Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D12320g7.351ON25025010481e-145
KLTH0H01232g7.351ON2572546993e-92
SAKL0F11396g7.351ON2542486845e-90
ZYRO0F11726g7.351ON2512506515e-85
Kwal_56.246447.351ON2582466491e-84
TDEL0C019707.351ON2602516325e-82
YLR201C (COQ9)7.351ON2602486125e-79
ACL147W7.351ON2462506072e-78
Ecym_47227.351ON2532465951e-76
Kpol_530.307.351ON2602475924e-76
Skud_12.2657.351ON2602485892e-75
CAGL0A03949g7.351ON2682445841e-74
Smik_12.2607.351ON2602465813e-74
Suva_10.2967.351ON2602465803e-74
TPHA0F029807.351ON2642535458e-69
TBLA0E004507.351ON2792295321e-66
KAFR0L014807.351ON2642475274e-66
NCAS0E028707.351ON2612475143e-64
NