ V  + C  
Sbjct: 140 ------PDADLSGYTHDG----------SFQQFATADAIQAAKIQQGTDLAEVAPILCAG 183

Query: 182 TTGYGAAVKTANVQEGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDF 240
            T Y  A+K A+++ GD VA+ G AG +G   VQ A + G  +++ +D  ++K++     
Sbjct: 184 VTVY-KALKEADLKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGEEKEKLFKKL 241

Query: 241 GATGFVNPLKDLKEGETIVSKLIDMTDGG 269
           G   F+    D  + + +VS + + T GG
Sbjct: 242 GGEVFI----DFTKTKNMVSDIQEATKGG 266

>Kwal_56.23198 s56 (443881..444936) [1056 bp, 351 aa] {ON} YOL086C
           (ADH1) - Alcohol dehydrogenase [contig 183] FULL
          Length = 351

 Score = 86.7 bits (213), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 79/280 (28%), Positives = 125/280 (44%), Gaps = 37/280 (13%)

Query: 14  AAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDP-EGAFPSILGHE 72
           A + YE G PL  + I V  P A E+ + V ++ VCHTD +   G  P     P + GHE
Sbjct: 12  AVIFYENGGPLEYKDIPVPKPSATELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHE 71

Query: 73  GAGIVESVGDGVTNVKVGDHVVLLY-TAECGKCKFCK-SNKTNLCGSVRATQGKGVMPDG 130
           GAG+V ++G+ V   K+GD+  + +    C  C+ C+ SN++N              P+ 
Sbjct: 72  GAGVVVAMGENVKGWKIGDYAGIKWLNGSCMSCESCELSNESNC-------------PEA 118

Query: 131 TTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVK 190
               +   G          +F QY     V    I     L+ V  + C   T Y  A+K
Sbjct: 119 DLSGYTHDG----------SFQQYATADAVQAAKIPQGTDLAEVAPVLCAGITVY-KALK 167

Query: 191 TANVQEGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPL 249
           +AN+  GD VA+ GA G +G   +Q A + G  +++ +D   +K +     G   F+   
Sbjct: 168 SANLSAGDWVAISGACGGLGSLCIQYATAMG-YRVLGIDGGAEKAELFKQLGGEVFI--- 223

Query: 250 KDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEA 289
            D    + +  ++I  T+GG         NV V   A+E+
Sbjct: 224 -DFTTCKDVEGEIIKATNGGAHGVI----NVSVSEAAIES 258

>AAR084W Chr1 (494021..495178) [1158 bp, 385 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR303C (ADH2)
          Length = 385

 Score = 87.0 bits (214), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 75/272 (27%), Positives = 122/272 (44%), Gaps = 35/272 (12%)

Query: 21  GKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDP-EGAFPSILGHEGAGIVES 79
           G PL   +I V  PK  E+ + V ++ VCHTD +   G  P     P + GHEGAG+V +
Sbjct: 53  GGPLEYREIEVPEPKPTELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGAGVVVA 112

Query: 80  VGDGVTNVKVGDHVVLLY-TAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLK 138
           +G+ V   +VGD   + +    C  C+ C+    + C            P+     +   
Sbjct: 113 MGENVRGWQVGDLAGIKWLNGSCMSCEACEQGHESNC------------PEADLSGYTHD 160

Query: 139 GEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQEGD 198
           G          +F QY     V    I     L+ V  + C   T Y  A+K+AN++ G+
Sbjct: 161 G----------SFQQYATADAVQAAHIPAGTDLAQVAPILCAGITVY-KALKSANLRAGN 209

Query: 199 TVAVFGA-GTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGET 257
            VA+ GA G +G   +Q A++ G  +++ +D  D+K+      G   FV    D ++ + 
Sbjct: 210 WVAISGACGGLGSLAIQYARAMG-YRVLEIDGGDEKEALFRKLGGEVFV----DFRKSKD 264

Query: 258 IVSKLIDMTDGGLDFTFDCTGNVKVMRDALEA 289
           +V+ ++  T GG         NV V   A+E+
Sbjct: 265 VVADVVKATGGGAHGVI----NVSVSEAAIES 292

>KLTH0D00616g Chr4 (59883..61031) [1149 bp, 382 aa] {ON} similar to
           uniprot|P39713 Saccharomyces cerevisiae YAL061W putative
           polyol dehydrogenase
          Length = 382

 Score = 87.0 bits (214), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 84/311 (27%), Positives = 129/311 (41%), Gaps = 73/311 (23%)

Query: 15  AVAYEAGKPLTVEKIIVDAPKAHE--VRVQVTHTAVCHTD----------------AYTL 56
           A+AY   K +     +     +HE  V + V+   VC +D                 + +
Sbjct: 3   ALAYFGQKDIRFTDSLAQPQVSHEDEVEIDVSWCGVCGSDLHEYLDGPIFFPANGKTHAM 62

Query: 57  SGVDPEGAFPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAEC--------------G 102
           SG       P  +GHE +GIV  VG  V+ VKVGDHVV+     C              G
Sbjct: 63  SG----QGLPQAMGHEMSGIVSKVGSDVSKVKVGDHVVVGACCTCEDRARWPDVKHEREG 118

Query: 103 KCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHF--MGCST--FSQYTVVA 158
            C  CK+   N C                           L F  +GC +  F++  V++
Sbjct: 119 LCIACKTGNPNCCTD-------------------------LGFCGLGCQSGGFAEKIVLS 153

Query: 159 DVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKS 218
           + ++V I  S PL    L+     + +  AV+ + +Q G T  V GAG +GL+ V   +S
Sbjct: 154 ERNVVKIPNSLPLDVAALVEPISVSWH--AVRISKLQPGQTALVLGAGPIGLAAVLALQS 211

Query: 219 RGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDG--GLDFTFDC 276
            GA  IIV +  D ++Q +   GA  F NP    + G+ ++  L  +  G  G +F++DC
Sbjct: 212 HGAGTIIVSEPADTRRQKAEALGAQTF-NP---TEHGDNVIEALRKLAPGGEGFNFSYDC 267

Query: 277 TGNVKVMRDAL 287
            G  +     L
Sbjct: 268 CGTSETFSAGL 278

>TPHA0M00730 Chr13 complement(137798..138850) [1053 bp, 350 aa] {ON}
           Anc_3.118 YBR145W
          Length = 350

 Score = 86.3 bits (212), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 78/278 (28%), Positives = 126/278 (45%), Gaps = 37/278 (13%)

Query: 16  VAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPEGA-FPSILGHEGA 74
           + YE   PL  + I V  P  +E+ + V ++ VCHTD +   G  P     P + GHEGA
Sbjct: 13  IFYENNGPLEYKDIPVPTPLPNELLIHVLYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGA 72

Query: 75  GIVESVGDGVTNVKVGDHVVLLY-TAECGKCKFCK-SNKTNLCGSVRATQGKGVMPDGTT 132
           G+V  +G  V   KVGD+  + +    C  C+ C+ SN++N              P+   
Sbjct: 73  GVVVGMGSSVKGWKVGDYAGIKWLNGSCMSCEECELSNESNC-------------PEADL 119

Query: 133 RFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTA 192
             +   G          +F QY     V    I   A L ++  + C   T Y  A+K+A
Sbjct: 120 SGYTHDG----------SFQQYATADAVQAAKIPAGADLKNIAPILCAGVTVY-KAIKSA 168

Query: 193 NVQEGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKD 251
           N++ GD +A+ GA G +G   +Q  K+ G  +I+ +D   +K++     G   F+    D
Sbjct: 169 NLKAGDWLAISGACGGLGSLAIQYGKAMGF-RILGIDGGAEKEELFKKLGGEYFI----D 223

Query: 252 LKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEA 289
             + + I++++   T+GG         NV V   A+EA
Sbjct: 224 FTQCKDIIAEVKKATNGGAHGVI----NVSVSEAAIEA 257

>SAKL0E02838g Chr5 (226264..227397) [1134 bp, 377 aa] {ON}
           uniprot|Q6XQ71 Saccharomyces kluyveri ADH4 Alcohol
           dehydrogenase 4
          Length = 377

 Score = 86.7 bits (213), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 74/257 (28%), Positives = 116/257 (45%), Gaps = 31/257 (12%)

Query: 16  VAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDP-EGAFPSILGHEGA 74
           + YE+G  L  + I V  PK +E+ + V ++ VCHTD +   G  P     P + GHEGA
Sbjct: 40  IFYESGGKLEYKDIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGA 99

Query: 75  GIVESVGDGVTNVKVGDHV-VLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTR 133
           G+V + G+ V N ++GD   +      C  C+ C+    + C          +  D +  
Sbjct: 100 GVVVAKGENVMNFEIGDLAGIKWLNGSCMACELCEQGHESNC----------LHADLSGY 149

Query: 134 FHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTAN 193
            H+             +F QY     V    I     L+ V  + C   T Y  A+KTA+
Sbjct: 150 THD------------GSFQQYATADAVQAAQIPKGTDLAEVAPILCAGVTVY-KALKTAD 196

Query: 194 VQEGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDL 252
           ++ G  VA+ G AG +G   VQ AK+ G  +I+ +D    K++     G   F+    D 
Sbjct: 197 LKPGQWVAISGAAGGLGSLAVQYAKAMGL-RILGIDGGPGKEELFKSLGGEVFI----DF 251

Query: 253 KEGETIVSKLIDMTDGG 269
            + + IVS + + T GG
Sbjct: 252 TKTKDIVSAIQEATKGG 268

>Smik_2.284 Chr2 (518341..519396) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 86.3 bits (212), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 80/279 (28%), Positives = 121/279 (43%), Gaps = 35/279 (12%)

Query: 14  AAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDP-EGAFPSILGHE 72
           A V YE    L  + + V  PK +E+ V V ++ VCH+D +   G  P +  FP I GHE
Sbjct: 12  AIVFYETDGKLEYKDVTVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQLKFPLIGGHE 71

Query: 73  GAGIVESVGDGVTNVKVGDHVVLLY-TAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGT 131
           GAG+V  +G  V   KVGD   + +    C  C++C+    + C  +          DGT
Sbjct: 72  GAGVVVKLGSNVKGWKVGDLAGIKWLNGTCMSCEYCEVGNESQCPHL----------DGT 121

Query: 132 TRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKT 191
              H+             TF +Y     V    I  +  L+ V  + C   T Y  A+K 
Sbjct: 122 GFTHD------------GTFQEYATADAVQAAHIPQNVNLAEVAPILCAGITVY-KALKR 168

Query: 192 ANVQEGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLK 250
           AN+  G  V + GA G +G   +Q A + G  ++I +D  + K++     G   F+    
Sbjct: 169 ANLMPGQWVTISGACGGLGSLAIQYALAMG-FRVIGIDGGEAKRKLFEKLGGEIFI---- 223

Query: 251 DLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEA 289
           D  +   +   +I  T+GG         NV V   A+EA
Sbjct: 224 DFTKERDVAGAVIKATNGGSHGII----NVSVSEAAIEA 258

>TDEL0D05050 Chr4 (921065..922120) [1056 bp, 351 aa] {ON} Anc_3.118
           YBR145W
          Length = 351

 Score = 86.3 bits (212), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 73/257 (28%), Positives = 116/257 (45%), Gaps = 31/257 (12%)

Query: 16  VAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPEGA-FPSILGHEGA 74
           + YE    L  + I V  P  +E+ + V ++ VCHTD +   G  P     P + GHEGA
Sbjct: 14  IFYENNGTLEYKDIPVPKPAPNELLINVKYSGVCHTDLHAWKGDWPLPVKLPLVGGHEGA 73

Query: 75  GIVESVGDGVTNVKVGDHV-VLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTR 133
           G+V ++G  V N KVGD+  +      C  C+ C+    + C     +   G   DG   
Sbjct: 74  GVVVALGSNVKNWKVGDYAGIKWLNGCCMSCEDCELGNESNCPQADLS---GYTHDG--- 127

Query: 134 FHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTAN 193
                           +F QY     V    I P   L+ V  + C   T Y  A+K+A 
Sbjct: 128 ----------------SFQQYATTDAVQAAKISPGTDLAEVAPVLCAGLTVY-KALKSAE 170

Query: 194 VQEGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDL 252
           ++ G  VA+ GA G +G   VQ AK+ G  +++ +D  D+K +   + G   F+    D 
Sbjct: 171 LEAGQWVAISGACGGLGSLAVQYAKAMG-YRVLGIDGGDEKAKMFKELGGEYFI----DF 225

Query: 253 KEGETIVSKLIDMTDGG 269
            + + I+ +++  T+GG
Sbjct: 226 TKCKDIIGEVVKATNGG 242

>Suva_13.261 Chr13 (416378..417505) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 85.9 bits (211), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 73/257 (28%), Positives = 113/257 (43%), Gaps = 31/257 (12%)

Query: 16  VAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPEGA-FPSILGHEGA 74
           + YE    L  + I V  PK +E+ + V ++ VCHTD +   G  P     P + GHEGA
Sbjct: 38  IFYENNGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGA 97

Query: 75  GIVESVGDGVTNVKVGDHV-VLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTR 133
           G+V  +G  V   KVGD   +      C  C+FC+S   + C            PD    
Sbjct: 98  GVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNC------------PDADLS 145

Query: 134 FHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTAN 193
            +   G          +F Q+     +    I     L+ V  + C   T Y  A+K AN
Sbjct: 146 GYTHDG----------SFQQFATADAIQAAKIQQGTDLAEVAPILCAGVTVY-KALKEAN 194

Query: 194 VQEGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDL 252
           ++ GD VA+ G AG +G   VQ A + G  +++ +D   +K++     G   F+    D 
Sbjct: 195 LKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGAEKEKLFKQLGGEVFI----DF 249

Query: 253 KEGETIVSKLIDMTDGG 269
            + + +VS + + T GG
Sbjct: 250 TKTKDMVSDIQEATKGG 266

>YMR303C Chr13 complement(873291..874337) [1047 bp, 348 aa] {ON}
           ADH2Glucose-repressible alcohol dehydrogenase II,
           catalyzes the conversion of ethanol to acetaldehyde;
           involved in the production of certain carboxylate
           esters; regulated by ADR1
          Length = 348

 Score = 85.5 bits (210), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 78/279 (27%), Positives = 124/279 (44%), Gaps = 35/279 (12%)

Query: 14  AAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDP-EGAFPSILGHE 72
           A + YE+   L  + I V  PK +E+ + V ++ VCHTD +   G  P     P + GHE
Sbjct: 9   AIIFYESNGKLEHKDIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPLVGGHE 68

Query: 73  GAGIVESVGDGVTNVKVGDHVVLLY-TAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGT 131
           GAG+V  +G+ V   K+GD+  + +    C  C++C+    + C     +   G   DG 
Sbjct: 69  GAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNCPHADLS---GYTHDG- 124

Query: 132 TRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKT 191
                             +F +Y     V    I     L+ V  + C   T Y  A+K+
Sbjct: 125 ------------------SFQEYATADAVQAAHIPQGTDLAEVAPILCAGITVY-KALKS 165

Query: 192 ANVQEGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLK 250
           AN++ G   A+ G AG +G   VQ AK+ G  +++ +D    K++     G   F+    
Sbjct: 166 ANLRAGHWAAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGPGKEELFTSLGGEVFI---- 220

Query: 251 DLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEA 289
           D  + + IVS ++  T+GG         NV V   A+EA
Sbjct: 221 DFTKEKDIVSAVVKATNGGAHGII----NVSVSEAAIEA 255

>Smik_13.266 Chr13 (418869..419996) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 85.9 bits (211), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 74/269 (27%), Positives = 118/269 (43%), Gaps = 31/269 (11%)

Query: 4   ATAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPEG 63
           +TA  P      + YE    L  + I V  PK +E+ + V ++ VCHTD +   G  P  
Sbjct: 26  STAAIPETQKGVIFYENKGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWPLP 85

Query: 64  A-FPSILGHEGAGIVESVGDGVTNVKVGDHV-VLLYTAECGKCKFCKSNKTNLCGSVRAT 121
              P + GHEGAG+V  +G  V   K+GD   +      C  C+FC+S   + C      
Sbjct: 86  VKLPLVGGHEGAGVVVKLGSNVKGWKIGDLAGIKWLNGSCMTCEFCESGHESNC------ 139

Query: 122 QGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGV 181
                 PD     +   G          +F Q+     +    I     L+ V  + C  
Sbjct: 140 ------PDADLSGYTHDG----------SFQQFATADAIQAAKIQQGTDLAEVAPILCAG 183

Query: 182 TTGYGAAVKTANVQEGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDF 240
            T Y  A+K A+++ GD VA+ G AG +G   VQ A + G  +++ +D  ++K++     
Sbjct: 184 VTVY-KALKEADLKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGEEKEKLFKKL 241

Query: 241 GATGFVNPLKDLKEGETIVSKLIDMTDGG 269
           G   F+    D  + + +VS + + T GG
Sbjct: 242 GGEVFI----DFTKTKDMVSDIQEATKGG 266

>Suva_15.81 Chr15 complement(132739..133785) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 85.1 bits (209), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 79/277 (28%), Positives = 121/277 (43%), Gaps = 35/277 (12%)

Query: 16  VAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPEGA-FPSILGHEGA 74
           + YE+   L  + I V  PKA+E+ + V ++ VCHTD +   G  P     P + GHEGA
Sbjct: 11  IFYESHGKLEYKDIPVPTPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGA 70

Query: 75  GIVESVGDGVTNVKVGDHVVLLY-TAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTR 133
           G+V ++G+ V    +GD   + +    C  C++C+    + C     +   G   DG   
Sbjct: 71  GVVVAMGENVKGWNIGDFAGIKWLNGSCMACEYCELGNESNCPHADLS---GYTHDG--- 124

Query: 134 FHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTAN 193
                           +F QY     V    I     L+    + C   T Y  A+K+AN
Sbjct: 125 ----------------SFQQYATADSVQAAHIPKGTDLAECAPVLCAGITVY-KALKSAN 167

Query: 194 VQEGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDL 252
           +  G  VA+ G AG +G   VQ AK+ G  +++ +D  + K++     G   F+    D 
Sbjct: 168 LSAGQWVAISGAAGGLGSLAVQYAKAMG-YRVVGIDGGEGKEELFRSIGGEVFI----DF 222

Query: 253 KEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEA 289
              + IV  +I  TDGG         NV V   A+EA
Sbjct: 223 TTEKDIVGAVIKATDGGAHGII----NVSVSEAAIEA 255

>Kwal_26.7799 s26 complement(515580..516743) [1164 bp, 387 aa] {ON}
           YMR083W (ADH3) - 1:1 [contig 55] FULL
          Length = 387

 Score = 85.5 bits (210), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 75/269 (27%), Positives = 117/269 (43%), Gaps = 31/269 (11%)

Query: 4   ATAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDP-E 62
           A+   P      + YE G  L  + + V  PK +E+ + V ++ VCHTD +   G  P +
Sbjct: 38  ASTNIPTTQKGVIFYEHGGELQYKDLPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLD 97

Query: 63  GAFPSILGHEGAGIVESVGDGVTNVKVGDHV-VLLYTAECGKCKFCKSNKTNLCGSVRAT 121
              P + GHEGAG+V + G+ VTN ++GD   +      C  C+ C+      C     +
Sbjct: 98  VKLPLVGGHEGAGVVVAKGENVTNFEIGDLAGIKWLNGSCMSCELCEQGHEPNCEHADLS 157

Query: 122 QGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGV 181
              G   DG                   +F QY     V    +     L+ V  + C  
Sbjct: 158 ---GYTHDG-------------------SFQQYATADAVQAAQLPKGINLAEVAPILCAG 195

Query: 182 TTGYGAAVKTANVQEGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDF 240
            T Y  A+KTA++  G  VA+ G AG +G   VQ AK+ G  +++ +D  D+KK+     
Sbjct: 196 VTVY-KALKTADLIPGQWVAISGAAGGLGSLAVQYAKAMGL-RVLGIDGGDEKKELFHKL 253

Query: 241 GATGFVNPLKDLKEGETIVSKLIDMTDGG 269
           G   F+    D    + +V  + + T GG
Sbjct: 254 GGEIFI----DYTTTKDMVGAIQEATQGG 278

>Kpol_1036.19 s1036 (51276..52337) [1062 bp, 353 aa] {ON}
           (51276..52337) [1062 nt, 354 aa]
          Length = 353

 Score = 85.1 bits (209), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 84/293 (28%), Positives = 130/293 (44%), Gaps = 37/293 (12%)

Query: 1   MTSATAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVD 60
           M +  A  P      + YE    L  + + V  PK  E+ + V ++ VCHTD +   G  
Sbjct: 1   MATIAADVPKTQKGVIFYENNGELQYKDLPVPQPKPTELLIHVLYSGVCHTDLHAWKGDW 60

Query: 61  P-EGAFPSILGHEGAGIVESVGDGVTNVKVGDHVVLLY-TAECGKCKFCK-SNKTNLCGS 117
           P +   P + GHEGAG+V  +G  V   K+GD   + +    C  C+ C+ SN++N    
Sbjct: 61  PLDTKLPLVGGHEGAGVVVGMGSSVKGWKMGDLAGIKWLNGSCMNCEECELSNESNC--- 117

Query: 118 VRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLL 177
                     P+     +   G          +F QY     V    I   A ++ V  +
Sbjct: 118 ----------PEADLSGYTHDG----------SFQQYATADAVQAAHIPQGADMAEVAPI 157

Query: 178 GCGVTTGYGAAVKTANVQEGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDVNDQKKQW 236
            C   T Y  A+K+A ++ GD VA+ G AG +G   VQ AK+ G  +++ +D  D+K+++
Sbjct: 158 LCAGVTVY-KALKSAELKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGDEKEKF 215

Query: 237 SMDFGATGFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEA 289
               G   FV    D    + IV  + + T+GG      C  NV V   A+EA
Sbjct: 216 FKSMGGEVFV----DFMTCKDIVGAVKEATNGG---AHGCI-NVSVSEKAIEA 260

>NCAS0A07780 Chr1 (1548197..1549318) [1122 bp, 373 aa] {ON}
           Anc_2.480
          Length = 373

 Score = 84.7 bits (208), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 74/257 (28%), Positives = 115/257 (44%), Gaps = 31/257 (12%)

Query: 16  VAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPEGA-FPSILGHEGA 74
           + YE G PL  + I V  PKA+E+ + V ++ VCHTD +   G  P     P + GHEG+
Sbjct: 36  IFYETGGPLHYKDIPVPKPKANEILINVKYSGVCHTDLHAWKGDWPLATKLPLVGGHEGS 95

Query: 75  GIVESVGDGVTNVKVGDHV-VLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTR 133
           G V ++G+ V   K+GD   +      C  C+ C+S   + C     +   G   DG   
Sbjct: 96  GEVVAMGENVKGWKIGDLAGIKWLNGSCMSCELCESGHESNCEHADLS---GYTHDG--- 149

Query: 134 FHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTAN 193
                           +F QY     V    I     ++ V  + C   T Y  A+K A+
Sbjct: 150 ----------------SFQQYATADAVQAARIPKGTNMAEVAPILCAGITVY-KALKEAD 192

Query: 194 VQEGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDL 252
           ++ G  V + G AG +G   VQ AK+ G  ++I +D    K++     G   FV    D 
Sbjct: 193 MRAGQWVCISGAAGGLGSLAVQYAKAMG-YRVIGIDGGPGKEELFKSLGGEIFV----DF 247

Query: 253 KEGETIVSKLIDMTDGG 269
            + + IV+++ + T GG
Sbjct: 248 TKTKDIVAEIQEATRGG 264

>ZYRO0G03388g Chr7 complement(265952..267064) [1113 bp, 370 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W
          Length = 370

 Score = 84.7 bits (208), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 72/289 (24%), Positives = 126/289 (43%), Gaps = 31/289 (10%)

Query: 3   SATAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDP- 61
           S+T   P      + YE+G  L  + + V  P+ +E+ V V ++ VCHTD +   G  P 
Sbjct: 20  SSTISIPSTQKGVIFYESGGKLHYKDLAVPKPRNNEILVNVKYSGVCHTDLHAWKGDWPL 79

Query: 62  EGAFPSILGHEGAGIVESVGDGVTNVKVGDHV-VLLYTAECGKCKFCKSNKTNLCGSVRA 120
           +   P + GHEGAG+V + G+ V N ++GD   +      C  C+ C+    + C     
Sbjct: 80  DTKLPLVGGHEGAGVVVAKGENVKNFEIGDLAGIKWLNGSCQSCEMCEMGHESNCAHADL 139

Query: 121 TQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCG 180
           +   G   DG                   TF QY     +    I     L+ V  + C 
Sbjct: 140 S---GYTHDG-------------------TFQQYATADAIQAAHIPKGTDLAGVAPILCA 177

Query: 181 VTTGYGAAVKTANVQEGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMD 239
             T Y  A++++  + G+ VA+ G AG +G    Q A++ G  +++ +D  + K +    
Sbjct: 178 GVTVY-KALRSSGARPGEWVAISGAAGGLGSLATQYARAMGL-RVVGIDGGEDKAKLFKS 235

Query: 240 FGATGFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALE 288
            G   F+    D  + + I + +++ T GG     + + + K M  ++E
Sbjct: 236 LGGEIFI----DFTKEKDIPAAILEATQGGAHGVINVSVSEKAMSQSVE 280

>KLTH0A00418g Chr1 complement(34685..35755) [1071 bp, 356 aa] {ON}
           similar to uniprot|P00331 Saccharomyces cerevisiae
           YMR303C ADH2 Glucose-repressible alcohol dehydrogenase
           II involved in the production of certain carboxylate
           esters
          Length = 356

 Score = 84.3 bits (207), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 74/262 (28%), Positives = 122/262 (46%), Gaps = 33/262 (12%)

Query: 9   PIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDP-EGAFPS 67
           P+   A +  +    L ++ I V +PKA+E+ + V  + VCH+D +   G  P +   P 
Sbjct: 10  PLTQRAVIFKKHSGKLELKSIEVQSPKANELLINVKFSGVCHSDLHAWKGDWPTKTKLPL 69

Query: 68  ILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAE-CGKCKFCK-SNKTNLCGSVRATQGKG 125
           + GHEGAGIV ++G  V   K+GD+  + +    C  C+ C+ SN+ N            
Sbjct: 70  VGGHEGAGIVVAMGASVRGWKIGDYAGIKWLNSCCMSCEQCELSNEPNCA---------- 119

Query: 126 VMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGY 185
                   + ++ G     F    +F QY     V    I P   L+ V  + C   T +
Sbjct: 120 --------YADISG-----FTRDGSFQQYATADAVQAARIPPGTNLAEVSPVLCAGITVF 166

Query: 186 GAAVKTANVQEGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATG 244
             A+KTAN+  G+ VA+ GA G +G   +Q AK+ G S ++ +D   +K+    D G   
Sbjct: 167 -KALKTANLTAGNWVAISGACGGLGSMAIQYAKAMGYS-VVGIDSGAEKEHLFNDLGGDV 224

Query: 245 FVNPLKDLKEGETIVSKLIDMT 266
           F+    D  + E +V +++  T
Sbjct: 225 FL----DFSKSENLVPEVVSAT 242

>Kpol_431.8 s431 (21043..22185) [1143 bp, 380 aa] {ON}
           (21043..22185) [1143 nt, 381 aa]
          Length = 380

 Score = 84.3 bits (207), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 71/249 (28%), Positives = 113/249 (45%), Gaps = 31/249 (12%)

Query: 24  LTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPEGA-FPSILGHEGAGIVESVGD 82
           L    I V  PK++E+ + V ++ VCHTD +   G  P     P + GHEGAG+V  +G+
Sbjct: 51  LKYTDIPVPTPKSNEILINVKYSGVCHTDLHAWKGDWPLAVKLPLVGGHEGAGVVVGIGE 110

Query: 83  GVTNVKVGDHV-VLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEP 141
            V   K+GD   +      C  C+ C++     C     +   G   DG           
Sbjct: 111 NVKGWKLGDLAGIKWLNGSCMSCELCETGHEANCEHADLS---GYTHDG----------- 156

Query: 142 LLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQEGDTVA 201
                   +F QY     V    I   + L+ +  + C   T Y  A+KTAN++ G+ VA
Sbjct: 157 --------SFQQYATADAVQAARIPEGSDLAQIAPILCAGITVY-KALKTANLKPGEWVA 207

Query: 202 VFG-AGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGETIVS 260
           + G AG +G   VQ AK+ G  +++ +D  ++K++     G   FV    D  + + IV+
Sbjct: 208 ISGAAGGLGSLAVQYAKAMG-YRVVGIDGGEEKEKLFRSLGGEVFV----DFTKSKDIVA 262

Query: 261 KLIDMTDGG 269
            + + T GG
Sbjct: 263 DIQNATKGG 271

>YAL060W Chr1 (35155..36303) [1149 bp, 382 aa] {ON}
           BDH1NAD-dependent (R,R)-butanediol dehydrogenase,
           catalyzes oxidation of (R,R)-2,3-butanediol to
           (3R)-acetoin, oxidation of meso-butanediol to
           (3S)-acetoin, and reduction of acetoin; enhances use of
           2,3-butanediol as an aerobic carbon source
          Length = 382

 Score = 84.3 bits (207), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 69/241 (28%), Positives = 105/241 (43%), Gaps = 39/241 (16%)

Query: 63  GAFPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECG--------------KCKFCK 108
            A P  +GHE +GIV  VG  VT VKVGDHVV+   + C                C  C+
Sbjct: 65  AALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAASSCADLHCWPHSKFYNSKPCDACQ 124

Query: 109 SNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPS 168
               NLC       G GV+  G                    F++  VV+   ++ +   
Sbjct: 125 RGSENLCTHA-GFVGLGVISGG--------------------FAEQVVVSQHHIIPVPKE 163

Query: 169 APLSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVD 228
            PL    L+     T +  AVK +  ++G +  V GAG +GL  +   K  GASKI+V +
Sbjct: 164 IPLDVAALVEPLSVTWH--AVKISGFKKGSSALVLGAGPIGLCTILVLKGMGASKIVVSE 221

Query: 229 VNDQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALE 288
           + +++ + +   G   F NP K   +   I+  L    D G D+++DC+G       +L+
Sbjct: 222 IAERRIEMAKKLGVEVF-NPSKHGHKSIEILRGLTKSHD-GFDYSYDCSGIQVTFETSLK 279

Query: 289 A 289
           A
Sbjct: 280 A 280

>KLLA0F00506g Chr6 complement(36518..37675) [1158 bp, 385 aa] {ON}
           similar to uniprot|P39714 Saccharomyces cerevisiae
           YAL060W BDH1 NAD-dependent (2R 3R)-2 3-butanediol
           dehydrogenase
          Length = 385

 Score = 84.3 bits (207), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 64/228 (28%), Positives = 103/228 (45%), Gaps = 39/228 (17%)

Query: 65  FPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAEC--------------GKCKFCKSN 110
            P  +GHE +GIV  VG  VTN+K GDHVV+  T  C               +C  C+  
Sbjct: 67  LPQAMGHEMSGIVSKVGPKVTNIKAGDHVVVEATGTCLDHYTWPNAAHAKDAECAACQRG 126

Query: 111 KTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAP 170
             N C  +    G GV   G                    F++  VV++  +V I  + P
Sbjct: 127 FYNCCAHL-GFMGLGVHSGG--------------------FAEKVVVSEKHVVKIPNTLP 165

Query: 171 LSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVN 230
           L    L+     + +  AV+ + +Q+G +  V GAG +GL+ +   +  GASKI+V +  
Sbjct: 166 LDVAALVEPISVSWH--AVRISKLQKGQSALVLGAGPIGLATILALQGHGASKIVVSEPA 223

Query: 231 DQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTG 278
           + ++  +   G   F +P +  ++   I+ KL    + G DF +DC+G
Sbjct: 224 EIRRNQAAKLGVETF-DPSEHKEDAVNILKKLAPGGE-GFDFAYDCSG 269

>CAGL0D00198g Chr4 (27559..28710) [1152 bp, 383 aa] {ON} similar to
           uniprot|P39714 Saccharomyces cerevisiae YAL060w FUN49 or
           uniprot|P39713 Saccharomyces cerevisiae YAL061w FUN50
          Length = 383

 Score = 84.0 bits (206), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 79/285 (27%), Positives = 122/285 (42%), Gaps = 47/285 (16%)

Query: 31  VDAPKA---HEVRVQVTHTAVCHTD----------------AYTLSGVDPEGAFPSILGH 71
           +D PK    HE+ + V    +C TD                 + LSG+D     P  +GH
Sbjct: 18  IDTPKINNDHELMIDVAWCGICGTDLHEFLEGPIFMPKDGDTHYLSGLD----LPLPMGH 73

Query: 72  EGAGIVESVGDGVTNVKVGDHVVLLYTAECGKC-KFCKSN--KTNLCGSVRATQGKGVMP 128
           E +GIV+ VG GVT  K GD VV+  T  CG   ++ KS   K  LC +         +P
Sbjct: 74  EMSGIVKEVGKGVTRFKPGDRVVIEATTSCGDTHRWPKSKVAKGELCPACEMG-----LP 128

Query: 129 DGTTRFHNLKGEPLLHFMGCST----FSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTG 184
           +  T            F G  +    F++  VV +  +V I    PL    L+   ++  
Sbjct: 129 NCCTHG---------SFQGLGSVGGGFAEQVVVGEKHVVKIPDKLPLDVAALVE-PLSVA 178

Query: 185 YGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATG 244
           + AA + A  +EG    V G+G +GL+++   K   A KI+V +    +++ +       
Sbjct: 179 WHAA-RLAEFKEGSNALVLGSGPIGLAMILALKGMKAGKIVVSEPAKLRRELAEKLNVVV 237

Query: 245 FVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEA 289
           F NP     +      K +   D G D+TFDC+G       A++A
Sbjct: 238 F-NPTHTRAQNAIEKLKELSPKDHGFDYTFDCSGVQDTFNAAVKA 281

>ABL033C Chr2 complement(337866..338987) [1122 bp, 373 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR083W
           (ADH3)
          Length = 373

 Score = 83.6 bits (205), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 79/266 (29%), Positives = 120/266 (45%), Gaps = 35/266 (13%)

Query: 9   PIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSG---VDPEGAF 65
           P    A V YE G  L    I V  PK +E+ V + ++ VCHTD +   G   + P+   
Sbjct: 29  PTTQKAVVFYEHGGELKYTDIPVPKPKPNEILVNIKYSGVCHTDLHAWKGDWAIKPK--L 86

Query: 66  PSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAE-CGKCKFCKSNKTNLCGSVRATQGK 124
           P + GHEGAG+V + G  VTN ++GD+  + +  + C +C+FC+               K
Sbjct: 87  PLVGGHEGAGVVVAKGANVTNFEIGDYAGVKWLGKTCMECEFCQ---------------K 131

Query: 125 GVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTG 184
           G  P       N +   L  +    TF QY     +    I P   L+ V  + C   T 
Sbjct: 132 GFEP-------NCETPTLSGYTHDGTFQQYATADAIHAAHIPPGTDLAKVAPILCAGITV 184

Query: 185 YGAAVKTANVQEGDTVAV-FGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGAT 243
           Y  A+KTA +  G  VA+    G +G   VQ A + G  +++ +D  ++K+      G  
Sbjct: 185 Y-KALKTAALIPGQWVAISGAGGGLGSLAVQYAVAMG-YRVVGIDGGNEKEALFRSLGGE 242

Query: 244 GFVNPLKDLKEGETIVSKLIDMTDGG 269
            FV    D  + + IVS + + T GG
Sbjct: 243 TFV----DFHKNKDIVSAVREATGGG 264

>ZYRO0C12562g Chr3 (993434..994480) [1047 bp, 348 aa] {ON} highly
           similar to uniprot|P00331 Saccharomyces cerevisiae
           YMR303C ADH2 Glucose-repressible alcohol dehydrogenase
           II involved in the production of certain carboxylate
           esters
          Length = 348

 Score = 83.2 bits (204), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 79/282 (28%), Positives = 120/282 (42%), Gaps = 35/282 (12%)

Query: 14  AAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDP-EGAFPSILGHE 72
           A +  E   PL  + I V  PK +E+ + V ++ VCHTD +   G  P     P + GHE
Sbjct: 9   AVIFSENNGPLEYKDIPVPKPKPNEILIHVRYSGVCHTDLHAWKGDWPLPTKLPLVGGHE 68

Query: 73  GAGIVESVGDGVTNVKVGDHVVLLY-TAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGT 131
           GAG V ++G  V N K+GD   + +    C  C+ C+ +  + C            PD  
Sbjct: 69  GAGEVVALGSDVKNWKIGDLAGIKWLNGSCMSCEACEQSHESNC------------PDAD 116

Query: 132 TRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKT 191
              +   G          +F QY     V    I     L+ V  + C   T Y  A+K+
Sbjct: 117 LSGYTHDG----------SFQQYATADAVQAAHIPAGTNLAEVAPVLCAGITVY-KALKS 165

Query: 192 ANVQEGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLK 250
           AN++ G  VA+ G AG +G   VQ A++ G  +++ +D    K++     G   F+    
Sbjct: 166 ANLKAGQWVAISGAAGGLGSLAVQYARAMGL-RVLGIDGGPGKEELFKTLGGECFI---- 220

Query: 251 DLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHK 292
           D  +   I   +I  T+GG         NV V   A+ A  K
Sbjct: 221 DFTKEHDIAEAVIKATNGGAHGVI----NVSVSEGAISASTK 258

>TDEL0A02560 Chr1 complement(462053..463174) [1122 bp, 373 aa] {ON}
           Anc_2.480 YMR083W
          Length = 373

 Score = 82.8 bits (203), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 72/257 (28%), Positives = 115/257 (44%), Gaps = 31/257 (12%)

Query: 16  VAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPEGA-FPSILGHEGA 74
           + YE G  L  + I V  PK +E+ + + ++ VCHTD +   G  P     P + GHEGA
Sbjct: 36  IFYENGGELHYKDIAVPKPKPNEILINIKYSGVCHTDLHAWKGDWPLPVKLPLVGGHEGA 95

Query: 75  GIVESVGDGVTNVKVGDHV-VLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTR 133
           G+V + G  VTN ++GD   V    + C  C++C+    + C     +   G   DG   
Sbjct: 96  GVVVAKGKDVTNFEIGDLAGVKWLNSSCMACEYCELGHESNCAKADLS---GYTHDG--- 149

Query: 134 FHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTAN 193
                           +F QY     +    I     L+ V  + C   T Y  A+KT+ 
Sbjct: 150 ----------------SFQQYATADAIQAAPIPKDTDLAEVAPILCAGVTVY-KALKTSG 192

Query: 194 VQEGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDL 252
            + G  VA+ G AG +G   VQ A + G  +++ +D  + K++     G   FV    D 
Sbjct: 193 AKPGQWVAISGAAGGLGSLAVQYATAMGL-RVLGIDGGEGKEELFKSLGGEVFV----DF 247

Query: 253 KEGETIVSKLIDMTDGG 269
            + + +VS + + T+GG
Sbjct: 248 TKTKDMVSAIQEATNGG 264

>Kwal_26.6739 s26 (46044..47192) [1149 bp, 382 aa] {ON} YAL060W
           (BDH1) - (2R,3R)-2,3-butanediol dehydrogenase [contig
           44] FULL
          Length = 382

 Score = 83.2 bits (204), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 63/234 (26%), Positives = 110/234 (47%), Gaps = 29/234 (12%)

Query: 52  DAYTLSGVDPEGAFPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECG---KCKFCK 108
           + + +SGV      P  +GHE +G+V  +G GV N+KVGDHVV+  T  C    +    K
Sbjct: 58  EKHAMSGV----GLPQAMGHEMSGVVAKIGPGVKNIKVGDHVVVETTGTCKDRYRWPDVK 113

Query: 109 SNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCST--FSQYTVVADVSLVTID 166
                 C + +              F+N   E     +GC +  F++  V+++  +V + 
Sbjct: 114 HASDEECAACKKD------------FYNCCSELGFCGLGCHSGGFAEKVVISEKHVVKVP 161

Query: 167 PSAPLSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIV 226
              PL    L+     + +  AV+ + ++ G +  + GAG +GL+ V   +  GA  I+V
Sbjct: 162 KDIPLDVAALVEPLAVSWH--AVRISQLKAGQSALILGAGPIGLATVLALQGHGAGTIVV 219

Query: 227 VDVNDQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDG--GLDFTFDCTG 278
            + +  +++ +   GA  F NP      G+  V +L  +  G  G DF++DC+G
Sbjct: 220 SEPSASRRKQAEALGALTF-NP---FDHGDKAVDELRKIPPGSDGFDFSYDCSG 269

>Smik_1.6 Chr1 (18115..19263) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 82.4 bits (202), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 67/239 (28%), Positives = 107/239 (44%), Gaps = 39/239 (16%)

Query: 65  FPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECG--------------KCKFCKSN 110
            P  +GHE +GIV  VG  VT VKVGDHVV+   + C                C+ CK  
Sbjct: 67  LPLAMGHEMSGIVAEVGPKVTKVKVGDHVVVDAASSCADLHCWPQSKHYSSKPCEACKKG 126

Query: 111 KTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAP 170
             NLC +     G GV+  G                    F++   V++  ++ +    P
Sbjct: 127 SENLC-THGGFIGLGVISGG--------------------FAEQVAVSEHHIIPVPKEIP 165

Query: 171 LSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVN 230
           L    L+     T +  AVK +  ++G +  V GAG +GL  +   K  GA KI+V +V 
Sbjct: 166 LDVAALVEPLSVTWH--AVKISGFKKGSSALVLGAGPIGLCTILVLKGMGAGKIVVSEVA 223

Query: 231 DQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEA 289
           +++ + + + G   F NP K  ++   ++  L    D G D+++DC+G       +L+A
Sbjct: 224 ERRIEMAKNLGVEVF-NPSKHGQKSIEVLRGLTKSHD-GFDYSYDCSGIQVTFETSLKA 280

>Skud_1.3 Chr1 (11174..12322) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 82.0 bits (201), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 74/278 (26%), Positives = 118/278 (42%), Gaps = 51/278 (18%)

Query: 38  EVRVQVTHTAVC------HTDAYTLSGVDPE------GAFPSILGHEGAGIVESVGDGVT 85
           EV + V+   +C      +TD       D E       A P  +GHE +GI+  VG  VT
Sbjct: 28  EVIIDVSWCGICGSDLHEYTDGPIFMPKDGECHALSNAALPLAMGHEMSGIIAKVGPRVT 87

Query: 86  NVKVGDHVVLLYTAECG--------------KCKFCKSNKTNLCGSVRATQGKGVMPDGT 131
            VKVGDHVV+   + C                C+ CK    NLC       G GV+  G 
Sbjct: 88  KVKVGDHVVVDAGSSCADLHCWPHSKYYNSKPCEACKKGSENLCAH-SGFVGLGVISGG- 145

Query: 132 TRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKT 191
                              F++  VV++  ++ +    PL    L+     T +  AVK 
Sbjct: 146 -------------------FAEQVVVSEHHIIPVPKEIPLDVAALVEPLSVTWH--AVKL 184

Query: 192 ANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKD 251
           +  ++G +  V GAG +GL  +   K  GA KI+V +V +++ + +       F NP + 
Sbjct: 185 SGFKKGSSALVLGAGPIGLCTILVLKGMGAGKIVVSEVAERRLKMAKSLDVEVF-NPAQH 243

Query: 252 LKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEA 289
             +   ++  L +  D G D+++DC+G       +L+A
Sbjct: 244 GHKSVELLRGLTESHD-GFDYSYDCSGIQATFETSLKA 280

>ZYRO0G03410g Chr7 complement(269170..270291) [1122 bp, 373 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3
          Length = 373

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 95/366 (25%), Positives = 151/366 (41%), Gaps = 39/366 (10%)

Query: 21  GKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDP-EGAFPSILGHEGAGIVES 79
           G  L  E + V  P ++EV + V ++ VCHTD +T  G  P +   P + GHEGAG+V +
Sbjct: 39  GPLLYREDLPVPTPASNEVLINVKYSGVCHTDLHTWKGEIPFKTKLPLVGGHEGAGVVVA 98

Query: 80  VGDGVTNVKVGDHV-VLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLK 138
            G  V   ++GD   V    + C  C+ C+      C      +  G   DG        
Sbjct: 99  KGKDVKTFEIGDLAGVKQLVSSCMGCESCEIGHEFGC---EQAEMSGSSHDG-------- 147

Query: 139 GEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQEGD 198
                      TF QY  +  +    +  +  L++V  + C   + Y  A+K  N+Q   
Sbjct: 148 -----------TFQQYVAIDALQAPPLPANVDLAAVAPIFCAGVSVY-KALKNGNLQTNQ 195

Query: 199 TVAVFGA-GTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGET 257
            VA+FGA G +G   VQ AK+ G   + +    +++KQ     G   F+    D  + + 
Sbjct: 196 WVAIFGATGGLGSIAVQYAKAMGYRVLGIDGPGEERKQLFHSLGGEVFL----DYTQVDN 251

Query: 258 IVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLI 317
           I + +   T GG     + T ++      ++ C +  G               T  F ++
Sbjct: 252 IPAAVKQATQGGAHCVLNVTASLAAYDQTIK-CVRPLGTVVPVGVPPDSGLLKTDIFTIV 310

Query: 318 T-GRVWKGSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPFTEINNAFEDLHHGDCL 376
             G   KGSA G    R++  + V  + +G +K    I      +E+  AFE L  G   
Sbjct: 311 QHGFSIKGSASG---SRADTREAVDFFTRGLIKSPIKILG---LSELPKAFELLESGQTT 364

Query: 377 -RTVLD 381
            R VLD
Sbjct: 365 GRLVLD 370

>KNAG0K01040 Chr11 complement(204636..205811) [1176 bp, 391 aa] {ON}
           
          Length = 391

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 60/238 (25%), Positives = 98/238 (41%), Gaps = 38/238 (15%)

Query: 65  FPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECG--------------KCKFCKSN 110
            P  +GHE AGIV  VG GVT  KVGDHV +  T  C               KC  CK  
Sbjct: 67  LPQAMGHEMAGIVREVGSGVTQFKVGDHVSVEPTGTCRDRYRWPEAPGVNKEKCAACKRG 126

Query: 111 KTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAP 170
             N+C  +    G GV   G                    F++  V+ +     +    P
Sbjct: 127 MYNVCSHL-GLIGNGVQSGG--------------------FAERVVINESHCYKLPNHIP 165

Query: 171 LSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVN 230
           +  V L+     + +  AV+ +  + G +V + G G +GLS +      G ++I+V +  
Sbjct: 166 MEVVALVQPIAVSWH--AVRVSKFKPGSSVLILGGGPIGLSTILALNGHGCTEIVVSEPA 223

Query: 231 DQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALE 288
             ++  +   GA  + +P++   E      + +     G D+ FDC+G    +R ++E
Sbjct: 224 KIRRDLAEKMGAVVY-DPMQHSYEENIKYLRALAPDKDGFDYCFDCSGTPATLRSSIE 280

>KAFR0L02000 Chr12 (378013..379098) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score = 81.3 bits (199), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 70/259 (27%), Positives = 112/259 (43%), Gaps = 31/259 (11%)

Query: 14  AAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDP-EGAFPSILGHE 72
           A V  E G  L    I V   KA+E+ + V ++ VCH+D Y      P     P + GHE
Sbjct: 22  AMVFSEYGGDLEYRDIPVPTKKANEILINVKYSGVCHSDLYVWKNRTPMTSKLPLVGGHE 81

Query: 73  GAGIVESVGDGVTNVKVGDHV-VLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGT 131
           GAG+V  +G  V N K+GD   V    + C  C+ C+      C                
Sbjct: 82  GAGVVVGMGSNVKNWKIGDKAGVKWLNSTCMTCEHCELGNEPSC---------------- 125

Query: 132 TRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKT 191
                LK E    F    +F QY  V  +    +  +  L+ +    C   T Y  A+K+
Sbjct: 126 -----LKSE-YNGFTRNGSFQQYVAVDAIHAPRLPDNCDLAELAPASCAGVTVY-KAIKS 178

Query: 192 ANVQEGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLK 250
           AN++ G  +A+ GA G +G   +Q  K+ G  +++ +D  + K     + G   F+    
Sbjct: 179 ANIRAGQWMAITGACGGLGSVAIQYCKAMG-YRVVGIDAGEAKANLFKELGGEVFI---- 233

Query: 251 DLKEGETIVSKLIDMTDGG 269
           D  + + +V+ ++  T+GG
Sbjct: 234 DFTKSKDLVADVVSATNGG 252

>Kwal_55.19574 s55 complement(32260..33330) [1071 bp, 356 aa] {ON}
           YJR159W (SOR1) - sorbitol-induced sorbitol dehydrogenase
           [contig 159] FULL
          Length = 356

 Score = 80.5 bits (197), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 95/367 (25%), Positives = 147/367 (40%), Gaps = 67/367 (18%)

Query: 37  HEVRVQVTHTAVCHTDA--YTLSGVDPEGAF----PSILGHEGAGIVESVGDGVTNVKVG 90
           +  +V V  T +C +D   Y   G+   G +    P +LGHE +G+V  VG  V  +KVG
Sbjct: 30  YYAKVAVKATGICGSDVHYYRSGGI---GKYILNSPMVLGHESSGVVVEVGPKVEKIKVG 86

Query: 91  DHVVLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGT-TRFHNLKGEPLLHFMGCS 149
           D V +            K+ K NLC  +       +  DGT  +++    + L+      
Sbjct: 87  DRVAIEPGVPDRYSDETKAGKYNLCPHMAFAATPPI--DGTLVKYYLSPADFLVKLPDHV 144

Query: 150 TFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVFGAGTVG 209
           +F +           I+P         L  GV +      K A V+ G TV VFGAG VG
Sbjct: 145 SFEEGA--------CIEP---------LSVGVHSN-----KLAKVRFGQTVVVFGAGPVG 182

Query: 210 LSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDGG 269
           L     AK+ GAS ++ VDV DQK + + +FGAT  +N  K  K     ++  ++   GG
Sbjct: 183 LLTGAVAKAFGASDVVFVDVFDQKLERAKNFGATHVINSTKLPKNDPQALADEVEKLLGG 242

Query: 270 --LDFTFDCTGNVKVMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLITGRVWKGSAF 327
              D  F+C+G    +   ++A   G                     Q+  G+ +     
Sbjct: 243 ALADVVFECSGAESCIDAGVKATKNGGTM-----------------VQIGMGKNYVNFPI 285

Query: 328 GGIKGRSEMGQLVTSYQKGDLK------------VDDFITHKRPFTEINNA--FEDLHHG 373
             + G+         Y  GD K            V   ITH+  F +   A  F   H G
Sbjct: 286 AEVSGKEMTLVGCFRYSYGDYKDAVNLVSTGRVDVKKLITHRFSFEDAAKAYDFNIAHGG 345

Query: 374 DCLRTVL 380
           + ++T++
Sbjct: 346 EVVKTII 352

>TDEL0H04460 Chr8 complement(769988..771136) [1149 bp, 382 aa] {ON}
           Anc_7.2 YAL061W
          Length = 382

 Score = 80.5 bits (197), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 77/266 (28%), Positives = 116/266 (43%), Gaps = 32/266 (12%)

Query: 38  EVRVQVTHTAVCHTDAYTLS----------GVDPEGA--FPSILGHEGAGIVESVGDGVT 85
           EV ++V+   +C TD +  S          G  P      P  +GHE +GIV  +G  VT
Sbjct: 28  EVLIEVSWAGICGTDLHEYSDGPIFMPQDGGSHPLSGKKLPQPMGHEMSGIVSKIGSKVT 87

Query: 86  NVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHF 145
            VKVGDHVV+     C   K  K +      +  A + KG++        N+        
Sbjct: 88  KVKVGDHVVVEAGCSCMDVKRWKESPLKGGKTCSACE-KGLV--------NICAHACFTG 138

Query: 146 MGCST--FSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVF 203
           +G S   F++   V+    + I    PL    L+     T + A  K A  Q+G T  V 
Sbjct: 139 LGTSGGGFAERLTVSQDHCIPIPKDLPLDVAALVEPLSVTWHAA--KVAGFQKGQTACVL 196

Query: 204 GAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGETIVSKLI 263
           GAG +GL+ +   K  GASKI+V ++   ++  +   G   F NP     E +  +++L 
Sbjct: 197 GAGPIGLATILTLKGLGASKIVVSELAQIRRDMAASMGVEVF-NP----AEHKDAIAELR 251

Query: 264 DMTDG--GLDFTFDCTGNVKVMRDAL 287
            + +G  G D  FDC+G       AL
Sbjct: 252 KIPEGATGFDAAFDCSGVKATFNTAL 277

>TDEL0F03190 Chr6 (583849..584904) [1056 bp, 351 aa] {ON}  possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 351

 Score = 80.1 bits (196), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 78/277 (28%), Positives = 126/277 (45%), Gaps = 38/277 (13%)

Query: 21  GKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDP-EGAFPSILGHEGAGIVES 79
           G  L  + I V  P+ +E+ + V ++ VCHTD +   G  P     P + GHEGAGIV +
Sbjct: 18  GGELQYKDIPVPEPQPNELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGAGIVVA 77

Query: 80  VGDGV-TNVKVGDHVVLLY-TAECGKCKFC-KSNKTNLCGSVRATQGKGVMPDGTTRFHN 136
            G  V    ++GD   + +    C  C++C K+N++N C     +   G   DG      
Sbjct: 78  KGSMVXXGWEIGDLAGIKWLNGSCMSCEYCEKANESN-CPQADLS---GYTHDG------ 127

Query: 137 LKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQE 196
                        +F QY     V    +     L+ V  + C   T Y  A+K+AN++ 
Sbjct: 128 -------------SFQQYATADAVQAARVPKGTDLAEVAPILCAGITVY-KALKSANLRA 173

Query: 197 GDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEG 255
           G+ VA+ GA G +G   VQ AK+ G  +++ +D  D+K +     G   F+    D  + 
Sbjct: 174 GEWVAISGASGGLGSLAVQYAKAMG-YRVLGIDGGDEKAKLFKQLGGEYFI----DFTKS 228

Query: 256 ETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHK 292
           + +++++I  TDGG         NV V   A+ A  +
Sbjct: 229 KDVIAEVIKATDGGAHGVI----NVSVSEGAISASTR 261

>NCAS0J00300 Chr10 (43719..44792) [1074 bp, 357 aa] {ON} Anc_8.16
          Length = 357

 Score = 80.1 bits (196), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 83/289 (28%), Positives = 113/289 (39%), Gaps = 62/289 (21%)

Query: 27  EKIIVDAPKAHEVRVQVTHTAVCHTDA--YTLSGVDPEGAF----PSILGHEGAGIVESV 80
           EK I      H V+VQ+  T +C +D   Y    +   G F    P +LGHE +GI+  V
Sbjct: 21  EKPIPALTDEHWVKVQIKATGICGSDVHFYKYGSI---GDFVVKSPMVLGHESSGIIAEV 77

Query: 81  GDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGE 140
           G  V  +KVGD V L         +   S   NLC                         
Sbjct: 78  GSAVKTLKVGDRVALEPGYPSRYTEATMSGHYNLC------------------------- 112

Query: 141 PLLHFMGCS----TFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGA--------- 187
           P +HF        T ++Y +             P   V  L   V+   GA         
Sbjct: 113 PFMHFAATPPCDGTLTKYYL------------TPFDFVYKLPDNVSYEEGALLEPLSVGV 160

Query: 188 -AVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFV 246
            A K A  + GD V VFGAG VGL     AK  GA +++ +DV D+K + +  FGAT  +
Sbjct: 161 HANKQAGTRFGDKVVVFGAGPVGLLNGAVAKVFGALQVVFIDVVDEKLERAKHFGATAVI 220

Query: 247 NPLKDLKEGETIVSKLIDMTDGGL--DFTFDCTGNVKVMRDALEACHKG 293
           N  K     E  ++  I    GG+  D   +CTG    +R  + A   G
Sbjct: 221 NSSKLRINDEFELAVAIKEKLGGVDPDIVLECTGAEPCIRAGIRALKTG 269

>Skud_20.2 Chr20 (1588..2661) [1074 bp, 357 aa] {ON} YJR159W (REAL)
          Length = 357

 Score = 79.7 bits (195), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 100/373 (26%), Positives = 157/373 (42%), Gaps = 69/373 (18%)

Query: 31  VDAPKAHEVRVQVTHTAVCHTDA--YTLSGVDPEGAF----PSILGHEGAGIVESVGDGV 84
           +D P  H V++ +  T +C +D   Y   G+   G +    P +LGHE +G V  VGD V
Sbjct: 27  IDDP--HYVKLAIKATGICGSDVHYYRSGGI---GKYILKAPMVLGHESSGQVVEVGDAV 81

Query: 85  TNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGT-TRFHNLKGEPLL 143
           T VK+GD V +            K  + NLC  +       +  DGT  R++    + L+
Sbjct: 82  TRVKIGDRVAIEPGVPGRYSDETKEGRYNLCPHMAFAATPPI--DGTLVRYYLSPEDFLV 139

Query: 144 HFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVF 203
                 ++ +   V            PLS       GV +      K A V+ G  V VF
Sbjct: 140 KLPDGVSYEEGACVE-----------PLS------VGVHSN-----KLAGVRFGTRVVVF 177

Query: 204 GAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLK-DLKEGETIVSKL 262
           GAG VGL     A + GAS +I VDV D + Q + DFGA+G  N  K  + E + +  ++
Sbjct: 178 GAGPVGLLTGAVAHAFGASDVIFVDVFDNRLQRAKDFGASGTFNSSKFSVDEAQQLADEV 237

Query: 263 IDMTDG-GLDFTFDCTG-------NVKVMRDALEACHKGWGQSXXXXXXXXXXXXSTRPF 314
             +  G   D  F+C+G        VK  +        G G++            +  P 
Sbjct: 238 EKLLGGHHADVVFECSGADVCIDAGVKTTKVGGTMVQVGMGKN-----------YTNFPI 286

Query: 315 QLITGRVWK-----GSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPFTEINNAFED 369
             ++G+  +       +FG  +   +   LV S   G + V   ITH+  F +   A++ 
Sbjct: 287 AEVSGKEMRLIGCFRYSFGDYR---DAVNLVAS---GKVNVKPLITHRFKFEDAAKAYDY 340

Query: 370 --LHHGDCLRTVL 380
              H GD ++T++
Sbjct: 341 NIAHGGDVVKTII 353

>Skud_4.2 Chr4 complement(6287..7360) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 79.7 bits (195), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 100/373 (26%), Positives = 157/373 (42%), Gaps = 69/373 (18%)

Query: 31  VDAPKAHEVRVQVTHTAVCHTDA--YTLSGVDPEGAF----PSILGHEGAGIVESVGDGV 84
           +D P  H V++ +  T +C +D   Y   G+   G +    P +LGHE +G V  VGD V
Sbjct: 27  IDDP--HYVKLAIKATGICGSDVHYYRSGGI---GKYILKAPMVLGHESSGQVVEVGDAV 81

Query: 85  TNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGT-TRFHNLKGEPLL 143
           T VK+GD V +            K  + NLC  +       +  DGT  R++    + L+
Sbjct: 82  TRVKIGDRVAIEPGVPGRYSDETKEGRYNLCPHMAFAATPPI--DGTLVRYYLSPEDFLV 139

Query: 144 HFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVF 203
                 ++ +   V            PLS       GV +      K A V+ G  V VF
Sbjct: 140 KLPDGVSYEEGACVE-----------PLS------VGVHSN-----KLAGVRFGTRVVVF 177

Query: 204 GAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLK-DLKEGETIVSKL 262
           GAG VGL     A + GAS +I VDV D + Q + DFGA+G  N  K  + E + +  ++
Sbjct: 178 GAGPVGLLTGAVAHAFGASDVIFVDVFDNRLQRAKDFGASGTFNSSKFSVDEAQQLADEV 237

Query: 263 IDMTDG-GLDFTFDCTG-------NVKVMRDALEACHKGWGQSXXXXXXXXXXXXSTRPF 314
             +  G   D  F+C+G        VK  +        G G++            +  P 
Sbjct: 238 EKLLGGHHADVVFECSGADVCIDAGVKTTKVGGTMVQVGMGKN-----------YTNFPI 286

Query: 315 QLITGRVWK-----GSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPFTEINNAFED 369
             ++G+  +       +FG  +   +   LV S   G + V   ITH+  F +   A++ 
Sbjct: 287 AEVSGKEMRLIGCFRYSFGDYR---DAVNLVAS---GKVNVKPLITHRFKFEDAAKAYDY 340

Query: 370 --LHHGDCLRTVL 380
              H GD ++T++
Sbjct: 341 NIAHGGDVVKTII 353

>Suva_1.7 Chr1 (12310..13458) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 67/241 (27%), Positives = 105/241 (43%), Gaps = 43/241 (17%)

Query: 65  FPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECG--------------KCKFCKSN 110
            P  +GHE +GI+  VG  VT VKVGDHVV+   + C                C  CK  
Sbjct: 67  LPQAMGHEMSGIIAKVGPKVTKVKVGDHVVVQAGSSCADLHCWPHSKHYNSKPCDACKKG 126

Query: 111 KTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAP 170
             NLC       G GV+  G                    F++  VV++  ++ +    P
Sbjct: 127 CENLCTHA-GFIGLGVISGG--------------------FAEQVVVSEHHIIPVPKEIP 165

Query: 171 LSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVN 230
           L    L+     T +  AV+ +  ++G +  V GAG +GL  +   K  GA +I+V +V 
Sbjct: 166 LDVAALVEPLSVTWH--AVRLSGFKKGSSALVLGAGPIGLCTILVLKGMGAGQIVVSEVA 223

Query: 231 DQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDG--GLDFTFDCTGNVKVMRDALE 288
           +++ + +   G   F +P    K GE  V  L  +T    G D+++DC+G       +L+
Sbjct: 224 ERRMELARRLGVEIF-DP---RKHGEKSVESLRALTKSHDGFDYSYDCSGIQATFDASLK 279

Query: 289 A 289
           A
Sbjct: 280 A 280

>Suva_10.154 Chr10 complement(275737..276807) [1071 bp, 356 aa] {ON}
           YLR070C (REAL)
          Length = 356

 Score = 79.0 bits (193), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 103/385 (26%), Positives = 164/385 (42%), Gaps = 57/385 (14%)

Query: 14  AAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDA-YTLSGVDPEGAF--PSILG 70
           A V  + GK +     I     A++V VQ+  T +C +D  Y   G         P +LG
Sbjct: 9   AVVLEQPGKIVLTNVNIPKISDANDVIVQIKATGICGSDIHYYTHGRISHFVVKSPMVLG 68

Query: 71  HEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDG 130
           HE +G+V  +GD V  +KVGD V L            K  + NL   ++         DG
Sbjct: 69  HESSGVVVLIGDNVKTLKVGDRVALEPGFPNRFSSELKEGRYNLDPDLKFAATPPY--DG 126

Query: 131 T-TRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAV 189
           T T+++    + +       +F +  ++  +S+                         A 
Sbjct: 127 TLTKYYRAPKDFVYKIPDHVSFEEGALMEPLSVAV----------------------HAN 164

Query: 190 KTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPL 249
           + A ++ G    VFGAG VGL   + A   GA+ ++ VD+++ K + +  FGAT  VN  
Sbjct: 165 RLAKMRFGARCVVFGAGPVGLLTGKVASVFGATDVVFVDLSETKLERAKQFGATHMVNS- 223

Query: 250 KDLKEG---ETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHK-------GWGQSXX 299
            DL +G   ET++ K I     G D  F+C+G    +R  +E C         G GQ   
Sbjct: 224 GDLPQGVSAETVIRKAIGKK--GADVVFECSGAQPCIRTGIEVCKAGGTYVQVGMGQE-- 279

Query: 300 XXXXXXXXXXSTRPFQLITGRVWKGSAFGGIKG-RSEMGQLVTSYQKGDLKVDDFITHKR 358
                     S  P + IT   ++GS F   +G  S+  +LV+S   G L +   IT + 
Sbjct: 280 ----EIQFPISKIPAKEIT---FQGS-FRYCQGDYSDSIELVSS---GKLSLKPLITRRY 328

Query: 359 PFTEINNAFEDL--HHGDCLRTVLD 381
            F E   AF++   H  D ++T+++
Sbjct: 329 QFKEAIEAFDENRDHPLDNVKTIIE 353

>SAKL0D14872g Chr4 complement(1226093..1227244) [1152 bp, 383 aa]
           {ON} highly similar to gnl|GLV|KLLA0F00506g
           Kluyveromyces lactis KLLA0F00506g and similar to YAL060W
           uniprot|P39714 Saccharomyces cerevisiae YAL060W BDH1
           NAD- dependent (2R 3R)-2 3-butanediol dehydrogenase a
           zinc- containing medium-chain alcohol dehydrogenase
           produces 2 3- butanediol from acetoin during
           fermentation and allows using 2 3-butanediol as a carbon
           source during aerobic growth
          Length = 383

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 70/235 (29%), Positives = 110/235 (46%), Gaps = 30/235 (12%)

Query: 65  FPSILGHEGAGIVESVGDGVT-NVKVGDHVVLLYTAEC-GKCKFCK--SNKTNLCGSVRA 120
            P  +GHE +GIV  VG GV  + KVGDHVV+  T  C  + ++ K  S+K   C + + 
Sbjct: 67  LPQPMGHEMSGIVSKVGPGVKGDYKVGDHVVVEATCTCLDRYRWPKIESSKLPPCSACK- 125

Query: 121 TQGKGVMPDGTTRFHNLKGEPLLHFMGCST----FSQYTVVADVSLVTIDPSAPLSSVCL 176
              +G+    T           L F G       FS+  V+++  ++ I    PL    L
Sbjct: 126 ---RGIYNCCTH----------LGFCGLGAHGGGFSEKVVISEQHVIKIPKEIPLDIAAL 172

Query: 177 LGCGVTTGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQW 236
           +     + +  AVK +N++ G +  V GAG +GL+ +   +  GA KI+V +    +++ 
Sbjct: 173 VEPISVSWH--AVKISNLKPGQSALVLGAGPIGLATILALQGHGAGKIVVSEPAQIRREQ 230

Query: 237 SMDFGATGFVNPLKDLKEGETIVSKLIDMTDG--GLDFTFDCTGNVKVMRDALEA 289
           +   G   F NP    + GE  V +L  +  G  G DF+FDC+G        L A
Sbjct: 231 AAKLGVETF-NP---FEHGEKAVEELRKIPPGGDGFDFSFDCSGMKATFDTGLHA 281

>Smik_48.1 Chr48 complement(1..1074) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 103/370 (27%), Positives = 150/370 (40%), Gaps = 73/370 (19%)

Query: 37  HEVRVQVTHTAVCHTDA--YTLSGVDPEGAF----PSILGHEGAGIVESVGDGVTNVKVG 90
           H V++ +  T +C +D   Y   G+   G +    P +LGHE +G V  VG+ VT VKVG
Sbjct: 31  HYVKLAIKATGICGSDVHYYRSGGI---GKYILKAPMVLGHESSGEVVEVGNAVTRVKVG 87

Query: 91  DHVVLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCST 150
           D V +            K  + NLC  +       +  DGT   + L  E  L       
Sbjct: 88  DRVAIEPGVPSRYSDETKEGRYNLCPHMAFAATPPI--DGTLVKYYLSPEDFL------- 138

Query: 151 FSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVFGAGTVGL 210
                 V     V+ +  A    V  L  GV +      K A V+    V VFGAG VGL
Sbjct: 139 ------VKLPEGVSYEEGA---CVEPLSVGVHSN-----KLAGVRFSTRVVVFGAGPVGL 184

Query: 211 SVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVN----PLKDLKEGETIVSKLIDMT 266
                A++ GAS ++ VDV D K Q + DFGAT   N    P    +E  + V KL+   
Sbjct: 185 LTGAVARAFGASDVVFVDVFDNKLQRAKDFGATNTFNSSKIPTDKAQELASEVEKLL--- 241

Query: 267 DGG--LDFTFDCTG-------NVKVMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLI 317
            GG   D  F+C+G        VKV +        G G++            +  P   +
Sbjct: 242 -GGNHADVVFECSGADVCIDAGVKVTKVGGTMVQVGMGKN-----------YTNFPIAEV 289

Query: 318 TGRVWK-----GSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPFTEINNAFED--L 370
           +G+  K       +FG  +        V     G + V   ITH+  F +   A++    
Sbjct: 290 SGKEMKLIGCFRYSFGDYR------DAVNLVATGKVNVKPLITHRFKFEDAAKAYDYNIS 343

Query: 371 HHGDCLRTVL 380
           H GD ++T++
Sbjct: 344 HGGDVVKTII 353

>NDAI0H02050 Chr8 complement(500914..502071) [1158 bp, 385 aa] {ON} 
          Length = 385

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 72/274 (26%), Positives = 129/274 (47%), Gaps = 40/274 (14%)

Query: 38  EVRVQVTHTAVCHTDAYTLSG----------VDPEG--AFPSILGHEGAGIVESVGDGVT 85
           EV ++V++  +C TD +  +            +P      P  +GHE +G V+++G  VT
Sbjct: 28  EVLIEVSYCGICGTDLHEYTDGPIFFPKDGETNPLSNIPLPQPMGHEFSGFVKAIGSNVT 87

Query: 86  NVKVGDHVVLLYTAECG--------KCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNL 137
            V+VGD VV+   A CG          K  +  K   C +       G+  D     ++ 
Sbjct: 88  KVEVGDKVVV--EAGCGCKDVHRWPDSKLYEKRKDTFCSACE----NGI--DNCCENYDF 139

Query: 138 KGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQEG 197
            G   L  +G   F++  VV +  +V +    P + V  L   ++  +  AV+ +  ++G
Sbjct: 140 TG---LGVVG-GAFAERVVVGERHIVKLPEEVP-TDVGALVEPISVAW-HAVRVSKFEKG 193

Query: 198 DTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGET 257
            +  + GAG +GL+ +   K+ GASKI+V ++ ++++  +   G   F +P    K G+ 
Sbjct: 194 KSALILGAGPIGLAAILALKAHGASKIVVSELAERRRILASKMGVEVF-DP---SKHGDN 249

Query: 258 IVSKLIDMTDG--GLDFTFDCTGNVKVMRDALEA 289
            V++L ++  G  G D+ FDC+G       AL+A
Sbjct: 250 AVTELRNIPRGQHGFDYAFDCSGVKATFNTALKA 283

>ZYRO0F02552g Chr6 (203037..204092) [1056 bp, 351 aa] {ON} similar
           to uniprot|Q07786 Saccharomyces cerevisiae YDL246C SOR2
           Protein of unknown function computational analysis of
           large-scale protein-protein interaction data suggests a
           possible role in fructose or mannose metabolism
          Length = 351

 Score = 77.8 bits (190), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 84/278 (30%), Positives = 124/278 (44%), Gaps = 37/278 (13%)

Query: 24  LTVEKIIVDAPK-AHEVRVQVTHTAVCHTDA--YTLSGVDPEGAF----PSILGHEGAGI 76
           +TV+K  V   K  H V++ +  T +C +D   YT   +   G F    P +LGHE +GI
Sbjct: 15  ITVDKRDVPEIKDPHYVKLHIKATGICGSDVHYYTQGAI---GQFVVKSPMVLGHESSGI 71

Query: 77  VESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHN 136
           V  VG  VTNVKVGD V +             S   NLC  +          DGT   + 
Sbjct: 72  VAEVGSAVTNVKVGDRVAIEPGIPSRYSDETMSGNYNLCPHMVFAATPPY--DGTLTKYY 129

Query: 137 LKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQE 196
           L  E  ++ M      +   +A+          P+S       GV      A K A  + 
Sbjct: 130 LAPEDFVYKMPDHLSFEEGALAE----------PMS------VGVH-----ANKLAGTRF 168

Query: 197 GDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGE 256
           G  V V GAG VGL     A++ GA++++ VD+ ++K + S  FGAT  V+   D    E
Sbjct: 169 GSKVLVSGAGPVGLLAGAVARAFGATEVVFVDIAEEKLERSKQFGATHTVSSSSD---EE 225

Query: 257 TIVSKLIDMTDGGL-DFTFDCTGNVKVMRDALEACHKG 293
             VS++  +  G L +   +C+G    +R  ++AC  G
Sbjct: 226 RFVSEVSKVLGGDLPNIVLECSGAQPAIRCGVKACKAG 263

>KNAG0E02590 Chr5 complement(513565..514689) [1125 bp, 374 aa] {ON}
           Anc_2.480 YMR083W
          Length = 374

 Score = 77.8 bits (190), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 73/257 (28%), Positives = 110/257 (42%), Gaps = 28/257 (10%)

Query: 16  VAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPEGA-FPSILGHEGA 74
           + YE G  L  + I V  PK +E+ V V ++ VCHTD +   G  P     P + GHEGA
Sbjct: 34  IFYEHGGDLHYKDIPVPKPKPNEILVNVKYSGVCHTDLHAWKGDWPLSVKLPLVGGHEGA 93

Query: 75  GIVESVGDGVTNVKVGDHV-VLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTR 133
           G+V + G  V N ++GD   +      C  C+ C+S   + C     +   G   DG   
Sbjct: 94  GVVVAKGSNVNNFEIGDLAGIKWLNGSCMSCELCESGHESNCEHADLS---GYTHDG--- 147

Query: 134 FHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTAN 193
                           +F QY     V    I     L+ V  + C   T Y  A+K A+
Sbjct: 148 ----------------SFQQYATADAVQAAKIPEGTNLAEVAPVLCAGITVY-KALKEAS 190

Query: 194 VQEGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDL 252
           +  G  V + G AG +G   VQ  K+ G  ++I +D    K++     G   F++  K  
Sbjct: 191 LSPGQWVCISGAAGGLGSLAVQYGKAMGL-RVIGIDGGPGKEELFKSLGGEVFIDFTKQ- 248

Query: 253 KEGETIVSKLIDMTDGG 269
           K    +V+ +   T+GG
Sbjct: 249 KTDSDMVAAIQKATNGG 265

>YJR159W Chr10 (736044..737117) [1074 bp, 357 aa] {ON}  SOR1Sorbitol
           dehydrogenase; expression is induced in the presence of
           sorbitol or xylose
          Length = 357

 Score = 77.4 bits (189), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 105/373 (28%), Positives = 151/373 (40%), Gaps = 79/373 (21%)

Query: 37  HEVRVQVTHTAVCHTDA--YTLSGVDPEGAF----PSILGHEGAGIVESVGDGVTNVKVG 90
           H V++ +  T +C +D   Y   G+   G +    P +LGHE +G V  VGD VT VKVG
Sbjct: 31  HYVKLAIKATGICGSDIHYYRSGGI---GKYILKAPMVLGHESSGQVVEVGDAVTRVKVG 87

Query: 91  DHVVLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCST 150
           D V +            K  + NLC  +       +  DGT   + L  E  L       
Sbjct: 88  DRVAIEPGVPSRYSDETKEGRYNLCPHMAFAATPPI--DGTLVKYYLSPEDFL------- 138

Query: 151 FSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVFGAGTVGL 210
                 V     V+ +  A    V  L  GV +      K A V+ G  V VFGAG VGL
Sbjct: 139 ------VKLPEGVSYEEGA---CVEPLSVGVHSN-----KLAGVRFGTKVVVFGAGPVGL 184

Query: 211 SVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNP-------LKDLKEGETIVSKLI 263
                A++ GA+ +I VDV D K Q + DFGAT   N         +DL +G   V KL+
Sbjct: 185 LTGAVARAFGATDVIFVDVFDNKLQRAKDFGATNTFNSSQFSTDKAQDLADG---VQKLL 241

Query: 264 DMTDGG--LDFTFDCTG-------NVKVMRDALEACHKGWGQSXXXXXXXXXXXXSTRPF 314
               GG   D  F+C+G        VK  +        G G++            +  P 
Sbjct: 242 ----GGNHADVVFECSGADVCIDAAVKTTKVGGTMVQVGMGKN-----------YTNFPI 286

Query: 315 QLITGRVWK-----GSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPFTEINNAFED 369
             ++G+  K       +FG  +        V     G + V   ITHK  F +   A++ 
Sbjct: 287 AEVSGKEMKLIGCFRYSFGDYR------DAVNLVATGKVNVKPLITHKFKFEDAAKAYDY 340

Query: 370 --LHHGDCLRTVL 380
              H G+ ++T++
Sbjct: 341 NIAHGGEVVKTII 353

>ABR229C Chr2 complement(831895..832956) [1062 bp, 353 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR070C
           (XYL2)
          Length = 353

 Score = 77.4 bits (189), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 82/284 (28%), Positives = 118/284 (41%), Gaps = 38/284 (13%)

Query: 15  AVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDA-YTLSGVDPEGAF----PSIL 69
           A+ YE  +P+ V    ++ P  H V+V++  T +C +D  Y L G    G F    P +L
Sbjct: 16  AIVYE-HRPVPV----IEDP--HYVKVKIEKTGICGSDVHYYLHGSI--GPFVVRSPMVL 66

Query: 70  GHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPD 129
           GHE +G V  VG  VT V++GD V +         +  KS   NLC  +R         D
Sbjct: 67  GHESSGTVVEVGSDVTRVRIGDRVAIEPGVPSRYSEETKSGHYNLCREMRFAATPPY--D 124

Query: 130 GTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAV 189
           G                   T  +Y +  +  LV +  S  L    L  C        A 
Sbjct: 125 G-------------------TLVKYYISPEDFLVKLPDSVSLEEGAL--CEPLAVAVHAN 163

Query: 190 KTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPL 249
           + A  Q    V VFGAG VGL     AK+ GA+ + +VD++  K   +   G T  V+  
Sbjct: 164 RLAGTQFPSRVVVFGAGPVGLLTASVAKAFGATTVAIVDISKHKLCVAPALGVTHPVDS- 222

Query: 250 KDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHKG 293
            D    E + +KL       +D  FDC+G    +  A+  C  G
Sbjct: 223 SDCSSPEALANKLRAELRSDVDIAFDCSGAEICIAAAVLICRPG 266

>Kwal_26.6684 s26 (21910..22980) [1071 bp, 356 aa] {ON} YJR159W
           (SOR1) - sorbitol-induced sorbitol dehydrogenase [contig
           381] FULL
          Length = 356

 Score = 77.0 bits (188), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 82/261 (31%), Positives = 116/261 (44%), Gaps = 38/261 (14%)

Query: 28  KIIVDAPKAHEVRVQVTHTAVCHTDA-YTLSGVDPEGAF----PSILGHEGAGIVESVGD 82
           + + + P  H V+V +  T +C +D  Y  SG    G +    P +LGHE +G V  VG 
Sbjct: 21  RPVPELPNEHYVKVAIKATGICGSDIHYYKSG--SIGKYVVNQPMVLGHESSGEVVEVGS 78

Query: 83  GVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPL 142
            V ++KVGD V +            K  + NLC  +       +  DGT          L
Sbjct: 79  AVRSIKVGDRVAIEPGVPDRYSDETKQGRYNLCPDMAFAATPPI--DGT----------L 126

Query: 143 LHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCL--LGCGVTTGYGAAVKTANVQEGDTV 200
           + +        Y   AD  +   D  +     C+  L  GV      A K A V  G  V
Sbjct: 127 VKY--------YVSPADFLVKLPDHVSFEEGACIEPLSVGVH-----ANKLAKVHFGSVV 173

Query: 201 AVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLK--EGETI 258
            VFGAG VGL     AK+ GAS++I VDV D K + +  FGAT  +N  K L   EG+ +
Sbjct: 174 VVFGAGPVGLLTGAVAKAFGASEVIYVDVFDNKLERAKGFGATHTINS-KSLPRGEGDAV 232

Query: 259 VSKLIDMTDGGL-DFTFDCTG 278
            + + +   G L D  F+C+G
Sbjct: 233 SAAVSNYLGGALADVVFECSG 253

>Kwal_55.20564 s55 complement(459253..459903) [651 bp, 216 aa] {ON}
           YOL086C (ADH1) - Alcohol dehydrogenase [contig 146] FULL
          Length = 216

 Score = 74.7 bits (182), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 62/218 (28%), Positives = 99/218 (45%), Gaps = 27/218 (12%)

Query: 21  GKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDP-EGAFPSILGHEGAGIVES 79
           G  L  + I V  P + E+ + V ++ VCHTD +   G  P     P + GHEGAG+V +
Sbjct: 16  GGELEYKDIPVPKPSSTEILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGAGVVVA 75

Query: 80  VGDGVTNVKVGDHVVLLY-TAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLK 138
           +G+ V   KVGD   + +    C  C++C+    + C     +   G   DG        
Sbjct: 76  LGENVKGWKVGDLAGIKWLNGSCMACEYCELGNESNCPHADLS---GYTHDG-------- 124

Query: 139 GEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQEGD 198
                      +F QY     V    I     L+ V  + C   T Y  A+K+A+++ G 
Sbjct: 125 -----------SFQQYATADAVQAAKIPQGTDLAQVAPILCAGITVY-KALKSADLKAGQ 172

Query: 199 TVAVFGA-GTVGLSVVQGAKSRGASKIIVVDVNDQKKQ 235
            VA+ GA G +G   VQ A++ G  +++ +D  D K++
Sbjct: 173 WVAISGACGGLGSLAVQYARAMG-YRVLGIDGGDDKRK 209

>YLR070C Chr12 complement(274141..275211) [1071 bp, 356 aa] {ON}
           XYL2Xylitol dehydrogenase, converts xylitol to
           D-xylulose; expression induced by xylose, even though
           this pentose sugar is not well utilized by S.
           cerevisiae; null mutant has cell wall defect
          Length = 356

 Score = 77.0 bits (188), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 99/370 (26%), Positives = 157/370 (42%), Gaps = 58/370 (15%)

Query: 31  VDAPK---AHEVRVQVTHTAVCHTDAYTLSG---VDPEGAFPSILGHEGAGIVESVGDGV 84
           V  PK    +EV +Q+  T +C +D +  +     +     P +LGHE +GIV  +G+ V
Sbjct: 23  VSIPKISDPNEVIIQIKATGICGSDIHYYTHGRIANYVVESPMVLGHESSGIVALIGENV 82

Query: 85  TNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGT-TRFHNLKGEPLL 143
             +KVGD V L            K  + NL  +++         DGT T+++      + 
Sbjct: 83  KTLKVGDRVALEPGIPDRFSPEMKEGRYNLDPNLKFAATPPF--DGTLTKYYKT----MK 136

Query: 144 HFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVF 203
            F+       Y +  DVS        PLS               A K A ++ G    VF
Sbjct: 137 DFV-------YKLPDDVSFEEGALIEPLSVAI-----------HANKLAKIKFGARCVVF 178

Query: 204 GAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGETIVSKLI 263
           GAG +GL   + A   GA+ ++ VD+ + K + +  FGAT  VN   DL  G T+ S + 
Sbjct: 179 GAGPIGLLAGKVASVFGAADVVFVDLLENKLETARQFGATHIVNS-GDLPHGVTVDSVIK 237

Query: 264 D-MTDGGLDFTFDCTGNVKVMRDALEACHK-------GWGQSXXXXXXXXXXXXSTRPFQ 315
             +   G D  F+C+G    +R  +E C         G GQ                P  
Sbjct: 238 KAIGKKGADVVFECSGAEPCVRAGIEVCKAGGTIVQVGMGQEEIQF-----------PIS 286

Query: 316 LI-TGRVWKGSAFGGIKG-RSEMGQLVTSYQKGDLKVDDFITHKRPFTEINNAFEDLHHG 373
           +I T  +     F   +G  S+  +LV+S +   L +  FITH+  F +   AFE+  H 
Sbjct: 287 IIPTKELTFQGCFRYCQGDYSDSIELVSSRK---LSLKPFITHRYSFKDAVEAFEETSHH 343

Query: 374 --DCLRTVLD 381
             + ++T+++
Sbjct: 344 PLNNIKTIIE 353

>TBLA0A04290 Chr1 (1063289..1064476) [1188 bp, 395 aa] {ON} Anc_7.3
           YAL060W
          Length = 395

 Score = 77.0 bits (188), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 63/240 (26%), Positives = 99/240 (41%), Gaps = 41/240 (17%)

Query: 65  FPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGK--------------CKFCKSN 110
            P  +GHE AG+V  VG GV   KVGDHVV+  T  C                C  CK  
Sbjct: 67  LPQAMGHEMAGVVSRVGPGVKKFKVGDHVVVEPTGTCKDRYRWKNSPSKNDDMCNACKKG 126

Query: 111 KTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAP 170
             N+C  +    G GV   G                    F++  V+ +     +    P
Sbjct: 127 YYNICSKL-GLCGAGVQSGG--------------------FAERVVMNESHCHKVPDDLP 165

Query: 171 LSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVN 230
           L    L+       +  A++  N ++G +  V G+G +GL ++      G + I+V +  
Sbjct: 166 LDIAALIQPIAVCWH--ALRICNFKKGSSALVVGSGPIGLGIILALHGHGCTDIVVSEPA 223

Query: 231 DQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDG--GLDFTFDCTGNVKVMRDALE 288
             ++ ++ + GAT F +P   L   E  +  L  +  G  G D+TFDC+GN      ++E
Sbjct: 224 KIRRDFAKELGATVF-DP-SSLPTHEESIKYLRSIAPGGDGFDYTFDCSGNQYTFNASIE 281

>YDL246C Chr4 complement(8683..9756) [1074 bp, 357 aa] {ON}
           SOR2Protein of unknown function; protein sequence is 99%
           identical to the Sor1p sorbitol dehydrogenase;
           computational analysis of large-scale protein-protein
           interaction data also suggests a role in fructose or
           mannose metabolism
          Length = 357

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 105/373 (28%), Positives = 150/373 (40%), Gaps = 79/373 (21%)

Query: 37  HEVRVQVTHTAVCHTDA--YTLSGVDPEGAF----PSILGHEGAGIVESVGDGVTNVKVG 90
           H V++ +  T +C +D   Y   G+   G +    P +LGHE +G V  VGD VT VKVG
Sbjct: 31  HYVKLAIKATGICGSDIHYYRSGGI---GKYILKAPMVLGHESSGQVVEVGDAVTRVKVG 87

Query: 91  DHVVLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCST 150
           D V +            K    NLC  +       +  DGT   + L  E  L       
Sbjct: 88  DRVAIEPGVPSRYSDETKEGSYNLCPHMAFAATPPI--DGTLVKYYLSPEDFL------- 138

Query: 151 FSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVFGAGTVGL 210
                 V     V+ +  A    V  L  GV +      K A V+ G  V VFGAG VGL
Sbjct: 139 ------VKLPEGVSYEEGA---CVEPLSVGVHSN-----KLAGVRFGTKVVVFGAGPVGL 184

Query: 211 SVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNP-------LKDLKEGETIVSKLI 263
                A++ GA+ +I VDV D K Q + DFGAT   N         +DL +G   V KL+
Sbjct: 185 LTGAVARAFGATDVIFVDVFDNKLQRAKDFGATNTFNSSQFSTDKAQDLADG---VQKLL 241

Query: 264 DMTDGG--LDFTFDCTG-------NVKVMRDALEACHKGWGQSXXXXXXXXXXXXSTRPF 314
               GG   D  F+C+G        VK  +        G G++            +  P 
Sbjct: 242 ----GGNHADVVFECSGADVCIDAAVKTTKVGGTMVQVGMGKN-----------YTNFPI 286

Query: 315 QLITGRVWK-----GSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPFTEINNAFED 369
             ++G+  K       +FG  +        V     G + V   ITHK  F +   A++ 
Sbjct: 287 AEVSGKEMKLIGCFRYSFGDYR------DAVNLVATGKVNVKPLITHKFKFEDAAKAYDY 340

Query: 370 --LHHGDCLRTVL 380
              H G+ ++T++
Sbjct: 341 NIAHGGEVVKTII 353

>Suva_12.260 Chr12 (427406..428479) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 102/375 (27%), Positives = 154/375 (41%), Gaps = 71/375 (18%)

Query: 30  IVDAPKAHEVRVQVTHTAVCHTDA--YTLSGVDPEGAF----PSILGHEGAGIVESVGDG 83
           I++ P  H V++ +  T +C +D   Y   G+   G +    P +LGHE +G V  VG  
Sbjct: 26  IIEDP--HYVKIAIKATGICGSDIHYYRSGGI---GKYILKAPMVLGHESSGQVVEVGSA 80

Query: 84  VTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLL 143
           VT VKVGD V +            K  + NLC  +       +  DGT   + L  E  L
Sbjct: 81  VTRVKVGDRVAIEPGVPSRYSDETKEGRYNLCPHMAFAATPPI--DGTLVKYYLSPEDFL 138

Query: 144 HFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVF 203
                        V     V+ +  A    V  L  GV +      K A V+ G  V VF
Sbjct: 139 -------------VKLPEGVSYEEGA---CVEPLSVGVHSN-----KLAGVRFGSRVVVF 177

Query: 204 GAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVN----PLKDLKEGETIV 259
           GAG VGL     A++ GAS ++ +DV D K   + +FGAT   N    P    +E    V
Sbjct: 178 GAGPVGLLTGAVARAFGASDVVFIDVFDNKLDRAKEFGATHTFNSSKFPADKTQELADEV 237

Query: 260 SKLIDMTDGGLDFTFDCTG-------NVKVMRDALEACHKGWGQSXXXXXXXXXXXXSTR 312
            KL  ++    D  F+C+G        VK+ +        G G++            +  
Sbjct: 238 EKL--LSGHHADIVFECSGADACIDAGVKITKVGGTMVQIGMGKN-----------YTNF 284

Query: 313 PFQLITGRVWK-----GSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPFTEINNA- 366
           P   ++G+  K       +FG  +   +  +LV S   G + V   ITH+  F +   A 
Sbjct: 285 PIAEVSGKEMKLIGCFRYSFGDYR---DAVKLVAS---GKVNVKAMITHRFKFEDAAKAY 338

Query: 367 -FEDLHHGDCLRTVL 380
            F   H G+ ++T++
Sbjct: 339 DFNIAHGGEVVKTII 353

>Kpol_1049.18 s1049 complement(35191..36351) [1161 bp, 386 aa] {ON}
           complement(35191..36351) [1161 nt, 387 aa]
          Length = 386

 Score = 75.1 bits (183), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 64/242 (26%), Positives = 102/242 (42%), Gaps = 42/242 (17%)

Query: 65  FPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAEC--------------GKCKFCKSN 110
            P  +GHE +GI+ SVG G    K+GDHVV+  TA C                C+ C++ 
Sbjct: 67  LPQAMGHEISGIISSVGPGCKKFKIGDHVVVEPTATCIDRYRWPNAPNRDTPMCEACRNG 126

Query: 111 KTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAP 170
             N+C  +  T G GV   G                    F++  V+ +     I    P
Sbjct: 127 MPNICKYLGLT-GAGVEGGG--------------------FAEKMVINEHHCHKIPHHMP 165

Query: 171 LSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVN 230
           L    L+       +  AVK ++ ++G +V + G G +GL  +   K  G   I+V +  
Sbjct: 166 LDVASLIQPISVCWH--AVKVSHYKQGGSVLIVGGGPIGLGTILALKGFGCEDIVVSEPA 223

Query: 231 DQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDG--GLDFTFDCTGNVKVMRDALE 288
             +++ +   GA  F      L   +  +  L +M  G  G D+TFDC+G    ++ A+E
Sbjct: 224 LIRRELAEKMGARVFDPSNMSL---DNSIKTLTEMAPGSQGFDYTFDCSGIPATLKVAIE 280

Query: 289 AC 290
            C
Sbjct: 281 CC 282

>SAKL0D14894g Chr4 complement(1230497..1231654) [1158 bp, 385 aa]
           {ON} similar to uniprot|P39713 Saccharomyces cerevisiae
           YAL061W putative polyol dehydrogenase
          Length = 385

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 61/239 (25%), Positives = 99/239 (41%), Gaps = 38/239 (15%)

Query: 65  FPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAEC--------------GKCKFCKSN 110
            P  +GHE AG+V  +G GV   +VGDHVV+  T+ C                C  CK  
Sbjct: 67  LPQAMGHEMAGVVSKIGPGVQGFEVGDHVVVEPTSTCLDRYRFPNSKHSGEEPCAACKRG 126

Query: 111 KTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAP 170
             N+C  +    G GV   G                    FS+  V+    ++ I    P
Sbjct: 127 LYNICSHL-GLCGVGVQSGG--------------------FSERVVMNQKHVIKIPKHIP 165

Query: 171 LSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVN 230
           L    L+     + +  A++ + +  G +  V G G +GL  +   ++ GASKI+V +  
Sbjct: 166 LDVAALVQPLAVSWH--AIRISGLTAGKSALVVGGGPIGLGTILALQAYGASKIVVSEPA 223

Query: 231 DQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEA 289
             +++ +   GA  F     +  E    + K+    D G D++FDC+G     R ++ A
Sbjct: 224 KNRRELAKLMGAEVFDPTEWEEHEAVEYLRKVAPGGD-GFDYSFDCSGLPVTFRASVHA 281

>KNAG0I00120 Chr9 (9352..10497) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 71/269 (26%), Positives = 111/269 (41%), Gaps = 29/269 (10%)

Query: 38  EVRVQVTHTAVCHTDAYTLS------------GVDPEGAFPSILGHEGAGIVESVGDGVT 85
           E+ V V    +C TD +  +             V    + P  +GHE +G V  VG  VT
Sbjct: 28  ELIVDVAFCGICGTDLHEYTDGPIFMPKDGEKNVLSNKSIPQAMGHEFSGYVAKVGPKVT 87

Query: 86  NVKVGDHVVLLYTAEC---GKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPL 142
            VKVGD VV+  T  C    +    K  KT  C + +         D    +    G   
Sbjct: 88  KVKVGDRVVVEATCSCVDLHRWPESKHYKTPACNACKDRC------DNCCEYAGFMG--- 138

Query: 143 LHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQEGDTVAV 202
           L  +G   F++  V  +  +V +    P+    L+   ++  + AA + +    G +  V
Sbjct: 139 LGVVG-GAFAERIVTIEHHVVKLPDGFPMDVAALIE-PLSVAWHAA-RVSKFPPGKSALV 195

Query: 203 FGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGETIVSKL 262
            GAG +GL+++   K++GASKIIV +    +++ +       F       K    + SK 
Sbjct: 196 LGAGPIGLAMILVLKAQGASKIIVSEPATMRRELADRMHVETFDPSTHGDKSVAMLRSKT 255

Query: 263 IDMTDGGLDFTFDCTGNVKVMRDALEACH 291
            D    G DF FDC+G        L+A H
Sbjct: 256 FD--GKGFDFAFDCSGVPATFNTGLQAAH 282

>NCAS0A07670 Chr1 complement(1527273..1528592) [1320 bp, 439 aa]
           {ON} 
          Length = 439

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 64/258 (24%), Positives = 104/258 (40%), Gaps = 46/258 (17%)

Query: 45  HTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECG-- 102
           H   CH     +SG   EG  P  +GHE AG +   G GVT  KVGD VV+  T  C   
Sbjct: 94  HDGCCHE----ISG---EG-LPQAMGHEIAGTIIECGPGVTKFKVGDRVVVEPTGTCKDR 145

Query: 103 ------------KCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCST 150
                        C  CK    N+C ++    G GV   G                    
Sbjct: 146 YRWPNSPNVDKEPCAACKKGLYNICSNL-GLVGAGVQSGG-------------------- 184

Query: 151 FSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVFGAGTVGL 210
           F++  V+ +     +     +    L+     + +  AV+ +  ++G +V + GAG +GL
Sbjct: 185 FAERLVMNERQCYKVPDHMSMDVAALIQPIAVSWH--AVRVSKFKKGASVLIVGAGPIGL 242

Query: 211 SVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDGGL 270
             +      G S+++V +    ++ ++   GA  +    KD  E    +  +    D G 
Sbjct: 243 GTILALNGHGVSEVVVSEPAKIRRDFAEKMGAIVYDPSAKDHDESIKYLRSIAPGGD-GF 301

Query: 271 DFTFDCTGNVKVMRDALE 288
           D+ FDC+GN   ++ A+E
Sbjct: 302 DYAFDCSGNPATLKAAIE 319

>NCAS0A07660 Chr1 complement(1525755..1526915) [1161 bp, 386 aa]
           {ON} 
          Length = 386

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 66/229 (28%), Positives = 112/229 (48%), Gaps = 15/229 (6%)

Query: 65  FPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRATQGK 124
            P  +GHE  G V+++G+ VT V VGD VV+   A CG     +  ++++ G  + T  +
Sbjct: 67  LPQPMGHEFCGFVKAIGNKVTKVAVGDKVVV--EAGCGCKDVHRWPQSHVYGKEQCTACR 124

Query: 125 GVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTG 184
               +  T      G   L  +G   F++  VV +  +V +    P + V  L   ++  
Sbjct: 125 KGFDNCCTH----AGFTGLGVVG-GAFAEQVVVGERHVVKLPEEVP-TDVGALVEPLSVA 178

Query: 185 YGAAVKTANVQEGD--TVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGA 242
           +  AVK A  ++G      V GAG +GL+ +   K+ GASKI+V ++   +++ ++  G 
Sbjct: 179 W-HAVKVAGFEKGSGKNALVLGAGPIGLATILALKAHGASKIVVSELAAIRRELALKMGV 237

Query: 243 TGFVNPLK--DLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEA 289
             F +P K  D K+G   + ++ +  D G DF FDC+G       AL +
Sbjct: 238 EVF-DPSKHGDEKQGIKKLREIPEDHD-GFDFAFDCSGVETTFNTALHS 284

>YAL061W Chr1 (33448..34701) [1254 bp, 417 aa] {ON}  BDH2Putative
           medium-chain alcohol dehydrogenase with similarity to
           BDH1; transcription induced by constitutively active
           PDR1 and PDR3
          Length = 417

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 59/228 (25%), Positives = 88/228 (38%), Gaps = 38/228 (16%)

Query: 65  FPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGK--------------CKFCKSN 110
            P  +GHE AG V  VG GV N+KVGD VV+  T  C                C  CK  
Sbjct: 67  LPQAMGHEMAGTVLEVGPGVKNLKVGDKVVVEPTGTCRDRYRWPLSPNVDKEWCAACKKG 126

Query: 111 KTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAP 170
             N+C S     G GV   G                    F++  V+ +     +    P
Sbjct: 127 YYNIC-SYLGLCGAGVQSGG--------------------FAERVVMNESHCYKVPDFVP 165

Query: 171 LSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVN 230
           L    L+       +  A++    + G T  + GAG +GL  +    + G   I+V +  
Sbjct: 166 LDVAALIQPLAVCWH--AIRVCEFKAGSTALIIGAGPIGLGTILALNAAGCKDIVVSEPA 223

Query: 231 DQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTG 278
             +++ +   GA  +       KE    +  + D  D G D+TFDC+G
Sbjct: 224 KVRRELAEKMGARVYDPTAHAAKESIDYLRSIADGGD-GFDYTFDCSG 270

>KLLA0D05511g Chr4 complement(476363..477427) [1065 bp, 354 aa] {ON}
           similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase expression is
           induced in the presence of sorbitol
          Length = 354

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 102/380 (26%), Positives = 150/380 (39%), Gaps = 48/380 (12%)

Query: 15  AVAYEAGKPLTVEKIIVDAPK---AHEVRVQVTHTAVCHTDA--YTLSGVDPEGAF---- 65
           AV  +    +T E I   AP+   +H V++ V  T +C +D   YT   +   G F    
Sbjct: 7   AVVLQKKGEITFEDI--PAPEITDSHYVKIHVKKTGICGSDIHYYTHGSI---GEFVVKK 61

Query: 66  PSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRATQGKG 125
           P +LGHE +G+V  VG  VT V+VGD V +            KS   NLC  +       
Sbjct: 62  PMVLGHESSGVVVEVGKDVTLVQVGDRVAIEPGVPSRYSDETKSGHYNLCPHMAFAATPP 121

Query: 126 VMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGY 185
              DGT   + L  E  L             V     V+ +  A         C      
Sbjct: 122 Y--DGTLVKYYLAPEDFL-------------VKLPDHVSFEEGA---------CAEPLAV 157

Query: 186 GA-AVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATG 244
           G  A + A    G  V VFGAG VGL     A + GAS ++ VDV + K + S DFGAT 
Sbjct: 158 GVHANRLAETSFGKNVVVFGAGPVGLVTGAVAAAFGASAVVYVDVFENKLERSKDFGATN 217

Query: 245 FVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHKGWGQSXXXXXXX 304
            +N  K   E E       ++     +   DC+G    +R A++    G           
Sbjct: 218 TINSTKYKSEDELTEVIKSELKGEQPEIAIDCSGAEICIRTAIKVLKAGGSYVQVGMGKD 277

Query: 305 XXXXXSTRPFQLITGRVWKGSAFGGIKGR-SEMGQLVTSYQKGDLKVDDFITHKRPFTEI 363
                   P  +I  +  +    G  +   ++    V    +G + V   ITH   F E 
Sbjct: 278 NI----NFPIAMIGAKELR--VLGSFRYYFNDYKIAVKLISEGKVNVKKMITHTFKFEEA 331

Query: 364 NNAFE-DLHHG-DCLRTVLD 381
            +A+  +L HG + ++T++D
Sbjct: 332 IDAYNFNLEHGSEVVKTMID 351

>KAFR0I00160 Chr9 (33043..34200) [1158 bp, 385 aa] {ON} Anc_7.2
           YAL061W
          Length = 385

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 71/307 (23%), Positives = 122/307 (39%), Gaps = 58/307 (18%)

Query: 13  VAAVAYEAGKPLTVEKIIVDAPK---AHEVRVQVTHTAVCHTDAYTLSGVD-----PE-- 62
           + A+AY A   +   K +V+ PK     E+ +++ +  +C TD +    +D     PE  
Sbjct: 1   MRALAYFAKGDIHFTKDLVE-PKISTPDELILEINYCGICGTDLHEY--IDGPIFFPEDG 57

Query: 63  -------GAFPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGK------------ 103
                     P  +GHE AG V  +G  VT  KVGDHVV+     C              
Sbjct: 58  ETNELSGSGLPQAMGHEIAGTVVKIGPKVTKFKVGDHVVVQPNGTCKDRYRWPHSPHVNK 117

Query: 104 --CKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVS 161
             C  CK    N+C ++    G GV   G                     ++   + +  
Sbjct: 118 PWCSACKKGHYNVCSNL-GLIGNGVQSGGC--------------------AERMCINESH 156

Query: 162 LVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGA 221
              +    P+    L+     + +  A+K A  + G +V V G G +GL  +   +  G 
Sbjct: 157 CFKVPKDMPMDIAALIQPIAVSWH--AIKVARFKRGGSVLVIGGGPIGLCTLLALQGHGC 214

Query: 222 SKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVK 281
           S I+V +    +++ +   GAT +     + ++    + K+I   D G D+ FD +G  +
Sbjct: 215 SDIVVSEPAKVRRELAERMGATTYDPSQHNTEKNIQNLRKMILGGD-GFDYVFDNSGTPE 273

Query: 282 VMRDALE 288
            +  A+E
Sbjct: 274 TLETAIE 280

>TDEL0D03720 Chr4 (683833..684840) [1008 bp, 335 aa] {ON} Anc_3.253
           YBR046C
          Length = 335

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 64/252 (25%), Positives = 100/252 (39%), Gaps = 69/252 (27%)

Query: 37  HEVRVQVTHTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGDGVTNVKVGDHVVLL 96
           +E+ ++  +  +   +AY   G+ P    P ILG E  G+V + G  V N  +GD V   
Sbjct: 37  NELLIKNKYAGINFIEAYFRKGIYPV-QLPQILGREATGVVVAKGQSVKNFDIGDKVA-- 93

Query: 97  YTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTV 156
                                                           +M  STF+QYT 
Sbjct: 94  ------------------------------------------------YMSSSTFAQYTK 105

Query: 157 VADVSLVTIDPSAP-------LSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVFGA-GTV 208
            +   L++  PS          ++  + G    T    A K   V+EGD + ++ A G V
Sbjct: 106 YSSSGLISKLPSETTDDQLKVYAAALIQGLTALTFLDEAYK---VKEGDYILLYAAAGGV 162

Query: 209 GLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMT-D 267
           GL + Q  K RGA  I VV   ++K++ +  FGA   +N  K     E I+ + +++T D
Sbjct: 163 GLLMDQLLKERGAHAIAVVS-TEEKEELAKKFGAEYVINSSK-----EDILKRALEITND 216

Query: 268 GGLDFTFDCTGN 279
            G+D  FD  G 
Sbjct: 217 KGVDAVFDSVGK 228

>Suva_1.6 Chr1 (10591..11844) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 86/228 (37%), Gaps = 38/228 (16%)

Query: 65  FPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGK--------------CKFCKSN 110
            P  +GHE AG V  VG GVT  KVGD VV+  T  C                C  CK  
Sbjct: 67  LPQAMGHEMAGTVAKVGPGVTQFKVGDKVVVEPTGTCRDRYRWPTSPNVDKEWCAACKRG 126

Query: 111 KTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAP 170
             N+C S     G GV   G                    F++  V+ +     +    P
Sbjct: 127 LYNIC-SYLGLCGAGVQSGG--------------------FAERVVINESHCYKVPEFVP 165

Query: 171 LSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVN 230
           L    L+       +  A+   + + G T  + GAG +GL  +    + G S I V +  
Sbjct: 166 LDVAALIQPLAVCWH--AISVCDFKAGSTALIIGAGPIGLGTILALNAAGCSDIAVSEPA 223

Query: 231 DQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTG 278
             +++ +   GA  F +P     +      + +     G D+TFDC+G
Sbjct: 224 KVRRELAEKMGARVF-DPTAHAAKDSIDYLRSVAPGGDGYDYTFDCSG 270

>Skud_1.2 Chr1 (9513..10766) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 57/228 (25%), Positives = 87/228 (38%), Gaps = 38/228 (16%)

Query: 65  FPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGK--------------CKFCKSN 110
            P  +GHE AG V  VG GV ++KVGD VV+  T  C                C  CK  
Sbjct: 67  LPQAMGHEMAGTVLEVGPGVAHLKVGDKVVVEPTGTCRDRYRWPNSPNVSKEWCAACKKG 126

Query: 111 KTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAP 170
             N+C S     G GV   G                    F++  V+ +     +    P
Sbjct: 127 YYNIC-SYLGLCGAGVQSGG--------------------FAERVVMNESHCYKVPDFVP 165

Query: 171 LSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVN 230
           L    L+       +  A+     + G T  + GAG +GL  +    + G   I+V +  
Sbjct: 166 LDVAALIQPLAVCWH--AISVCEFKAGSTALIIGAGPIGLGTILALDAAGCKDIVVSEPA 223

Query: 231 DQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTG 278
             +++ +   GA  +       KE    +  + +  D G D+TFDC+G
Sbjct: 224 KLRRELAEKMGARVYDPTEHAAKESIDYLRSIAEGGD-GFDYTFDCSG 270

>YBR046C Chr2 complement(330507..331511) [1005 bp, 334 aa] {ON}
           ZTA1NADPH-dependent quinone reductase, GFP-tagged
           protein localizes to the cytoplasm and nucleus; has
           similarity to E. coli quinone oxidoreductase and to
           human zeta-crystallin
          Length = 334

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 66/245 (26%), Positives = 104/245 (42%), Gaps = 55/245 (22%)

Query: 37  HEVRVQVTHTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGDGVTNVKVGDHVVLL 96
            E+ ++  +T V + ++Y   G+ P    P +LG E +G V + G GVTN +VGD V   
Sbjct: 36  EELLIKNKYTGVNYIESYFRKGIYPCEK-PYVLGREASGTVVAKGKGVTNFEVGDQV--- 91

Query: 97  YTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTV 156
             A      F + +K +  G V        +P GT+                        
Sbjct: 92  --AYISNSTFAQYSKISSQGPVMK------LPKGTS------------------------ 119

Query: 157 VADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVFGA-GTVGLSVVQG 215
                    D    L +  LL   V T      +  +V++GD V +F A G VGL + Q 
Sbjct: 120 ---------DEELKLYAAGLLQ--VLTALSFTNEAYHVKKGDYVLLFAAAGGVGLILNQL 168

Query: 216 AKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDG-GLDFTF 274
            K +GA  I V    D+K + + ++GA   +N  K     E I+ +++  T+G G+D +F
Sbjct: 169 LKMKGAHTIAVAS-TDEKLKIAKEYGAEYLINASK-----EDILRQVLKFTNGKGVDASF 222

Query: 275 DCTGN 279
           D  G 
Sbjct: 223 DSVGK 227

>Smik_1.5 Chr1 (16385..17638) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 56/228 (24%), Positives = 87/228 (38%), Gaps = 38/228 (16%)

Query: 65  FPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGK--------------CKFCKSN 110
            P  +GHE AG V  VG GV ++KVGD VV+  T  C                C  CK  
Sbjct: 67  LPQAMGHEMAGTVLEVGPGVAHLKVGDKVVVEPTGTCRDRYRWPESPNVDKEWCAACKKG 126

Query: 111 KTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAP 170
             N+C S     G GV   G                    F++  V+ +     +    P
Sbjct: 127 YYNIC-SYLGLCGAGVQSGG--------------------FAERVVMNESHCYKVPDFVP 165

Query: 171 LSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVN 230
           L    L+       +  A+     + G T  + GAG +GL  +    + G   I+V +  
Sbjct: 166 LDVAALIQPLAVCWH--AISVCEFKAGSTALIIGAGPIGLGTILALNAAGCRDIVVSEPA 223

Query: 231 DQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTG 278
             +++ +   GA  +       +E    +  + +  D G D+TFDC+G
Sbjct: 224 KLRRELAEKMGARVYDPTEHAARESIDYLRSVAEGGD-GFDYTFDCSG 270

>KNAG0D00110 Chr4 (3538..4626) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 87/343 (25%), Positives = 137/343 (39%), Gaps = 37/343 (10%)

Query: 37  HEVRVQVTHTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGDGVTN-VKVGDHVVL 95
            ++ V++    VC +D +  SG   + A P I+GHE  G V  VG   T+ VKVGD V L
Sbjct: 34  RDIDVKIECCGVCGSDVHCASGHWGDIAKPLIVGHEIVGHVVKVGPNCTSGVKVGDRVGL 93

Query: 96  LYTA-ECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQY 154
              A  C KCK C +   + C +   T         +T + +        ++    ++ Y
Sbjct: 94  GAQALSCMKCKRCLNGNESYCPNAIQTY--------STPYED-------GYVSKGGYADY 138

Query: 155 TVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQ 214
             V +   V I  + P      L CG  T +   ++      G  VA+ G G +G   V 
Sbjct: 139 VRVHEQFTVPIPENIPSHLAAPLMCGGLTVFSPLLRNG-CGPGKKVAILGIGGIGHMGVL 197

Query: 215 GAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDGGLDFTF 274
            AK+ GA ++  +     KK+ +M  GA  F+      KE      K  D     LD   
Sbjct: 198 LAKAMGA-EVYAISRTSSKKEDAMKLGADHFIA----TKEEPDWHEKYFDE----LDLVV 248

Query: 275 DCTGNV-KVMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLITGRVWKGSAFGGIKGR 333
            C G+V  +  + L       G+               +PF L+ G     S  G ++  
Sbjct: 249 VCAGSVTDIDFNTLPKIIAVGGRIVSIAIPEMSEVLELKPFGLV-GVSIANSLLGSME-- 305

Query: 334 SEMGQLVTSYQKGDLKVDDFITHKRPFTE--INNAFEDLHHGD 374
            E+ QL+    + D+K+        P +E  ++  FE +  GD
Sbjct: 306 -ELKQLLKLVSEKDIKI---WVETVPISEKGVHEVFERMDKGD 344

>Smik_2.170 Chr2 complement(312211..313215) [1005 bp, 334 aa] {ON}
           YBR046C (REAL)
          Length = 334

 Score = 58.9 bits (141), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 63/249 (25%), Positives = 104/249 (41%), Gaps = 67/249 (26%)

Query: 38  EVRVQVTHTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGDGVTNVKVGDHVVLLY 97
           ++ ++  +T V + ++Y   G+ P    P ILG E AG + + G  VTN ++GD V    
Sbjct: 37  DLLIKNKYTGVNYIESYFRKGLYPCEK-PYILGREAAGTIVAKGKDVTNFEIGDKVA--- 92

Query: 98  TAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYT-- 155
                                                          ++  STF+QYT  
Sbjct: 93  -----------------------------------------------YISNSTFAQYTKF 105

Query: 156 ----VVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVF-GAGTVGL 210
                V  +S  T D    L +  LL     T      +  +V++GD + +F  AG VGL
Sbjct: 106 PSEGTVMKLSKETNDEELKLYAAGLLQA--LTALSFTNEAYHVRKGDYILLFAAAGGVGL 163

Query: 211 SVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDG-G 269
            + Q  + +GA  I V    D+K + + ++GA   +N  K     E I+ K++++T+G G
Sbjct: 164 ILNQLLRMKGAHAIAVAS-TDEKLEIAKEYGAEYLINSSK-----EDILKKVLEITNGEG 217

Query: 270 LDFTFDCTG 278
           +D +FD  G
Sbjct: 218 VDASFDSVG 226

>Kwal_56.22985 s56 complement(357501..358541) [1041 bp, 346 aa] {ON}
           YBR046C (ZTA1) - 1:1 [contig 184] FULL
          Length = 346

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 77/352 (21%), Positives = 131/352 (37%), Gaps = 84/352 (23%)

Query: 37  HEVRVQVTHTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGDGVTNVKVGDHVVLL 96
           +E+ ++  +T +   ++Y   G+ P    P +LG E +G V + G  V+   + D V   
Sbjct: 47  NEILIKNKYTGINFIESYFRKGIYPSQK-PYVLGREASGTVVAKGKAVSKFNLADKVA-- 103

Query: 97  YTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTV 156
                                                           ++   TF+QYT 
Sbjct: 104 ------------------------------------------------YLSAGTFAQYTK 115

Query: 157 VADVSLV------TIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVFGA-GTVG 209
           +A+   +      T D    L +  L    V T    A +   V++GD V ++ A G VG
Sbjct: 116 IAETGHISKLPENTTDKQLELYAASL--VQVLTALTFAKEAYTVKKGDFVLLYAAAGGVG 173

Query: 210 LSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDG- 268
           L+  Q  K  GA  I V    D+K Q + +FGA   VN  K     E ++++++++T G 
Sbjct: 174 LAFNQILKRLGAHTIAVAS-TDEKLQLAKEFGAEYLVNSSK-----EDVLARVLEITQGQ 227

Query: 269 GLDFTFDCTGNVKVMRDALEACHK-----GWGQSXXXXXXXXXXXXSTRPFQLITGRVWK 323
           G+D  +D  G        L A  +      +G +            S +  +++     +
Sbjct: 228 GVDVAYDSIGK-DTFETTLSALRRKGTFVSFGNASGPVPPIAISRLSPKNIKIL-----R 281

Query: 324 GSAFGGIKGRSEMG----QLVTSYQKGDLKVDDFITHKRPFTEINNAFEDLH 371
            + FG I  + E      +L+      + KV   IT   P  E   A E+L 
Sbjct: 282 PTLFGYIASQEEWAYYSEELIKLLHSEEFKV--LITKIYPLEEYRKATEELE 331

>KLLA0F00528g Chr6 complement(40081..41226) [1146 bp, 381 aa] {ON}
           similar to uniprot|P39713 Saccharomyces cerevisiae
           YAL061W putative polyol dehydrogenase
          Length = 381

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 70/270 (25%), Positives = 107/270 (39%), Gaps = 53/270 (19%)

Query: 35  KAHEVRVQVTHTAVCHTDAYTLSGVDPEGAFP--------------SILGHEGAGIVESV 80
           K  +V + +    +C TD + L  +D    FP                +GHE AG+V  V
Sbjct: 25  KPDDVLIDIVWCGICGTDLHEL--LDGPNFFPKDGETHEISGRGLPQAMGHEMAGVVSQV 82

Query: 81  GDGVTNVKVGDHVVLLYTAECGK----------CKFCKSNKTNLCGSVRATQGKGVMPDG 130
           G  VT  + GDHVV+  T  C            CK CK    N+C  +    G GV   G
Sbjct: 83  GSSVTKFQPGDHVVVEPTGTCQDRERYNTKGETCKACKRGMHNVCVHL-GLCGCGVQSGG 141

Query: 131 TTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVK 190
                               F++  V+ +     +    PL    L+       +  AVK
Sbjct: 142 --------------------FAEKVVIGEKHCFKVPSWIPLDVAALIQPLAVCWH--AVK 179

Query: 191 TANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLK 250
              V+EG +  + G G +GL ++   +  G + I+V +    ++  +   GA    NP+ 
Sbjct: 180 LGAVKEGQSALILGGGPIGLGIIMALQHFGCTDIVVSEPAKIRRDLAEKMGAI-VSNPM- 237

Query: 251 DLKEGETIVSKLIDMTDG--GLDFTFDCTG 278
           D K  E  +  L  ++    G DFTFDC+G
Sbjct: 238 DFKTNEENIKNLCSLSPNGEGYDFTFDCSG 267

>TPHA0H03100 Chr8 complement(736924..738102) [1179 bp, 392 aa] {ON}
           Anc_7.3 YAL060W
          Length = 392

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 73/286 (25%), Positives = 116/286 (40%), Gaps = 64/286 (22%)

Query: 38  EVRVQVTHTAVCHTD--AYTLSGV--DPEGA--------FPSILGHEGAGIVESVGDGVT 85
           E+ + V++  +C TD   YT   +   P+G          P  +GHE +G+VE VG G  
Sbjct: 28  ELIIAVSYCGICGTDLKEYTEGAIFFPPDGGHNEISGNGLPQAMGHEISGVVEKVGKGCK 87

Query: 86  NVKVGDHVVLLYTAECGK--------------CKFCKSNKTNLCGSVRATQGKGVMPDGT 131
             KVGDHVV+  T  C                C  C    TN+C  + A  G G+   G 
Sbjct: 88  TFKVGDHVVVEPTGTCKDRYRWPESQNANKPMCSACSIGMTNICAHL-ALCGAGLESGG- 145

Query: 132 TRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKT 191
                              F++  V+ +  +  I    PL    L+       +  AVK 
Sbjct: 146 -------------------FAERLVINEAHVHKIPDHMPLDIGALIQPISVCWH--AVKV 184

Query: 192 ANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGA-----TG-- 244
           A+ ++G +  + G G +GL  +   K  G   I++ +    +++++   GA     TG  
Sbjct: 185 AHYKKGGSALIIGGGPIGLGTILALKGFGCEYIVLSEPATIRREYAGKMGAKVYDPTGVP 244

Query: 245 FVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEAC 290
           F   +K L+E        +     G D+TFDC+G    +  A+E C
Sbjct: 245 FDESVKTLRE--------MGPNGDGFDYTFDCSGLPITLNAAIECC 282

>NDAI0H02950 Chr8 complement(718762..719853) [1092 bp, 363 aa] {ON} 
          Length = 363

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 85/342 (24%), Positives = 137/342 (40%), Gaps = 36/342 (10%)

Query: 37  HEVRVQVTHTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGDGVTNVKVGDHV-VL 95
           ++V V++    VC +D +T SG   E   P ++GHE  G V  +G     +KVGD V + 
Sbjct: 38  YDVEVKIECCGVCGSDIHTASGHWGETKKPLVVGHEIIGTVTQIGSQCNELKVGDRVGIG 97

Query: 96  LYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYT 155
                C +C  CKS+    C     T  K    DG    +N KG           ++ Y 
Sbjct: 98  AQVFSCLECDRCKSDNEPYCPKTVNTYRKDYT-DG----YNSKG----------GYADYI 142

Query: 156 VVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQG 215
            + +   V I  + P      L CG  T +   ++      G  V + G G +G   +  
Sbjct: 143 RLHEHFAVPIPENIPSHLAAPLMCGGVTAFSPLLRNG-CGPGKKVGIMGIGGIGHMGLIF 201

Query: 216 AKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDGGLDFTFD 275
           AK+ GA +   +  +  KK+ ++  GA  F+      KE     +K  D      D    
Sbjct: 202 AKAMGA-ETFAISRSSAKKEDAIKMGADHFIA----TKEEPDWATKYFDT----FDLIVV 252

Query: 276 CTGNV-KVMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLITGRVWKGSAFGGIKGRS 334
           C+ ++  +  + +    K  G+             + +PF LI G     SA GGI   +
Sbjct: 253 CSNSLTDIDFNVVPRTMKVGGKIVSICVPEQHEVMNLKPFGLI-GVSISNSALGGI---N 308

Query: 335 EMGQLVTSYQKGDLKVDDFITHKRPFTE--INNAFEDLHHGD 374
           E+ Q++    K +LK+        P +E  +   FE +  GD
Sbjct: 309 EIKQMLDLVSKKNLKI---WVETIPISEKGVKEVFERMEKGD 347

>KNAG0E04200 Chr5 complement(837232..838389) [1158 bp, 385 aa] {ON} 
          Length = 385

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 67/279 (24%), Positives = 109/279 (39%), Gaps = 54/279 (19%)

Query: 38  EVRVQVTHTAVCHTDAYTLSG------VDPE------GAFPSILGHEGAGIVESVGDGVT 85
           E+ V + +  +C TD + L+       +D E         P  +GHE AGIV +VG GV 
Sbjct: 28  ELLVDIVYCGICGTDLHELTDGPIFFPLDNERNEISGNGLPQAMGHEMAGIVTAVGSGVK 87

Query: 86  NVKVGDHVVLLYTAECGK--------------CKFCKSNKTNLCGSVRATQGKGVMPDGT 131
             +VGDHV +  T  C                C  C+    N C  +    G GV   G 
Sbjct: 88  KFQVGDHVAIEPTGTCRDRYRWPDAPDAKKPVCTSCQRGMYNCCDYL-GLIGNGVQSGG- 145

Query: 132 TRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKT 191
                              F++  VV +        + P     L+       +  A+  
Sbjct: 146 -------------------FAERIVVNESHCYKCPDNLPWEVAALIQPIAVCWH--AINI 184

Query: 192 ANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKD 251
           A  + G +V + G G +GL  +      G ++IIV +    ++ ++   GA  + +PL+ 
Sbjct: 185 AQFKPGSSVLILGGGPIGLGTILALNGHGCTEIIVSEPVKLRRDYAEKMGAVVY-DPLQ- 242

Query: 252 LKEGETIVSKLIDMTDG--GLDFTFDCTGNVKVMRDALE 288
               E  +  L  M  G  G D+ FDC+G    ++ ++E
Sbjct: 243 -CSHEQSIPNLRKMAPGADGFDYCFDCSGTPATLKASIE 280

>NDAI0A06320 Chr1 (1438393..1439442) [1050 bp, 349 aa] {ON}
           Anc_3.253
          Length = 349

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 59/244 (24%), Positives = 101/244 (41%), Gaps = 56/244 (22%)

Query: 37  HEVRVQVTHTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGDGVTNVKVGDHVVLL 96
           +++ ++  +  V + ++Y   G+ P  A P+ILG E +G+V   G  + N ++GD V   
Sbjct: 52  NDIIIKNKYAGVNYIESYFRKGIYP-CALPAILGREASGVVVDKGTNIKNFEIGDKVA-- 108

Query: 97  YTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTV 156
           Y   C   +F K + + +           +  D T     L    +L  +   +F     
Sbjct: 109 YIGNCSMAQFTKIDNSMIM---------KLSSDSTNEDLKLYAAGILQGLTALSF----- 154

Query: 157 VADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVF-GAGTVGLSVVQG 215
                                   VT  Y        V++GD + V+  AG  GL   Q 
Sbjct: 155 ------------------------VTEAY-------EVKKGDYILVYAAAGGAGLIFDQL 183

Query: 216 AKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDG-GLDFTF 274
            K+RGA  +I V  +D+K Q + + GA   +N   D      I++K++++TD  G+   F
Sbjct: 184 IKARGAH-VIAVCSSDEKLQLAKENGAEYLINSKTD-----DILTKVMEITDNKGVQAAF 237

Query: 275 DCTG 278
           D  G
Sbjct: 238 DSVG 241

>KAFR0C00580 Chr3 (113544..114548) [1005 bp, 334 aa] {ON} Anc_3.253
           YBR046C
          Length = 334

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 61/247 (24%), Positives = 99/247 (40%), Gaps = 63/247 (25%)

Query: 38  EVRVQVTHTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGDGVTNVKVGDHVVLLY 97
           EV ++  +T V + ++Y   G+ P    P +LG E  G V ++G  V ++KVGD V    
Sbjct: 37  EVIIKNRYTGVNYIESYFRKGIYP-AELPYVLGREAVGTVVAIGKSVRDLKVGDKV---- 91

Query: 98  TAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVV 157
                                                          ++  +TF+Q+T V
Sbjct: 92  ----------------------------------------------SYIAGATFAQFTKV 105

Query: 158 ADVSLVTIDP-SAPLSSVCLLGCGVTTGYGAAV---KTANVQEGDTVAVFGA-GTVGLSV 212
            + + V   P +     + L   G+  G  A     +  +V++GD V ++ A G VGL  
Sbjct: 106 PNSTHVFKLPDTTSTEQLKLYAAGMIQGLTALTFVNEAYDVKKGDYVLLYAAAGGVGLIF 165

Query: 213 VQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDG-GLD 271
            Q  + RGA  I V   N +K   + + GA   +N  +D      I+ K+  +T G G+D
Sbjct: 166 NQLLRMRGAHTIAVASTN-EKLSLAKENGAEFLINSKED-----NILEKVQQITKGNGVD 219

Query: 272 FTFDCTG 278
             FD  G
Sbjct: 220 VAFDSVG 226

>KAFR0I00170 Chr9 (34519..35664) [1146 bp, 381 aa] {ON} Anc_7.3
           YAL060W
          Length = 381

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 80/294 (27%), Positives = 120/294 (40%), Gaps = 55/294 (18%)

Query: 22  KPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYT-LSGV-----DPEG------AFPSIL 69
           K L   KI VD     E+ + V++  +C +D +  L G      D E       + P  +
Sbjct: 16  KDLPEPKINVD----DEIIIDVSYCGICGSDLHEYLEGPIFMPKDNETNEISNLSLPLAM 71

Query: 70  GHEGAGIVESVGDGVTNVKVGDHVVLLYTAECG--------------KCKFCKSNKTNLC 115
           GHE +GIV  VG  VT VK GD VV+  ++ C               KC  C     N C
Sbjct: 72  GHEMSGIVREVGKNVTKVKKGDKVVVEASSACSDVHRFATGKHYGEEKCPNCARGYDNCC 131

Query: 116 GSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVC 175
                T G G +  G                    F++  +V +  +V I    PL    
Sbjct: 132 AYAGFT-GLGFIGGG--------------------FAEQILVGEQHIVRIPDEIPLDVAA 170

Query: 176 LLGCGVTTGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQ 235
           L+     T + A  K     +G T  + G+G +GL+++   K+ GASKI+V +V   +++
Sbjct: 171 LVEPLSVTWHAA--KVGKFVKGSTALILGSGPIGLAMILVLKALGASKIVVSEVAQVRRK 228

Query: 236 WSMDFGATGFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEA 289
            +       F +P    K     +  L +  D G DF FDC+G    M  A+ A
Sbjct: 229 LAEKMKVEVF-DPSVHGKNTSNELRLLTENKD-GFDFAFDCSGLEVTMNTAIHA 280

>SAKL0D03872g Chr4 (316127..317173) [1047 bp, 348 aa] {ON} highly
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046C
          Length = 348

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 83/347 (23%), Positives = 138/347 (39%), Gaps = 72/347 (20%)

Query: 36  AHEVRVQVTHTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGDGVTNVKVGDHVVL 95
           A EV ++   + +   ++Y   G+ P    P +LG E AG V + GD V+   +GD V  
Sbjct: 49  ADEVLIKNKFSGINFIESYFRKGLYPSQK-PYVLGREAAGTVVAKGDAVSKFNIGDKVAY 107

Query: 96  LYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYT 155
           L         F +  K    G +        +P  TT       E L  + G       +
Sbjct: 108 L-----SPGTFAQYTKYPENGKILK------LPKETT------DEQLKFYAG-------S 143

Query: 156 VVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVFGA-GTVGLSVVQ 214
           +V  ++ +T                V   Y       +V++GD + ++ A G  GL   Q
Sbjct: 144 LVQGLTALTF---------------VNDAY-------DVKKGDYILLYAAAGGAGLIFNQ 181

Query: 215 GAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDG-GLDFT 273
             K +GA  I V    D+K + + ++GA   +N  KD       +SK++++T+G G+   
Sbjct: 182 LLKLKGAHTIAVAS-TDEKLKLAREYGAEYVINSSKD-----DTLSKVLEITNGEGVAAA 235

Query: 274 FDCTGNVKVMRDALEACHK-----GWGQSXXXXXXXXXXXXSTRPFQLITGRVWKGSAFG 328
           FD  G       +L+A  +      +G +            S++  +++  +V     FG
Sbjct: 236 FDSIGK-DTFEISLQAIKRKGTLVSFGNASGPVPPFSINRLSSKNLKVLRPQV-----FG 289

Query: 329 GIKGRSE----MGQLVTSYQKGDLKVDDFITHKRPFTEINNAFEDLH 371
            I    E      +L+     GDLKV  FI+   P +E   A E L 
Sbjct: 290 YITTSEEWNHYASKLIELLSSGDLKV--FISGTYPLSEYRAATEALE 334

>NDAI0G04880 Chr7 complement(1175518..1176603) [1086 bp, 361 aa]
           {ON} 
          Length = 361

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 85/343 (24%), Positives = 138/343 (40%), Gaps = 37/343 (10%)

Query: 37  HEVRVQVTHTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGDGVTN-VKVGDHV-V 94
           H++ +++    VC +D +T SG   +   P ++GHE  G V  +GD  T+ +K+GD V V
Sbjct: 35  HDIDIKIECCGVCGSDIHTASGHWGDITKPLVVGHEIIGTVVRLGDKCTSGLKLGDRVGV 94

Query: 95  LLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQY 154
                 C +C  CKS+    C     T       DG    +N KG           ++ Y
Sbjct: 95  GAQAFSCLECGRCKSDNEPYCTKSVWTYSTN-YEDG----YNSKG----------GYADY 139

Query: 155 TVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQ 214
             + +   + I  + P      L CG  T +   ++      G  V + G G +G   + 
Sbjct: 140 IRLHEHFAIPIPENIPSHLAAPLMCGGITAFSPLLRNG-CGRGKKVGIMGIGGIGHMALI 198

Query: 215 GAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDGGLDFTF 274
            AK+ GA ++  +     KK  S+  GA  F+      KE     +K  D      D   
Sbjct: 199 FAKAMGA-EVYAISRTSAKKDDSIKMGADHFIA----TKEEPDWATKYFDT----FDLIV 249

Query: 275 DCTGNV-KVMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLITGRVWKGSAFGGIKGR 333
            C+ ++  +  D +    K  G+             + +PF L+ G     SA GGI   
Sbjct: 250 VCSNSLTDINFDVVPRTMKVGGKIVSICAPEQNEVINLKPFGLL-GVSISNSALGGI--- 305

Query: 334 SEMGQLVTSYQKGDLKVDDFITHKRPFTE--INNAFEDLHHGD 374
           +E+ Q++    K DLK+        P +E  +   FE +  GD
Sbjct: 306 NEIKQMLDLVSKKDLKI---WVETVPISEKGVKEVFERMDMGD 345

>NDAI0H02060 Chr8 complement(502872..504071) [1200 bp, 399 aa] {ON} 
          Length = 399

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 55/238 (23%), Positives = 95/238 (39%), Gaps = 38/238 (15%)

Query: 65  FPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECG--------------KCKFCKSN 110
            P  +GHE AGIV  +G  V   +VGD VV+  T  C               +C  CK  
Sbjct: 67  LPQAMGHEIAGIVSEIGPKVKKFQVGDRVVVEPTGTCKDRYRWPDAPNANQEECAACKKG 126

Query: 111 KTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAP 170
             N+C ++    G GV   G                    F++  V+ +     I     
Sbjct: 127 LYNICSNL-GLVGCGVQSGG--------------------FAERMVMNEAKCYKIPEHLT 165

Query: 171 LSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVN 230
           +    L+     + +  AV+ +  + G +V + G G +GL  +      G ++++V +  
Sbjct: 166 MDVAALIQPIAVSWH--AVRVSKFKPGSSVLIIGGGPIGLGTILALNGHGVTEVVVSEPA 223

Query: 231 DQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALE 288
             ++  +   GA  +    +D  E    +  +    D G D+TFDC+GN   ++ A+E
Sbjct: 224 KIRRDLAEKMGAVVYDPMTRDHDESIKYLRSIAPGGD-GFDYTFDCSGNPATLKAAIE 280

>Kwal_47.17532 s47 (444594..445715) [1122 bp, 373 aa] {ON} YMR318C
           (ADH6) - NADPH-dependent alcohol dehydrogenase [contig
           207] FULL
          Length = 373

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 59/239 (24%), Positives = 92/239 (38%), Gaps = 30/239 (12%)

Query: 22  KPLTVEKIIVDAPKA---HEVRVQVTHTAVCHTDAYTLS---GVDPEGAFPS-------I 68
           K     K+    PKA   H+V ++V    +C ++ + L    G  P     S       +
Sbjct: 16  KDWATPKLTSFEPKAFGPHDVDIEVECCGICASELFALKNEWGHAPLACLSSKYGPKTQV 75

Query: 69  LGHEGAGIVESVGDGVTNVKVGDHVVLLYTAE-CGKCKFCKSNKTNLCGSVRATQGKGVM 127
           +GHE  G V +VG  V+   VGD V L   A  C +C  C S     C +  +T  K   
Sbjct: 76  VGHEVVGKVVAVGPQVSLCNVGDRVGLGAQASACMQCSRCNSGNEQYCPNAISTYCK-PY 134

Query: 128 PDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGA 187
           PDG              ++    ++ +    +     I P  P   V  L CG  T +  
Sbjct: 135 PDG--------------YVSQGGYASHVRAHEQFCFPIPPEIPSELVAPLQCGGLTVFSP 180

Query: 188 AVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFV 246
             +    +    VAV G G +G   +  A++ GA ++        K+  ++  GA  FV
Sbjct: 181 IKRNLQGKHDPKVAVIGIGGLGHMAIMIARALGA-EVYAFSRGHSKRDDALKMGAHHFV 238

>Skud_2.162 Chr2 complement(299642..300646) [1005 bp, 334 aa] {ON}
           YBR046C (REAL)
          Length = 334

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 57/243 (23%), Positives = 101/243 (41%), Gaps = 55/243 (22%)

Query: 38  EVRVQVTHTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGDGVTNVKVGDHVVLLY 97
           ++ ++  +T V + ++Y   G+ P    P +LG E  G++ + G  VTN + GD V    
Sbjct: 37  DILIKNKYTGVNYIESYFRKGLYPCEK-PYVLGREATGVIVAKGKDVTNFETGDQV---- 91

Query: 98  TAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVV 157
            A      F +  K    G++        +P GT+                         
Sbjct: 92  -AYISNSTFAQYTKFPSEGTIMK------LPSGTS------------------------- 119

Query: 158 ADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVF-GAGTVGLSVVQGA 216
                   D    L +  LL     T      +  +V++GD + V+  AG VGL + Q  
Sbjct: 120 --------DEKMKLYAAGLLQA--LTALSFTNEAYHVKKGDYILVYAAAGGVGLILNQLL 169

Query: 217 KSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDG-GLDFTFD 275
           + + A  I V     +K + + D+GA   ++  K     E I+++++++TDG G+D +FD
Sbjct: 170 RMKDAHAIAVASTY-EKLETAKDYGAEFLIDSSK-----EDILTRVLEITDGKGVDASFD 223

Query: 276 CTG 278
             G
Sbjct: 224 SVG 226

>KLTH0C07854g Chr3 (673945..675021) [1077 bp, 358 aa] {ON} similar
           to uniprot|P38230 Saccharomyces cerevisiae YBR046C ZTA1
           Zeta-crystallin homolog
          Length = 358

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 67/349 (19%), Positives = 126/349 (36%), Gaps = 78/349 (22%)

Query: 37  HEVRVQVTHTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGDGVTNVKVGDHVVLL 96
           +E+ ++  +  + + ++Y   G+ P    P +LG E +G+V + GD VT   V D V   
Sbjct: 59  NEILIKNKYAGINYIESYFRKGIYPSKK-PYVLGREASGVVVAKGDAVTKFDVNDKVA-- 115

Query: 97  YTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTV 156
                                                           ++  +TF+QYT 
Sbjct: 116 ------------------------------------------------YLSSNTFAQYTK 127

Query: 157 VADVSLVTIDPSAPLSSVCLLGCG----VTTGYGAAVKTANVQEGDTVAVFGAGTVGLSV 212
           +++   V+  P         L  G      T      +   V++GD + ++ A       
Sbjct: 128 ISEAGTVSKVPQDSTDEQLKLYAGSLVQALTSLAFVREAYPVKKGDYILLYAAAGGAGLA 187

Query: 213 VQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDG-GLD 271
                 +  +  I V   D+K Q + ++GA   +N  KD      ++++++++T+G G++
Sbjct: 188 FNQFLKKAGAHTIAVASTDEKLQLAKEYGAEFLINSSKD-----DVLARVLEITNGQGVE 242

Query: 272 FTFDCTGNVKVMRDALEACHK-----GWGQSXXXXXXXXXXXXSTRPFQLITGRVWKGSA 326
             FD  G       +L+A  +      +G +            + +  +L+     + S 
Sbjct: 243 AAFDSVGK-DTFETSLKALKRKGTLVSFGNASGPVPPVAINILTPKNIKLL-----RPSL 296

Query: 327 FGGIKGRSEM----GQLVTSYQKGDLKVDDFITHKRPFTEINNAFEDLH 371
           FG I    E      +L      G LK+   I+   P  E N A E L 
Sbjct: 297 FGYIATHEEWESYSSELFDLLHSGALKI--LISKTYPLEEYNQAAEQLE 343

>NCAS0D01220 Chr4 (223821..224909) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 68/157 (43%), Gaps = 17/157 (10%)

Query: 37  HEVRVQVTHTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGDGVTN-VKVGDHV-V 94
           H+++++V    VC +D +  SG       P ++GHE  G V  VGD   N +KVGD V V
Sbjct: 34  HDIQIKVECCGVCGSDIHAASGHWGNIPTPLVVGHEIVGRVVKVGDRCDNGLKVGDRVGV 93

Query: 95  LLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQY 154
                 C +C  CK++  + C    AT G G  PDG              ++    ++ +
Sbjct: 94  GAQVFSCLECNRCKTDNESYCPKWVATYG-GEYPDG--------------YISKGGYADF 138

Query: 155 TVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKT 191
             V +  +V I  + P      L CG  T +   ++ 
Sbjct: 139 VRVHEHFVVPIPENIPSEYAAPLLCGGLTVFSPLLRN 175

>KLLA0A10549g Chr1 (921022..922083) [1062 bp, 353 aa] {ON} highly
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046C
          Length = 353

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 79/355 (22%), Positives = 129/355 (36%), Gaps = 88/355 (24%)

Query: 36  AHEVRVQVTHTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGDGVTNVKVGDHVVL 95
           A ++ ++  +  +   + Y   G+ P    P +LG E  G V + GD V    VGD V  
Sbjct: 54  ATDLLIKNKYAGINFIEVYFRKGIYPSEK-PYVLGREAVGEVVAKGDQVDKYNVGDKVA- 111

Query: 96  LYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYT 155
                                                            ++  STF+Q+T
Sbjct: 112 -------------------------------------------------YLSASTFAQFT 122

Query: 156 VVA-DVSLVTIDPSAPLSSVCLLGCGVTTGYGAAV---KTANVQEGDTVAVFGA-GTVGL 210
               +  L+ +          ++   +  G        +  NVQ+GD + V+ A G VGL
Sbjct: 123 KYPQNGHLIKLPKDISAEKEKIIAGSLVQGLTPLTFIDEAYNVQKGDFILVYAAAGGVGL 182

Query: 211 SVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDG-G 269
              Q  K+RGA + I V   D+K Q + ++GA   +N  KD      IV K+ + T+G G
Sbjct: 183 IFDQLLKARGA-RTIAVASTDEKLQLAKEYGAEFLINSTKD-----DIVEKVKEFTNGEG 236

Query: 270 LDFTFDCTGNVKVMRDALEAC-----HKG----WGQSXXXXXXXXXXXXSTRPFQLITGR 320
           +   FD  G     +D  E        KG    +G +            S +  +L+  +
Sbjct: 237 VAAAFDSIG-----KDTFETTLQVVKRKGTIVSFGNASGAVPPFSINRLSPKNLKLVRPQ 291

Query: 321 VWKGSAFGGIKGRSEM----GQLVTSYQKGDLKVDDFITHKRPFTEINNAFEDLH 371
           +     F  +   SE      +L+     G+LK+   I+   P  +   A EDL 
Sbjct: 292 L-----FAYVADPSEWEHYSSELIRLIDSGELKIT--ISKVYPLKDYKEATEDLE 339

>NDAI0A08470 Chr1 (1954035..1955126) [1092 bp, 363 aa] {ON} 
          Length = 363

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 93/383 (24%), Positives = 153/383 (39%), Gaps = 45/383 (11%)

Query: 1   MTSATAGKPIECVAAVAYEAGK-PLTVEKIIVDAPKA---HEVRVQVTHTAVCHTDAYTL 56
           MTS+T+    + +A + ++  K P  VE      PK    +++ +++    VC +D +  
Sbjct: 1   MTSSTSPAKFQGIAVLDHKDWKNPKKVEF----EPKPFYPNDIDIKIECCGVCGSDIHAA 56

Query: 57  SGVDPEGAFPSILGHEGAGIVESVGDGVTN-VKVGDHV-VLLYTAECGKCKFCKSNKTNL 114
           +G   +   P ++GHE  G V  +G+   + +K+GD V V      C  C+ CKSN    
Sbjct: 57  AGHWGDLEKPLVVGHEVIGTVVRLGENCNSGLKLGDRVGVGAQVFSCLDCERCKSNNEPY 116

Query: 115 CGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSV 174
           C S   T G+    DG    ++ KG           ++ Y  V +   V I  + P    
Sbjct: 117 CPSFVTTYGQSYK-DG----YSSKG----------GYADYIRVHEHFAVPIPENIPSHLA 161

Query: 175 CLLGCGVTTGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKK 234
             L CG  T +   ++           V   G   + ++  AK+ GA ++  +     KK
Sbjct: 162 APLMCGGITVFSPLLRNGCGPGKKVGIVGIGGIGHMGLIF-AKAMGA-EVYAISRTSAKK 219

Query: 235 QWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNV-KVMRDALEACHKG 293
           + +M  GA  F+      KE     +K  D      D    C  ++  V  + +    K 
Sbjct: 220 EDAMKLGADHFIA----TKEEPDWGTKYFDT----FDLIVVCANSLTDVDFNVVPKAMKV 271

Query: 294 WGQSXXXXXXXXXXXXSTRPFQLITGRVWKGSAFGGIKGRSEMGQLVTSYQKGDLKVDDF 353
            G              + +PF L+ G     SA GG+K   E+  LV+   K +LK+   
Sbjct: 272 GGNIVSICVPEQNEVLNLKPFGLL-GVSISNSALGGVKEIKELLDLVS---KNNLKI--- 324

Query: 354 ITHKRPFTE--INNAFEDLHHGD 374
                P  E  +  AFE +  GD
Sbjct: 325 WVETLPIGEEGVKQAFERMDKGD 347

>KAFR0A08730 Chr1 complement(1747657..1748739) [1083 bp, 360 aa]
           {ON} 
          Length = 360

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 67/247 (27%), Positives = 104/247 (42%), Gaps = 27/247 (10%)

Query: 37  HEVRVQVTHTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGDGVTN-VKVGDHV-V 94
           +++ +++    VC +D +  SG   +   P ++GHE  G V  VG   T+ +KVGD V V
Sbjct: 34  NDIDIKIEACGVCGSDVHMASGNWGDVKKPLVVGHEIVGTVVKVGSKCTSGMKVGDRVGV 93

Query: 95  LLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQY 154
                 C  C  C ++    C +V  T G    PDG    +N KG           ++ Y
Sbjct: 94  GAQVHSCLTCDRCNNDNEQYCPNVVFTYGFD-YPDG----YNGKG----------GYANY 138

Query: 155 TVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQ 214
             V +   V I  + P      L CG  T Y   ++      G  V + G G +G   + 
Sbjct: 139 IRVHEHFAVPIPENIPTHLAAPLLCGGITVYSPLLRNG-CGPGKKVGILGIGGIGHMGII 197

Query: 215 GAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDGGLDFTF 274
            AKS GA ++  +  +D KK+ +   GA  F+    +   G+    K  D     LD   
Sbjct: 198 FAKSMGA-EVYAISRSDAKKEDAFKLGADHFIATKDEPDWGK----KYFDT----LDLIV 248

Query: 275 DCTGNVK 281
            C G++K
Sbjct: 249 ICAGSLK 255

>NCAS0C03020 Chr3 complement(593785..594873) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 91/357 (25%), Positives = 141/357 (39%), Gaps = 43/357 (12%)

Query: 37  HEVRVQVTHTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGDGVTN-VKVGDHV-V 94
           H++ ++V    VC +D +  SG   +   P ++GHE  G V  +G+   + +K+GD V V
Sbjct: 36  HDIEIKVECCGVCGSDIHAASGNWGDLTKPLVVGHEIIGTVVRLGENCNSGLKLGDRVGV 95

Query: 95  LLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQY 154
                 C  C+ CK++    C     T G+   PDG    ++ KG           ++ Y
Sbjct: 96  GAQVFSCLDCERCKNDNEPYCEGFVTTYGQD-YPDG----YSSKG----------GYADY 140

Query: 155 TVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKT--ANVQEGDTVAVFGAGTVGLSV 212
             V +   V I  + P      L CG  T Y   V+      ++   V + G G  GL  
Sbjct: 141 FRVHEHFAVPIPENIPSHLAAPLMCGGLTVYSPLVRNGCGPNKKVGIVGIGGIGHQGLLF 200

Query: 213 VQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDGGLDF 272
              AK+ GA ++  +     KK+ +M  GA  F+      KE     +K  D      D 
Sbjct: 201 ---AKAMGA-EVYAISRTSAKKEDAMKLGADHFIA----TKEEPDWGTKYFDT----FDL 248

Query: 273 TFDCTGNV-KVMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLITGRVWKGSAFGGIK 331
              C  ++  V  + +    K  G              S +PF L  G     SA G I 
Sbjct: 249 IVVCASSLTDVDFNTVPNTMKIGGSIVSISVPEQNETLSLKPFGL-KGVSISNSALGSI- 306

Query: 332 GRSEMGQLVTSYQKGDLKVDDFITHKRPFTE--INNAFEDLHHGDCLR--TVLDLAN 384
             SEM  L+    + ++K+        P  E  +  AFE +  GDC    T++D  N
Sbjct: 307 --SEMRDLLKLVSENNIKL---WVETIPIGEKGVKEAFERMDKGDCRYRFTLVDYDN 358

>KLLA0E19889g Chr5 (1770061..1771161) [1101 bp, 366 aa] {ON} similar
           to uniprot|Q04894 Saccharomyces cerevisiae YMR318C ADH6
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis or in aldehyde tolerance
          Length = 366

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 73/175 (41%), Gaps = 18/175 (10%)

Query: 15  AVAYEAGKPLTVEKIIVDAPK--AHEVRVQVTHTAVCHTDAYTLSGVDPEGAFPSILGHE 72
           AV     K L+ EK++  A +    +V +++    VC +D +   G   E   P ++GHE
Sbjct: 11  AVVDSHKKWLSPEKVVYPAKQFNPRDVDIEIEACGVCGSDVHCAKGNWGEMKLPLVVGHE 70

Query: 73  GAGIVESVGDGV-TNVKVGDHV-VLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDG 130
             G V  +GD   T +KVGD V V    + C  C  C ++    C     T  +    DG
Sbjct: 71  IIGKVVRLGDKCDTGLKVGDRVGVGAQVSACLDCNRCNNDNEQYCPKFVTTYSQPYFEDG 130

Query: 131 TTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGY 185
                         ++G   ++ +  V +  ++ I  S   ++V  L CG  T Y
Sbjct: 131 --------------YVGQGGYASHIRVHEHFVIPIPESLETNNVAPLLCGGATVY 171

>CAGL0M14047g Chr13 complement(1386775..1387854) [1080 bp, 359 aa]
           {ON} highly similar to uniprot|Q04894 Saccharomyces
           cerevisiae YMR318c or uniprot|P25377 Saccharomyces
           cerevisiae YCR105w
          Length = 359

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 81/344 (23%), Positives = 135/344 (39%), Gaps = 39/344 (11%)

Query: 37  HEVRVQVTHTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGDGV-TNVKVGDHV-V 94
           ++V +++    VC +D +  +G   +   P ++GHE  G V  VG    T +K+GD V V
Sbjct: 33  NDVDIKIEACGVCGSDIHCAAGNWGQKQTPLVVGHEIIGKVVKVGPKCKTGLKIGDRVGV 92

Query: 95  LLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLH-FMGCSTFSQ 153
                 C +C+ CK++    C                 RF     +P    ++    ++ 
Sbjct: 93  GAQVFSCLECERCKNDNEPYCA----------------RFVTTYSQPYEDGYVSQGGYAN 136

Query: 154 YTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVFGAGTVGLSVV 213
           Y  V +   V I  + P      L CG  T Y   ++      G  V + G G +G   +
Sbjct: 137 YVRVHEHFAVPIPENIPSEYAAPLLCGGLTVYSPLLRNG-CGPGKKVGILGIGGIGHMGI 195

Query: 214 QGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDGGLDFT 273
             AK+ GA ++  +  ++ KK+ S+  GA  ++      KE     +K  D      D  
Sbjct: 196 LFAKAMGA-EVYAISRSNAKKEDSLKLGADHYIA----TKEEPDWGTKYFDT----FDLI 246

Query: 274 FDCTGNV-KVMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLITGRVWKGSAFGGIKG 332
             C  ++  V  D +    K  G+             + +PF LI G     S  G I  
Sbjct: 247 VVCASSLTDVDFDVMPKAMKVGGRIVSISVPEQDEVLTMKPFGLI-GVSIANSILGSI-- 303

Query: 333 RSEMGQLVTSYQKGDLKVDDFITHKRPFTE--INNAFEDLHHGD 374
            +EM QL+    + ++K+        P  E  +  AFE +  GD
Sbjct: 304 -AEMKQLLKLVSENNIKI---WVETLPVGEAGVKEAFERMDKGD 343

>KLTH0E07964g Chr5 (735214..736338) [1125 bp, 374 aa] {ON} similar
           to uniprot|P25377 Saccharomyces cerevisiae YCR105W ADH7
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis
          Length = 374

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 50/221 (22%), Positives = 87/221 (39%), Gaps = 27/221 (12%)

Query: 37  HEVRVQVTHTAVCHTDAYTLSG---VDPEGAFPS-------ILGHEGAGIVESVGDGVTN 86
            +V ++V    +C ++ + L      +P     S       ++GHE  G V +VG  V+ 
Sbjct: 34  RDVDIEVECCGICASELFALKNDWTHEPLACLSSKYGPKTQVVGHEVVGKVVAVGPEVSL 93

Query: 87  VKVGDHVVL-LYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHF 145
            KVGD V L    + C +C  C+S+    C     T      PDG              +
Sbjct: 94  CKVGDRVGLGAQASACMQCSRCQSSNEQYCAQSIGTYCNP-YPDG--------------Y 138

Query: 146 MGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVFGA 205
           +    ++ +    +     I P  P   V  L CG  T +    +    ++   VA+ G 
Sbjct: 139 VSQGGYASHVRAHEQFCFPIPPEIPSELVAPLQCGGLTVFSPIKRNIQGKKNPRVAIIGI 198

Query: 206 GTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFV 246
           G +G   +  +K+ GA ++  V     K+  ++  GA  F+
Sbjct: 199 GGLGHMAIMISKALGA-EVSAVSRGYSKRDDALKMGADHFI 238

>SAKL0H22088g Chr8 (1934171..1935301) [1131 bp, 376 aa] {ON} similar
           to uniprot|Q04894 Saccharomyces cerevisiae YMR318C ADH6
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis or in aldehyde tolerance
          Length = 376

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 51/223 (22%), Positives = 87/223 (39%), Gaps = 27/223 (12%)

Query: 35  KAHEVRVQVTHTAVCHTDAYTLSGV---DPEGAFPS-------ILGHEGAGIVESVGDGV 84
           +AH+V ++V    +C ++ ++L      +P     S       ++GHE  G V +VG  V
Sbjct: 34  EAHDVDIEVECCGICASELFSLKNEWKHEPLACLSSSYGPKSQVVGHEVVGKVVAVGSNV 93

Query: 85  TNVKVGDHVVLLYTA-ECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLL 143
           T   +GD V L   A  C KC  C S     C     T          +R+ +       
Sbjct: 94  TLCNIGDRVGLGAQAFSCMKCSRCNSGNEQYCPQAVGTY--------CSRYAD------- 138

Query: 144 HFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVF 203
            ++    ++ +    +     I    P   V  L CG  T Y    +     +   VA+ 
Sbjct: 139 GYISQGGYASHVRAHEQFCFPIPDDIPSELVAPLQCGGLTVYSPIKRNIEGVKDPKVAII 198

Query: 204 GAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFV 246
           G G +G   +  +K+ GA ++        KK+ ++  GA  F+
Sbjct: 199 GIGGLGHMAIMISKALGA-EVTAFSRGYSKKEDALKMGAHHFI 240

>CAGL0H06853g Chr8 complement(680184..681266) [1083 bp, 360 aa] {ON}
           highly similar to uniprot|Q04894 Saccharomyces
           cerevisiae YMR318c
          Length = 360

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 79/343 (23%), Positives = 133/343 (38%), Gaps = 37/343 (10%)

Query: 37  HEVRVQVTHTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGDGV-TNVKVGDHV-V 94
           H++ +++    VC +D +  +G   +   P ++GHE  G V  +G    T +KVGD V V
Sbjct: 34  HDIDIKIDACGVCGSDIHCAAGNWGKKQTPLVVGHEIIGKVVKIGPKCNTGLKVGDRVGV 93

Query: 95  LLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQY 154
                 C +C  CK++    C     T  +    DG              ++    ++ Y
Sbjct: 94  GAQVFSCLECDRCKNDNEPYCPKFVTTYSQP-YEDG--------------YVSQGGYANY 138

Query: 155 TVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQ 214
             V +   V I  + P      L CG  T Y   ++           V   G   + ++ 
Sbjct: 139 VRVHEHFAVKIPENIPDHLAAPLLCGGITVYSPLLRNGCGPGKKVGIVGIGGIGHMGLL- 197

Query: 215 GAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDGGLDFTF 274
            AK+ GA ++  +  ++ KK+ S+  GA  ++   ++   GE    K  D      D   
Sbjct: 198 FAKAMGA-EVYAISRSNAKKEDSLKLGADHYIATKEEPNWGE----KYFDT----FDLIV 248

Query: 275 DCTGNV-KVMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLITGRVWKGSAFGGIKGR 333
            C  ++  V  D +    K  G+             + +PF L+ G     SA G IK  
Sbjct: 249 VCASSLTDVDFDVMPKAMKVGGRIVSISIPDEDQTLTMKPFGLL-GVSIANSALGSIK-- 305

Query: 334 SEMGQLVTSYQKGDLKVDDFITHKRPFTE--INNAFEDLHHGD 374
            E+ QL+    + D+K+        P  E  +  AFE +  GD
Sbjct: 306 -EIEQLLKLVSEKDIKI---WVETLPVGEAGVKEAFERMDKGD 344

>ZYRO0A03366g Chr1 (271779..272828) [1050 bp, 349 aa] {ON} highly
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046C ZTA1 Zeta-crystallin homolog
          Length = 349

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 78/349 (22%), Positives = 131/349 (37%), Gaps = 77/349 (22%)

Query: 37  HEVRVQVTHTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGDGVTNVKVGDHVVLL 96
           +E+ V+  ++ +   ++Y   G+ P    P ILG E +G V + G+ V +  +GD V   
Sbjct: 52  NELLVKNKYSGINFIESYFRKGIYPSEK-PLILGRESSGTVVAKGNSVKDFDIGDKVA-- 108

Query: 97  YTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTV 156
                                                           ++  S F+QYT 
Sbjct: 109 ------------------------------------------------YLSGSAFAQYTK 120

Query: 157 V-ADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAV---KTANVQEGDTVAVFGA-GTVGLS 211
           V A   +V +   A   ++ L   G+     A     +  NV++GD +  + A G VGL 
Sbjct: 121 VDAAGKVVKLPKDANDETLKLYAAGLLQSLTALTFIDEAYNVKKGDFILNYAAAGGVGLI 180

Query: 212 VVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDG-GL 270
           + Q  K RGA  I VV   ++K + +   GA   +     +   E IV+++ ++T+  G+
Sbjct: 181 LDQLLKERGAHTIAVVS-TEEKLELAKKHGAEYGI-----ISSKEDIVTRVKEITNNQGV 234

Query: 271 DFTFDCTGNVKVMRDALEACHKGWGQS-XXXXXXXXXXXXSTRPFQLITG--RVWKGSAF 327
           D  FD  G     +D  E       +              S  P   +TG  ++ + S F
Sbjct: 235 DAAFDSIG-----KDTFETTISALKRKGTFVSYGNASGPVSPFPLTKLTGNIKILRPSLF 289

Query: 328 GGIKGRSEMG----QLVTSYQKGDLKVDDFITHKRPFTEINNAFEDLHH 372
             I    E      + V+    G LK++  I H  P +E   A + L  
Sbjct: 290 SYIATSEEWKHYSREFVSLVSSGKLKIN--IGHVFPLSEYPKATQLLEE 336

>Suva_4.279 Chr4 complement(495380..496384) [1005 bp, 334 aa] {ON}
           YBR046C (REAL)
          Length = 334

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 58/250 (23%), Positives = 97/250 (38%), Gaps = 67/250 (26%)

Query: 37  HEVRVQVTHTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGDGVTNVKVGDHVVLL 96
            ++ ++  +  V + ++Y   G+ P    P +LG E  G V + G  V N ++GD V   
Sbjct: 36  EDLLIKNKYAGVNYIESYFRKGLYP-CEKPYVLGREATGTVVAKGKDVNNFQIGDQVA-- 92

Query: 97  YTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTV 156
                                                           ++  STF+QYT 
Sbjct: 93  ------------------------------------------------YISHSTFAQYTK 104

Query: 157 ------VADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVFGA-GTVG 209
                 V  +   T D    L +  LL     T      +  +V++GD + V+ A G VG
Sbjct: 105 FSSKGNVMRLPKCTSDEKMKLYAAGLLQA--LTALSFTNEAYHVKKGDYILVYAAAGGVG 162

Query: 210 LSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDG- 268
           L + Q  K +GA  I V    D+K   +   GA   +N  K     E ++ +++++T+G 
Sbjct: 163 LILNQLLKMKGAHAIAVAS-TDEKLDIAKKNGAEYLINSSK-----EDVLERVLEITNGE 216

Query: 269 GLDFTFDCTG 278
           G+D +FD  G
Sbjct: 217 GVDSSFDSIG 226

>Suva_13.513 Chr13 complement(894394..895476) [1083 bp, 360 aa] {ON}
           YMR318C (REAL)
          Length = 360

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 77/346 (22%), Positives = 139/346 (40%), Gaps = 43/346 (12%)

Query: 37  HEVRVQVTHTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGDGVTN-VKVGDHVVL 95
           H+V +++    VC +D +  +G   +   P ++GHE  G V  +G    + ++VG  V +
Sbjct: 34  HDVDIKIEACGVCGSDIHCAAGNWGKKKMPLVVGHEIVGTVVKLGSKSNSGLQVGQRVGM 93

Query: 96  -LYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLH-FMGCSTFSQ 153
                 C +C  CKS+    C                T+F    G+P    ++    ++ 
Sbjct: 94  GAQVFSCLECDRCKSDNEPYC----------------TKFVTTYGQPYEDGYVSQGGYAD 137

Query: 154 YTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKT--ANVQEGDTVAVFGAGTVGLS 211
           Y  V +  +V I  + P      L CG  T Y   V+      ++   V   G G++G  
Sbjct: 138 YVRVHEHFVVPIPENIPSHLAAPLLCGGLTAYSPLVRNGCGPGKKVGIVGFGGIGSMGTL 197

Query: 212 VVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDGGLD 271
           +   AK+ GA +  V+  + +K++ +M  GA  ++  L++   GE    K  D      D
Sbjct: 198 I---AKAMGA-ETYVISRSSKKREDAMKMGADHYIATLEEENWGE----KYFDT----FD 245

Query: 272 FTFDCTGNVK-VMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLITGRVWKGSAFGGI 330
               C  ++  +  D +    K  G+             + +P+ L    +   SA G I
Sbjct: 246 LIVVCASSLTGIDFDVMPKAMKVGGRIVSISIPEQHEVLTLKPYGLKAVSI-SYSALGSI 304

Query: 331 KGRSEMGQLVTSYQKGDLKVDDFITHKRPFTE--INNAFEDLHHGD 374
           K   E+ QL+    + ++K+        P  E  ++ A E +  GD
Sbjct: 305 K---ELKQLLKLVSEKNVKI---WVETLPVGEAGVHEALERMEKGD 344

>Skud_13.494 Chr13 complement(884038..885120) [1083 bp, 360 aa] {ON}
           YMR318C (REAL)
          Length = 360

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 80/346 (23%), Positives = 139/346 (40%), Gaps = 43/346 (12%)

Query: 37  HEVRVQVTHTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVG-DGVTNVKVGDHV-V 94
           H+V +++    VC +D +  +G       P ++GHE  G V  +G    + +K+G  V V
Sbjct: 34  HDVDIKIEACGVCGSDVHCAAGHWGNKQLPLVVGHEIVGKVVKLGPKSNSGLKIGQRVGV 93

Query: 95  LLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLH-FMGCSTFSQ 153
                 C +C  CKS+    C                T+F     +P    ++    ++ 
Sbjct: 94  GAQVFSCLECNRCKSDNEPYC----------------TKFVTTYSQPYEDGYVSQGGYAN 137

Query: 154 YTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKT--ANVQEGDTVAVFGAGTVGLS 211
           Y  V +  +V +  + P      L CG  T Y   ++      ++   V   G G++G  
Sbjct: 138 YVRVHEHFVVPVPKNIPSHLAAPLLCGGLTVYSPLIRNGCGPGKKVGIVGFGGIGSMGSL 197

Query: 212 VVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDGGLD 271
           +   AK+ GA +  V+  + +KK+ +M  GA  ++  L++   GE    K  D  D  + 
Sbjct: 198 I---AKAMGA-ETYVISRSSKKKEDAMKMGADHYIATLEEEDWGE----KYFDTFDLIVV 249

Query: 272 FTFDCTG-NVKVMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLITGRVWKGSAFGGI 330
                TG +  VM  A+    K  G+             + +P+ L    +   SA G I
Sbjct: 250 CASSLTGIDFNVMPKAM----KVGGRIVSISIPEQHEMLTLKPYGLKAVSI-SYSALGSI 304

Query: 331 KGRSEMGQLVTSYQKGDLKVDDFITHKRPFTE--INNAFEDLHHGD 374
           K   E+ QL+    + D+K+        P  E  ++ A E +  GD
Sbjct: 305 K---ELKQLLKLVSENDIKI---WVETLPIGEAGVHEALERMEKGD 344

>ABL090W Chr2 (230699..231703) [1005 bp, 334 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR046C (ZTA1)
          Length = 334

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 66/280 (23%), Positives = 105/280 (37%), Gaps = 66/280 (23%)

Query: 9   PIECVAAVAYEAGKPLTV---EKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPEGAF 65
           P E    +  E G P  +   E   V   +  ++ ++  +  V   + Y  +G+ P    
Sbjct: 5   PTEQKVVLIRETGGPEVLRYEEDYPVPEVRGSDILIKNRYAGVNFIETYFRTGLYP-CEK 63

Query: 66  PSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRATQGKG 125
           P +LG E  G+V ++G  V   KVGD V             C S+ T             
Sbjct: 64  PYVLGREAVGVVAAIGADVRRFKVGDRVA------------CLSSGT------------- 98

Query: 126 VMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDP----SAPLSSVCLLGCGV 181
                                    F+QYT V++ S V   P       L +V       
Sbjct: 99  -------------------------FAQYTAVSEKSNVLKLPDDIQDGELQAVAGSLVNG 133

Query: 182 TTGYGAAVKTANVQEGDTVAVF-GAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDF 240
            T      +    Q G+ V V+  AG VG  ++Q   +R   ++I V   D+K Q +   
Sbjct: 134 LTALTLVDEAYKPQVGEIVLVYAAAGGVGQLLIQLLHARSV-RVIAVASTDEKLQIAKSR 192

Query: 241 GATGFVNPLKDLKEGETIVSKLIDMTDG-GLDFTFDCTGN 279
           GA   +N  +     E IV+K+++ TDG G+  ++D  G 
Sbjct: 193 GAEFLINSSR-----EDIVAKVLEFTDGEGVGASYDSVGK 227

>CAGL0H09944g Chr8 complement(971519..972520) [1002 bp, 333 aa] {ON}
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046c ZTA1
          Length = 333

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 78/339 (23%), Positives = 124/339 (36%), Gaps = 78/339 (23%)

Query: 38  EVRVQVTHTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGDGVTNVKVGDHVVLLY 97
           +V V+  +  V   +AY   G  P    P +LG E +G V  VG  V + K+GD V    
Sbjct: 36  DVLVKNKYAGVNFIEAYFRKGYYP-CELPYVLGREASGEVVQVGSEVKDFKIGDKVA--- 91

Query: 98  TAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVV 157
                                                          ++G STF+QYT  
Sbjct: 92  -----------------------------------------------YLGGSTFAQYTKK 104

Query: 158 A-DVSLVTIDPSAPLSSVCLLGCGVT---TGYGAAVKTANVQEGDTVAVFGA-GTVGLSV 212
           + +  ++ +  S P   + L G  +    T      +   V EGD + V+ A G VG  +
Sbjct: 105 STENHIMNLGQSCPDEDLKLYGSSLVQCLTAISFIDEAYKVMEGDYILVYAASGGVGSIL 164

Query: 213 VQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDG-GLD 271
            Q    R A  +I V  + +K   + + GA   +N  +D      I+ K++  T+G G+ 
Sbjct: 165 CQLISQRKA-HVIAVASSAEKLAMAKENGAEFLINYAED-----DILEKVMQYTNGKGVH 218

Query: 272 FTFDCTGNVKVMRDALEACHKG----WGQSXXXXXXXXXXXXSTRPFQLITGRVWKGSAF 327
             FD  G      D      KG    +G +            S +  +L+  +V+     
Sbjct: 219 AAFDSIGKDTFETDLAALRRKGTLVSFGNASGMVPPFAINKLSPKNLKLLRPQVY----- 273

Query: 328 GGIKGRSEMGQLVTSY----QKGDLKVDDFITHKRPFTE 362
           G +  RSE     + +    Q   LKVD  I+   P +E
Sbjct: 274 GYLGTRSEWDHYCSIFKHFVQSKSLKVD--ISGIYPLSE 310

>KLTH0B04972g Chr2 (408153..409235) [1083 bp, 360 aa] {ON} highly
           similar to uniprot|Q04894 Saccharomyces cerevisiae
           YMR318C ADH6 NADPH-dependent cinnamyl alcohol
           dehydrogenase family member with broad substrate
           specificity may be involved in fusel alcohol synthesis
           or in aldehyde tolerance
          Length = 360

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 75/343 (21%), Positives = 130/343 (37%), Gaps = 37/343 (10%)

Query: 37  HEVRVQVTHTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGDGV-TNVKVGDHV-V 94
           ++V V++    +C +D +  SG     + P ++GHE  G V  VG    T VKVGD V V
Sbjct: 34  YDVDVEIEACGICGSDTHCASGNWGPKSLPLVVGHEVIGRVVRVGPKCHTGVKVGDRVGV 93

Query: 95  LLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQY 154
               + C  C  C S+    C     T  +   PDG              ++    ++ +
Sbjct: 94  GAQVSSCLDCDRCNSDFEPYCAEFITTYSQP-YPDG--------------YVSQGGYASH 138

Query: 155 TVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQ 214
               +  ++ I    P      L CG  T +   +            V   G   + ++ 
Sbjct: 139 IRAHEHFVIPIPEKIPTHLAAPLLCGGITVFSPLINNDCGPNKKVGIVGIGGIGHMGLI- 197

Query: 215 GAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDGGLDFTF 274
            AK+ GA ++  +  +  KK+ +M  GA  F+   ++    +   S         LD   
Sbjct: 198 FAKALGA-EVYAISRSSAKKEDAMKLGADHFIATKEEPDWEKKYAST--------LDLVI 248

Query: 275 DCTGNV-KVMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLITGRVWKGSAFGGIKGR 333
            C  ++ ++  + L    +  G+             + +PFQL +G     S  G    R
Sbjct: 249 VCASSLTEINLEQLIKTMRIKGRIISICVPKETEELNLKPFQL-SGITIGNSQLG---SR 304

Query: 334 SEMGQLVTSYQKGDLKVDDFITHKRPFTE--INNAFEDLHHGD 374
            E+ QL+      DLK+        P +E  +++AF  +  GD
Sbjct: 305 KELIQLLQLVADKDLKI---WVETLPISEESVHDAFVRMEKGD 344

>KLLA0F00638g Chr6 (51849..52997) [1149 bp, 382 aa] {ON} weakly
           similar to uniprot|P53912 Saccharomyces cerevisiae or
           YLR460C uniprot|P54007 Saccharomyces cerevisiae YLR460C
           Hypothetical ORFs
          Length = 382

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 53/230 (23%), Positives = 90/230 (39%), Gaps = 52/230 (22%)

Query: 28  KIIVDAP-----KAHEVRVQVTHTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGD 82
           K++ D P     K +E+ ++  +  + H D  +        +FP + G E +GIV   G+
Sbjct: 60  KLLTDLPVPQKLKPYEILIKNKYIGLNHVDWKSKKYRFSIYSFPWVNGRESSGIVVRRGE 119

Query: 83  GVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPL 142
            V                          K  L G V            +T + +L+    
Sbjct: 120 KVDE-----------------------EKFPLGGEVFI---------ASTTYRDLR---- 143

Query: 143 LHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANV----QEGD 198
                 STF +YTV     +  +     L     +G  + T   A     NV    +E  
Sbjct: 144 -----TSTFQEYTVFDSRLVWRVPERIGLDFASGIGVSLVTAGAALASKRNVKVQPEEKK 198

Query: 199 TVAVFGAGT-VGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVN 247
           ++ ++G  T VG+ VVQ AKS G +KII +  + + +Q+ +  GAT  ++
Sbjct: 199 SIVIWGGSTGVGIFVVQLAKSLGFTKIITI-TSKKHEQYLLSLGATHIIH 247

>YMR318C Chr13 complement(911061..912143) [1083 bp, 360 aa] {ON}
           ADH6NADPH-dependent medium chain alcohol dehydrogenase
           with broad substrate specificity; member of the cinnamyl
           family of alcohol dehydrogenases; may be involved in
           fusel alcohol synthesis or in aldehyde tolerance
          Length = 360

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 76/349 (21%), Positives = 134/349 (38%), Gaps = 49/349 (14%)

Query: 37  HEVRVQVTHTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVG-DGVTNVKVGDHV-V 94
           H++ +++    VC +D +  +G       P ++GHE  G V  +G    + +KVG  V V
Sbjct: 34  HDIDIKIEACGVCGSDIHCAAGHWGNMKMPLVVGHEIVGKVVKLGPKSNSGLKVGQRVGV 93

Query: 95  LLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLH-FMGCSTFSQ 153
                 C +C  CK++    C                T+F     +P    ++    ++ 
Sbjct: 94  GAQVFSCLECDRCKNDNEPYC----------------TKFVTTYSQPYEDGYVSQGGYAN 137

Query: 154 YTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTA-----NVQEGDTVAVFGAGTV 208
           Y  V +  +V I  + P      L CG  T Y   V+        V       +   GT+
Sbjct: 138 YVRVHEHFVVPIPENIPSHLAAPLLCGGLTVYSPLVRNGCGPGKKVGIVGLGGIGSMGTL 197

Query: 209 GLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDG 268
            +S   GA++       V+  + +K++ +M  GA  ++  L++   GE    K  D    
Sbjct: 198 -ISKAMGAET------YVISRSSRKREDAMKMGADHYIATLEEGDWGE----KYFDT--- 243

Query: 269 GLDFTFDCTGNV-KVMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLITGRVWKGSAF 327
             D    C  ++  +  + +    K  G+             S +P+ L    +   SA 
Sbjct: 244 -FDLIVVCASSLTDIDFNIMPKAMKVGGRIVSISIPEQHEMLSLKPYGLKAVSI-SYSAL 301

Query: 328 GGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPFTE--INNAFEDLHHGD 374
           G IK   E+ QL+    + D+K+        P  E  ++ AFE +  GD
Sbjct: 302 GSIK---ELNQLLKLVSEKDIKI---WVETLPVGEAGVHEAFERMEKGD 344

>Smik_13.535 Chr13 complement(893727..894809) [1083 bp, 360 aa] {ON}
           YMR318C (REAL)
          Length = 360

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 77/349 (22%), Positives = 134/349 (38%), Gaps = 49/349 (14%)

Query: 37  HEVRVQVTHTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGDGVTN-VKVGDHV-V 94
           H+V +++    VC +D +  +G       P ++GHE  G V  +GD   + +KVG  V V
Sbjct: 34  HDVDIKIEACGVCGSDVHCAAGHWGNMKMPLVVGHEIVGKVVRLGDKSNSGLKVGQRVGV 93

Query: 95  LLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLH-FMGCSTFSQ 153
                 C +C  CKS+    C                T+F     +P    ++    ++ 
Sbjct: 94  GAQVFSCLECDRCKSDNEPYC----------------TKFVTTYSQPYEDGYISQGGYAN 137

Query: 154 YTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTA-----NVQEGDTVAVFGAGTV 208
           Y  V +  +V I  + P      L CG  T Y   V+        V       +   GT+
Sbjct: 138 YVRVHEHFIVPIPENVPSHLAAPLLCGGLTVYSPLVRNGCGPGKKVGIVGLGGIGSMGTL 197

Query: 209 GLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDG 268
            +S   GA++       V+  + +KK+ ++  GA  ++  L++   GE    K  D    
Sbjct: 198 -ISKAMGAET------YVISRSSKKKEDAIKMGADHYIATLEEGDWGE----KYFDT--- 243

Query: 269 GLDFTFDCTGNV-KVMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLITGRVWKGSAF 327
             D    C  ++  +  + +    K  G+             + +P+ L    +   SA 
Sbjct: 244 -FDLIVVCASSLTDIDFNIMPKAMKVGGRIVSISIPEQHEMLTLKPYGLKAVSI-SYSAL 301

Query: 328 GGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPFTE--INNAFEDLHHGD 374
           G IK   E+ QL+    + ++KV        P  E  ++ A E +  GD
Sbjct: 302 GSIK---ELKQLLALVSEKNIKV---WVETLPVGEAGVHEALERMERGD 344

>NCAS0I01730 Chr9 (319449..320498) [1050 bp, 349 aa] {ON} Anc_3.253
          Length = 349

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/261 (21%), Positives = 104/261 (39%), Gaps = 64/261 (24%)

Query: 36  AHEVRVQVTHTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGDGVTNVKVGDHVVL 95
           ++E+ ++ +++ +   +AY   G+ P    P + G E +GIV  VG  V N ++GD V  
Sbjct: 52  SNEMVIKNSYSGINFIEAYFRKGIYP-CELPYLPGREASGIVAEVGKDVKNFQIGDKVAY 110

Query: 96  LYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYT 155
           L+                                         GE         T +++T
Sbjct: 111 LH-----------------------------------------GE---------TMAEFT 120

Query: 156 VVADVS-LVTIDPSAPLSSVCLLGCGVTTGYGAAV---KTANVQEGDTVAVF-GAGTVGL 210
            + +   ++ +   A   ++ L   G+     A     +   V++G+ V V+  AG VGL
Sbjct: 121 KIKETDPIIKLSKDASDENLKLYAAGLLQSLTAITLINEAHEVKKGEYVLVYAAAGGVGL 180

Query: 211 SVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDG-G 269
            + Q  K +GA  I V     +K + +   GA   +N      + E +V +++++T+  G
Sbjct: 181 LLDQLLKMKGAHTIAVCSTK-EKLELAKANGAEFSIN-----SKEENVVQRVMEITNNKG 234

Query: 270 LDFTFDCTGNVKVMRDALEAC 290
           +D  +D  G      D L A 
Sbjct: 235 VDVAYDSIGKA-TFEDTLAAL 254

>Suva_6.13 Chr6 (21861..22031,22035..22067) [204 bp, 68 aa] {ON}
           YJR159W (REAL)
          Length = 68

 Score = 37.7 bits (86), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 188 AVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFV 246
           AV+   V+ GD V V     +GL V    +  G  K++++   D KKQ S  FG TGF+
Sbjct: 11  AVRLPQVKYGDCVVVISVRAIGLLVDAVFREFGVDKVVLMSTQDSKKQ-SEQFGGTGFI 68

>SAKL0D14938g Chr4 complement(1235542..1236678) [1137 bp, 378 aa]
           {ON} similar to uniprot|Q04894 Saccharomyces cerevisiae
           YMR318C ADH6 NADPH-dependent cinnamyl alcohol
           dehydrogenase family member with broad substrate
           specificity may be involved in fusel alcohol synthesis
           or in aldehyde tolerance
          Length = 378

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 74/190 (38%), Gaps = 23/190 (12%)

Query: 63  GAFPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECG---KCKFCKSNKTNLCGSVR 119
           G    ++GHE  G V +VG+ VT    G+ V +   A+CG   KC  C +     C    
Sbjct: 74  GPKSQVVGHEIVGHVVNVGNKVTKFHKGERVAM--GAQCGSCMKCNRCINGYEQFCTGCI 131

Query: 120 ATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGC 179
            T      PDG              ++    ++ +    +  +V + P      V  L C
Sbjct: 132 ETYCSE-YPDG--------------YVSQGGYASHVRAHEHYIVHVPPQLDSKHVAPLQC 176

Query: 180 GVTTGYGAAVKTAN--VQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWS 237
           G  T Y    +       +   VA+ G G +G   +  +K+    ++  +  +D KK+ +
Sbjct: 177 GGLTVYSPIKRALKDVTDKKPRVAIIGIGGLGHMAIMISKALDC-EVWALSTSDSKKEDA 235

Query: 238 MDFGATGFVN 247
              GA  FVN
Sbjct: 236 KKMGADHFVN 245

>ZYRO0G10318g Chr7 (831554..832684) [1131 bp, 376 aa] {ON} similar
           to uniprot|Q04894 Saccharomyces cerevisiae YMR318C ADH6
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis or in aldehyde tolerance
          Length = 376

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 40/92 (43%), Gaps = 11/92 (11%)

Query: 36  AHEVRVQVTHTAVCHTDAYTLSG----------VDPEGAFPSILGHEGAGIVESVGDGVT 85
           AH+V ++V    +C ++ ++L                G    ++GHE  G V +VGD V+
Sbjct: 35  AHDVDIEVECCGICASELFSLKNEWSSEPLTCMTSSYGPKSQVVGHEVVGKVVAVGDKVS 94

Query: 86  NVKVGDHVVL-LYTAECGKCKFCKSNKTNLCG 116
             KVGD + L    + C  C  C  N    C 
Sbjct: 95  LCKVGDRIGLGAQASSCMSCPRCHGNNEQYCA 126

>KNAG0B06990 Chr2 (1393058..1394134) [1077 bp, 358 aa] {ON} 
          Length = 358

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 84/343 (24%), Positives = 127/343 (37%), Gaps = 37/343 (10%)

Query: 37  HEVRVQVTHTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGDGV-TNVKVGDHV-V 94
           H++ ++V    VC +D +  SG   E   P ++GHE  GIV   G    + +KV D V V
Sbjct: 34  HDIDIRVLACGVCGSDIHCASGHWGEIPKPLVVGHEIIGIVVKTGPRCDSGLKVEDRVGV 93

Query: 95  LLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQY 154
                 C  C  C  +    C +  +T  K    DG              ++    ++ Y
Sbjct: 94  GAQALSCLDCDRCTHDNEPYCPNRVSTYAKSYR-DG--------------YVSQGGYADY 138

Query: 155 TVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQ 214
             V +   V I  S P      L CG  T +   ++      G  V + G G +G   V 
Sbjct: 139 VRVHEHFAVLIPESIPSHLAAPLMCGGLTVFSPLLRNG-CGPGKKVGILGIGGIGHMGVL 197

Query: 215 GAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDGGLDFTF 274
            AK+ GA ++  +     KK  ++  G   F+      KE      K  D     LD   
Sbjct: 198 LAKAMGA-EVYAISRTSSKKADAVKLGTDHFIA----TKEEPDWHEKYFDT----LDLLV 248

Query: 275 DCTGNV-KVMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLITGRVWKGSAFGGIKGR 333
            C G++  V  D L       G+               +PF L+ G     S  G +K  
Sbjct: 249 ICAGSLTDVDFDTLPKIMTVGGRVVSIAIPEQHEILKLKPFGLV-GVSIANSLLGSMKEL 307

Query: 334 SEMGQLVTSYQKGDLKVDDFITHKRPFTE--INNAFEDLHHGD 374
            E+ +LV    K ++K+        P  E  +N AF  +  GD
Sbjct: 308 KELLELVA---KNNIKI---WVETIPIGEKGVNEAFTRMEKGD 344

>Ecym_1093 Chr1 complement(195854..197005) [1152 bp, 383 aa] {ON}
           similar to Saccharomyces cerevisiae YMR318C ADH6 /
           YCR105W ADH7
          Length = 383

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 83/383 (21%), Positives = 144/383 (37%), Gaps = 66/383 (17%)

Query: 13  VAAVAYEAGKPLTVEKIIVDAPK---AHEVRVQVTHTAVCHTDAYTLSGVDPEGAFPSIL 69
           +  +A   G   T  K +   PK   A ++ ++V    VC +D +  +G       P ++
Sbjct: 30  ITGIAVVEGTEWTSPKKVSFKPKTVYARDIVLKVEACGVCGSDIHCAAGHWGPRNNPLVV 89

Query: 70  GHEGAGIVESVGDGVTN-VKVGDHV-VLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVM 127
           GHE  G V  VG G    +KVGD V V      C +C  C+S     C ++  T      
Sbjct: 90  GHEIIGRVIEVGSGCKEGLKVGDRVGVGAQALSCLECSRCESENEQYCSNMTGTYNFP-Y 148

Query: 128 PDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGA 187
           PDG              ++    ++ + +V +   + I  + P      L CG  T +  
Sbjct: 149 PDG--------------YISQGGYASHVIVHEHFAIPIPDNIPSHLAAPLMCGGITAFSP 194

Query: 188 AVKTANVQEGDT-----------VAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQW 236
            +++ NV  G +           +AV  A  +G +V   A SR             KK  
Sbjct: 195 LLRS-NVGPGTSVGVVGIGGIGHMAVIFAKALGANVT--AISR----------RSNKKDD 241

Query: 237 SMDFGATGFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMR-DALEACHKGWG 295
           ++  GA  ++  ++D    +T  +         LD    C+ ++  +  D + +  K  G
Sbjct: 242 ALKLGADVYIAAVEDKDWHKTYANT--------LDLIVVCSSSLTELDFDRIPSLLKVGG 293

Query: 296 QSXXXXXXXXXXXXSTRPFQLITGRVWKGSAFGG--IKGRSEMGQLVTSYQKGDLKVDDF 353
           +               RP  L      KG + G   I   +E+ +L+    K +LK+   
Sbjct: 294 KVLSIAIPEASERLVLRPLLL------KGISIGTSVIGSPAEIKKLLDFVSKKNLKI--- 344

Query: 354 ITHKRPFTE--INNAFEDLHHGD 374
              + P +E  +   F  ++ GD
Sbjct: 345 WVEEVPISEAGVAEVFRRMNSGD 367

>KNAG0K02680 Chr11 complement(531173..532252) [1080 bp, 359 aa] {ON}
           
          Length = 359

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 86/212 (40%), Gaps = 19/212 (8%)

Query: 37  HEVRVQVTHTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGDGVTN-VKVGDHVVL 95
           H++ +++    VC +D +  SG   +   P ++GHE  G +  +G    +  K+GD V +
Sbjct: 34  HDIDIKIEACGVCGSDVHCASGNWGDTPKPLVVGHEIIGTIVKMGPKCNSGYKIGDRVGM 93

Query: 96  LYTA-ECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQY 154
              A  C +C  C ++    C  V  T         ++R                 ++ Y
Sbjct: 94  GAQAMSCLECDRCINDNEPYCAKVVCTYANPYEDGYSSR---------------GGYANY 138

Query: 155 TVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQ 214
             V +   V I  S P      L CG  T + + +K      G  V + G G +G   + 
Sbjct: 139 VRVHEHFAVPIPESIPSHLAAPLMCGGLTVF-SPLKRNGCGPGKKVGIIGIGGIGHMGII 197

Query: 215 GAKSRGASKIIVVDVNDQKKQWSMDFGATGFV 246
            AK+ GA ++  +    +K+  +M  GA  F+
Sbjct: 198 LAKAMGA-EVYAISRTSKKRDDAMKLGADHFI 228

>Kpol_526.18 s526 (51360..52445) [1086 bp, 361 aa] {ON}
           (51360..52445) [1086 nt, 362 aa]
          Length = 361

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 76/345 (22%), Positives = 133/345 (38%), Gaps = 37/345 (10%)

Query: 35  KAHEVRVQVTHTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVG-DGVTNVKVGDHV 93
           K  +V +++    VC +D +  SG   E     ++GHE  G V  +G +  T +K+GD V
Sbjct: 32  KECDVDIEIEACGVCGSDIHCASGDWGERRDKLVVGHEVIGRVIKLGPECHTGLKIGDRV 91

Query: 94  -VLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFS 152
            V    A C  C+ C+ +    C     T  +   PDG              ++    ++
Sbjct: 92  GVGAQVASCLDCERCEHDNEPYCPKFVTTYNQA-YPDG--------------YISQGGYA 136

Query: 153 QYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVFGAGTVGLSV 212
            +  V +  ++ +    P      L CG  T Y   V+           V   G   + +
Sbjct: 137 SHIRVHEHFVIPVPEKIPTHLAAPLLCGGITVYSPLVRGGCAPGKKVGIVGIGGIGHMGI 196

Query: 213 VQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDGGLDF 272
           +  AK+ GA ++     ++ K++ SM  GA  ++  L++  EG T      +     LD 
Sbjct: 197 L-FAKAMGA-EVYAFSRHENKREDSMKLGADHYIATLEE--EGWT------EKYFNSLDV 246

Query: 273 TFDCTGNV-KVMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLITGRVWKGSAFGGIK 331
              C  ++ ++  D L    K  G+               +P  L+ G     S  G   
Sbjct: 247 MILCASSLSQINLDDLIKVMKVEGKIISICVPENDEMMIVKPLGLL-GVYVSNSLLG--- 302

Query: 332 GRSEMGQLVTSYQKGDLKVDDFITHKRPFTE--INNAFEDLHHGD 374
            R E+ +L+    + D+K+      K P  E  ++ AF  +  GD
Sbjct: 303 SRKELLELLHMVAEKDIKI---WVEKLPVGEAGVSEAFIRMKKGD 344

>NDAI0H02940 Chr8 complement(717073..718158) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score = 38.5 bits (88), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 44/95 (46%), Gaps = 3/95 (3%)

Query: 38  EVRVQVTHTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGDGVTN-VKVGDHVVL- 95
           +V +++    VC +D +  SG   +   P I+GHE  G V  +G    N +K+GD V + 
Sbjct: 36  DVDIKIECCGVCGSDIHAASGHWGDIEKPLIVGHEIIGTVVKLGSKCENGLKLGDRVGMG 95

Query: 96  LYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDG 130
                C KC  C +N  + C     T G    PDG
Sbjct: 96  AQCYSCLKCDRCLNNNESYCQHFVTTYGMN-YPDG 129

>Skud_86.1 Chr86 complement(469..738) [270 bp, 89 aa] {ON} YJR159W
           (REAL)
          Length = 89

 Score = 35.8 bits (81), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 32/59 (54%), Gaps = 2/59 (3%)

Query: 222 SKIIVVDVNDQKKQWSMDFGATGFVNPLK-DLKEGETIVSKLIDMTDG-GLDFTFDCTG 278
           S +I VDV D K Q + DFGATG  N  K  + E + +  +L  +  G   D  F+C+G
Sbjct: 1   SDVIFVDVFDNKLQRAKDFGATGTFNSSKFSVDEAQQLADELEKLLGGHQADVVFECSG 59

>SAKL0C00264g Chr3 complement(17429..18508) [1080 bp, 359 aa] {ON}
           highly similar to uniprot|Q04894 Saccharomyces
           cerevisiae YMR318C ADH6 NADPH-dependent cinnamyl alcohol
           dehydrogenase family member with broad substrate
           specificity may be involved in fusel alcohol synthesis
           or in aldehyde tolerance
          Length = 359

 Score = 38.1 bits (87), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 40/81 (49%), Gaps = 2/81 (2%)

Query: 37  HEVRVQVTHTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGDGV-TNVKVGDHV-V 94
           ++V +++    VC +D +  +G   +   P ++GHE  G V  VG    T VK+GD V V
Sbjct: 34  NDVDIEIDACGVCGSDVHCAAGHWGDTQKPLVVGHEVIGRVVRVGPKCHTGVKIGDRVGV 93

Query: 95  LLYTAECGKCKFCKSNKTNLC 115
                 C KC  CKS+    C
Sbjct: 94  GAQVYSCLKCDRCKSDNEPYC 114

>TDEL0F02300 Chr6 complement(421372..422511) [1140 bp, 379 aa] {ON} 
          Length = 379

 Score = 37.7 bits (86), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 56/239 (23%), Positives = 91/239 (38%), Gaps = 31/239 (12%)

Query: 37  HEVRVQVTHTAVCHTDAYTLSG----------VDPEGAFPSILGHEGAGIVESVGDGVTN 86
           H++ ++V    +C ++ ++L                G    ++GHE  G V  VG+ VT 
Sbjct: 38  HDIDIEVECCGICASELFSLKNEWSNAPLACLSSSYGPKSQVVGHEVIGKVVKVGEKVTL 97

Query: 87  VKVGDHVVL-LYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHF 145
            K+G  V L    + C +C  C SN    C     T      PDG              +
Sbjct: 98  AKLGQRVGLGAQASSCMQCGRCSSNNEQYCLKSVGTYCSR-YPDG--------------Y 142

Query: 146 MGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVFGA 205
           +    ++ +    +     I    P + V  L CG  T Y    +     E   V + G 
Sbjct: 143 VSQGGYASHVRAHEQFCFPIPDDVPSAFVAPLMCGGLTVYSPIKRNIEGVEKPKVGIIGI 202

Query: 206 GTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGETIVSKLID 264
           G +G   +  AK+ GA ++     +++KK  ++  GA  FV       E E   S+L D
Sbjct: 203 GGLGHMAIMIAKALGA-EVTAFSRSNKKKDDAIKMGAQYFVA----TGEEENWSSRLAD 256

>KAFR0H03770 Chr8 complement(715399..716496) [1098 bp, 365 aa] {ON} 
          Length = 365

 Score = 37.0 bits (84), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 49/108 (45%), Gaps = 5/108 (4%)

Query: 22  KPLTVEKIIVDAPKA---HEVRVQVTHTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVE 78
           K  T  K +   PKA   H+V +++    VC +D +T +    E     ++GHE  G + 
Sbjct: 22  KDWTHPKRVTYEPKAFGPHDVDIEIECCGVCGSDIHTAASHWRELRDKMVVGHEIVGRIV 81

Query: 79  SVGDGV-TNVKVGDHV-VLLYTAECGKCKFCKSNKTNLCGSVRATQGK 124
            +G    + +K+GD V V   +  C +C  CK N    C    +T  +
Sbjct: 82  KLGPECDSGLKIGDRVGVGAQSFSCLECDRCKENNEPYCPKFVSTYNR 129

>TDEL0A00140 Chr1 (23016..24233) [1218 bp, 405 aa] {ON} 
          Length = 405

 Score = 36.6 bits (83), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 63/263 (23%), Positives = 103/263 (39%), Gaps = 67/263 (25%)

Query: 35  KAHEVRVQVTHTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGDGVTNVKVGDHVV 94
           K +E+ VQ  +  + H D  +        +FP I G E +GIV   G  V          
Sbjct: 71  KEYEILVQNKYVGLNHVDWKSKKYRFNIYSFPWINGRESSGIVIRRGSKVDT-------- 122

Query: 95  LLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQY 154
                     KF  S +  L                +T + +L+          STF +Y
Sbjct: 123 ---------QKFPISAEVFLA---------------STSYRDLE---------TSTFQEY 149

Query: 155 TVVADVSLVTIDPSAPLSSVCL-----------LGCGVTTGYGAAVKT---------ANV 194
           TV  D  LV   P   L +  L           +G G+ T  G+A+ +         A+ 
Sbjct: 150 TVF-DSRLVWKLPQYRLPNGRLHKRFDLEFAAGVGVGLVTA-GSAISSLVDLSLRDQADH 207

Query: 195 QE-GDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLK 253
           Q+ G+ V   G+ +VGL V+Q AK+    + IVV    + K++ ++ GA+  ++  +   
Sbjct: 208 QKLGNIVIWGGSSSVGLYVIQLAKASKMFEKIVVVSASKHKEYLLELGASCIIDRHQS-- 265

Query: 254 EGETIVSKLIDMTDGGLDFTFDC 276
             E I+  ++     G+DF  D 
Sbjct: 266 -EEEILDDILSHCPEGIDFGIDV 287

>SAKL0H00374g Chr8 (45725..47011) [1287 bp, 428 aa] {ON} weakly
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3 Alcohol dehydrogenase isoenzyme III, shows
           a high affinity for alcohols with a double bond
           conjugated to the alcohol group
          Length = 428

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 46/102 (45%), Gaps = 11/102 (10%)

Query: 19  EAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPEGAFPS----ILGHEGA 74
           E  K   +E   V + K H+  +++    +CH+D   L     +G FP+     +GHE  
Sbjct: 93  ENNKLEYLENYRVQSLKPHQGLLKIKAVGLCHSDLTIL-----KGGFPASQRYAMGHEIC 147

Query: 75  G-IVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLC 115
           G +V++  D      VG+   ++  A CG C  CK    + C
Sbjct: 148 GELVQTYADE-PKYAVGELYTVVGNAPCGGCDSCKKGWESCC 188

>TPHA0F02090 Chr6 (465913..466995) [1083 bp, 360 aa] {ON} 
          Length = 360

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 49/125 (39%), Gaps = 5/125 (4%)

Query: 11  ECVAAVAYEAGKPLTVEKIIVDAPKA---HEVRVQVTHTAVCHTDAYTLSGVDPEGAFPS 67
           E    +A   GK  T  K I   PK     +V +++    VC +D +  +          
Sbjct: 5   EQFQGIAVTDGKDWTHPKKISFPPKKFDDRDVDIEIEACGVCGSDVHCAASHWGPVKDNQ 64

Query: 68  ILGHEGAGIVESVGDGV-TNVKVGDHV-VLLYTAECGKCKFCKSNKTNLCGSVRATQGKG 125
           ++GHE  G V  VG    T +KVGD V V      C  C  CK +  N C     T G  
Sbjct: 65  VVGHEIIGKVVKVGPKCNTGIKVGDRVGVGAQALACLDCNRCKEDHENYCFGNIWTYGGP 124

Query: 126 VMPDG 130
              DG
Sbjct: 125 TYADG 129

>TBLA0A06640 Chr1 (1621352..1622437) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score = 33.9 bits (76), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 44/96 (45%), Gaps = 3/96 (3%)

Query: 37  HEVRVQVTHTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGDGVTN-VKVGDHV-V 94
            ++ +++    VC +D +T +          ++GHE  G V  +G    + +K+G  V V
Sbjct: 34  QDIDIEIMACGVCGSDTHTAASRWGPCPNSQVVGHEIIGKVVKIGSKCEDGLKIGQRVGV 93

Query: 95  LLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDG 130
                 C +C+ CK+N    C +   T   G+ P+G
Sbjct: 94  GAQVFSCLECQRCKNNNEQYCTNFVTTY-TGIYPNG 128

>Kpol_1057.24 s1057 (53467..54549) [1083 bp, 360 aa] {ON}
           (53467..54549) [1083 nt, 361 aa]
          Length = 360

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 38/80 (47%), Gaps = 2/80 (2%)

Query: 38  EVRVQVTHTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGDGVTN-VKVGDHV-VL 95
           +V +++    VC +D +  +      A   ++GHE  G V  VG   T  +KVGD V V 
Sbjct: 35  DVDIKIEACGVCGSDVHCAASHWGPVAEKQVVGHEIIGRVLKVGPKCTTGIKVGDRVGVG 94

Query: 96  LYTAECGKCKFCKSNKTNLC 115
                C +C  CKS+  + C
Sbjct: 95  AQAWSCLECSRCKSDNESYC 114

>KLTH0C10538g Chr3 complement(873623..874444) [822 bp, 273 aa] {ON}
           conserved hypothetical protein
          Length = 273

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 62/144 (43%), Gaps = 20/144 (13%)

Query: 152 SQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVFGA-GTVGL 210
           ++Y VV++ ++     +   +    LG  +TT    A++ A V+  D V+V GA G+VG 
Sbjct: 51  AEYCVVSEDAVALKPKNVTFAQAACLGVPLTTA-SLALQRAAVEPSDCVSVIGASGSVGS 109

Query: 211 SVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDG-G 269
            VVQ A+S G        V    +Q   D            + E E   S L  +T G G
Sbjct: 110 YVVQLAQSMGCR------VLRAARQSPTDVC----------IAEDEEF-SALTSLTQGRG 152

Query: 270 LDFTFDCTGNVKVMRDALEACHKG 293
           +D   D  G   +M+ A E    G
Sbjct: 153 VDVVIDTVGMPALMKAAAEKLAHG 176

>TPHA0A00140 Chr1 (14857..15945) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 42/95 (44%), Gaps = 4/95 (4%)

Query: 27  EKIIVDAPK--AHEVRVQVTHTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGDGV 84
           +KI  D  K   ++V +++    VC +D +  S          ++GHE  G V  +G   
Sbjct: 22  KKISYDPKKFDDYDVDIKIEACGVCGSDVHRASSNWGPVKANQVVGHEIVGRVVKLGPKC 81

Query: 85  T-NVKVGDHV-VLLYTAECGKCKFCKSNKTNLCGS 117
              +KVGD V V      C  CK CKS+    C S
Sbjct: 82  KLGLKVGDRVGVGAQAKSCLNCKRCKSDNEPYCKS 116

>Smik_26.3 Chr26 (2136..2513) [378 bp, 125 aa] {ON} YMR318C (REAL)
          Length = 125

 Score = 30.8 bits (68), Expect = 2.0,   Method: Composition-based stats.
 Identities = 22/83 (26%), Positives = 37/83 (44%), Gaps = 8/83 (9%)

Query: 38  EVRVQVTHTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGDGVT-----NVKVGDH 92
           +V ++V    VC +D +  +G       P + GHE  G +  +G   +     +++VG  
Sbjct: 35  DVEIKVEACGVCGSDIHCAAGHWGPRNDPLVAGHEIVGRIVRMGSRCSSQLKVDMRVGMG 94

Query: 93  VVLLYTAECGKCKFCKSNKTNLC 115
            +   T  C KC  CK  + N C
Sbjct: 95  AI---TFSCLKCSGCKKGEENYC 114

>Smik_14.193 Chr14 complement(352041..353171) [1131 bp, 376 aa] {ON}
           YNL134C (REAL)
          Length = 376

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 70/303 (23%), Positives = 111/303 (36%), Gaps = 81/303 (26%)

Query: 11  ECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVC-------HTDAYTLSGVDPEG 63
           E + AV  E GK +    I +  P+  E  V +   AV        H D      + P+G
Sbjct: 7   ETMKAVVIENGKAVVKHDIPI--PELEEGFVLIKTVAVAGNPTDWKHID----YKIGPQG 60

Query: 64  AFPSILGHEGAGIVESVGDGV--TNVKVGDHVVLL----------------YTAECGKCK 105
           A   +LG + AG +  +G  V      +GD++  +                Y+A   +  
Sbjct: 61  A---LLGCDAAGQIVKLGPNVDAAEFSIGDYIYGVIHGASVRFPSNGAFAEYSAISSEIA 117

Query: 106 FCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTI 165
           +  + +  LCG  + ++G                 P+    G  T         VSL T 
Sbjct: 118 YKPAREFRLCGKDKLSEG-----------------PVRSLEGAVTLP-------VSLTT- 152

Query: 166 DPSAPLSSVCLLGCGVTTGYGAAVK--TANVQEGDTVAVFGAGT-VGLSVVQGAKS-RGA 221
                       G  +T  +G  +K      Q    +  +G  T VG  ++Q AK   G 
Sbjct: 153 -----------AGMVLTHSFGLDMKWEPPKAQRDHPILFWGGATGVGQMLIQLAKKLHGF 201

Query: 222 SKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVK 281
           SKIIVV     +KQ   D+GA    + L D  + + I  + I      L +  DC  N +
Sbjct: 202 SKIIVVASRKHEKQLK-DYGA----DELFDYHDADVI--EQIKKKHNNLTYLVDCVSNTE 254

Query: 282 VMR 284
            ++
Sbjct: 255 TIQ 257

>Kwal_8.605 s8 (25017..26156) [1140 bp, 379 aa] {ON} YCR105W -
           Hypothetical ORF [contig 311] FULL
          Length = 379

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 56/216 (25%), Positives = 90/216 (41%), Gaps = 25/216 (11%)

Query: 37  HEVRVQVTHTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGDGVTNVK--VGDHV- 93
            ++ +++    VC +D + +SG       P  +GHE  G + ++G  V   K  +GD V 
Sbjct: 49  EDIELEIEACGVCGSDIHAVSGDWGRLYKPFAVGHEIIGKISAMGAQVNKEKFHLGDRVG 108

Query: 94  VLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQ 153
           V   T  CG C  C  ++   C        K V+        N          G  T   
Sbjct: 109 VGAQTNSCGDCTRCSRDRQQNCK-------KSVLTYTCVDERN----------GFETQGG 151

Query: 154 YT--VVADVSLVTIDPSAPLSSVCL-LGCGVTTGYGAAVKTANVQEGDTVAVFGAGTVGL 210
           Y   + A+   V   P A  S+V   L CG  TG+   + T  V+EG  + V G G +G 
Sbjct: 152 YASHIRANSGFVFKIPDALDSAVAAPLLCGGITGFRPLL-TGGVKEGSKLGVVGIGGIGH 210

Query: 211 SVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFV 246
             +  AK+ GA ++  +  +++K   +   GA  F+
Sbjct: 211 MSILFAKALGA-EVTAISRSNRKFDDAKKLGADHFL 245

>KAFR0C01550 Chr3 complement(318350..319429) [1080 bp, 359 aa] {ON} 
          Length = 359

 Score = 31.2 bits (69), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 39/82 (47%), Gaps = 2/82 (2%)

Query: 36  AHEVRVQVTHTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVG-DGVTNVKVGDHV- 93
           +H+V +++    VC +D +  +    E     ++GHE  G V  VG +  T +K+GD V 
Sbjct: 33  SHDVDIEIECCGVCGSDIHCAASHWSEVREDLVVGHEVIGRVVKVGPECNTGLKLGDRVG 92

Query: 94  VLLYTAECGKCKFCKSNKTNLC 115
           V      C +C  CK +    C
Sbjct: 93  VGAQVFSCLECDRCKEDNEPYC 114

>Kwal_33.12956 s33 complement(14925..16160) [1236 bp, 411 aa] {ON}
           YBR046C (ZTA1) - Homolog to quinone oxidoreductase (E.
           coli) [contig 123] FULL
          Length = 411

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 64/146 (43%), Gaps = 22/146 (15%)

Query: 146 MGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVF-- 203
           +  STF ++TV  D  LV   P   LSS  +     +  + A +  A V  G  ++ F  
Sbjct: 153 LKSSTFQEFTVF-DSRLVWRLPQETLSS-GITRRRFSLDFAAGIGVALVTAGSALSSFID 210

Query: 204 -----------------GAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFV 246
                            G+ +VG+  +Q A++ G  K I+   + + + +  + GAT  +
Sbjct: 211 FDRSFNEAPSKSLVIWGGSSSVGIFTIQLARNLGIFKNIIAISSLKYEHYLKELGATIVL 270

Query: 247 NPLKDLKEGETIVSKLI-DMTDGGLD 271
           +  + L E +  +SKL  +  D G+D
Sbjct: 271 DRSRPLVELKQALSKLCPEGVDYGID 296

>KLTH0F14322g Chr6 (1174310..1177012) [2703 bp, 900 aa] {ON} similar
           to uniprot|Q01454 Saccharomyces cerevisiae YPR135W CTF4
           Chromatin-associated protein required for sister
           chromatid cohesion interacts with DNA polymerase alpha
           (Pol1p) and may link DNA synthesis to sister chromatid
           cohesion
          Length = 900

 Score = 31.2 bits (69), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 8/68 (11%)

Query: 3   SATAGKPIECVAAVAY-------EAGKPLTVEKII-VDAPKAHEVRVQVTHTAVCHTDAY 54
           +A A  P   +   ++       + G PL VEK+  V A  AHE +V   H ++ H   Y
Sbjct: 567 TAAAATPKRIIVGTSFGYIRTFNQFGIPLGVEKMAPVAAIAAHEFKVFAVHYSLHHGITY 626

Query: 55  TLSGVDPE 62
           TL   DP+
Sbjct: 627 TLFEQDPK 634

>Kwal_27.12835 s27 complement(1395770..1396864) [1095 bp, 364 aa]
           {ON} YCR105W - Hypothetical ORF [contig 261] FULL
          Length = 364

 Score = 30.8 bits (68), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 57/216 (26%), Positives = 90/216 (41%), Gaps = 25/216 (11%)

Query: 37  HEVRVQVTHTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGDGVTNVK--VGDHV- 93
            ++ +++    VC +D + +SG       P  +GHE  G + ++G  V   K  +GD V 
Sbjct: 34  EDIELEIEACGVCGSDIHAVSGDWGRLYKPFAVGHEIIGKISAMGAQVNKEKFHLGDRVG 93

Query: 94  VLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQ 153
           V   T  CG C  C  ++   C        K V+        N          G  T   
Sbjct: 94  VGAQTNSCGGCTRCSRDRQQNCK-------KSVLTYTCVDERN----------GFETQGG 136

Query: 154 YT--VVADVSLVTIDPSAPLSSVCL-LGCGVTTGYGAAVKTANVQEGDTVAVFGAGTVGL 210
           Y   + A+   V   P A  S+V   L CG  TG+   + T  V+EG  V V G G +G 
Sbjct: 137 YASHIRANSEFVFKIPDALDSAVAAPLLCGGITGFRPLL-TGGVKEGSKVGVVGIGGIGH 195

Query: 211 SVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATGFV 246
             +  AK+ GA ++  +  +++K   +   GA  F+
Sbjct: 196 MSILFAKALGA-EVTAISRSNRKFDDAKKLGADHFL 230

>TPHA0E00730 Chr5 (139190..142126) [2937 bp, 978 aa] {ON} Anc_7.413
           YER114C
          Length = 978

 Score = 30.8 bits (68), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 26/60 (43%), Gaps = 1/60 (1%)

Query: 48  VCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFC 107
           V  T  +TL G      F S       G+++  G  V   K  D +V LY A  GK ++C
Sbjct: 773 VWKTRFFTLHGTR-LSYFSSTTDTREKGLIDITGHRVVPAKDDDKIVSLYAASTGKGRYC 831

>Suva_7.343 Chr7 complement(587041..591117) [4077 bp, 1358 aa] {ON}
           YGR061C (REAL)
          Length = 1358

 Score = 30.8 bits (68), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 39/80 (48%), Gaps = 7/80 (8%)

Query: 198 DTVAVFGAGTVGLSVVQGAKSRGASKIIVV--DVNDQKKQWSMDFGATGFVNPLKDL-KE 254
           D+V V     V LSV Q AKS GAS ++ V   V ++      +    GF+  L  L +E
Sbjct: 865 DSVLVL----VDLSVKQEAKSLGASALLQVYNQVGNKSPTVHDNVILKGFLESLIQLHQE 920

Query: 255 GETIVSKLIDMTDGGLDFTF 274
            E IV    D +DGGL  T 
Sbjct: 921 NEDIVLAYHDRSDGGLLVTL 940

>TDEL0E00230 Chr5 (36310..37398) [1089 bp, 362 aa] {ON}   Added 3N
           and 2N to fix a STOP codon and a frameshift that cannot
           be fixed with the contigs.
          Length = 362

 Score = 30.0 bits (66), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 47/106 (44%), Gaps = 11/106 (10%)

Query: 28  KIIVDAPKA----HEVRVQVTHTAVCHTDAYTLSGVDPEGAFPS---ILGHEGAGIVESV 80
           K I  APK     ++V VQ+    VC +D +  SG D  G +P    ++GHE  G +  +
Sbjct: 22  KKIEFAPKPFXXDYDVDVQIEACGVCGSDVHRASG-DWMG-YPCQXLVVGHEIIGRIVKL 79

Query: 81  GDGV-TNVKVGDHV-VLLYTAECGKCKFCKSNKTNLCGSVRATQGK 124
           G    + VK+GD V +      C  C+ C +     C     T  +
Sbjct: 80  GPKYHSGVKIGDRVGIGAQVFSCLNCRRCNNGDEPYCSKFVTTYSQ 125

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 37,345,180
Number of extensions: 1480742
Number of successful extensions: 3882
Number of sequences better than 10.0: 199
Number of HSP's gapped: 3755
Number of HSP's successfully gapped: 226
Length of query: 384
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 273
Effective length of database: 40,753,473
Effective search space: 11125698129
Effective search space used: 11125698129
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)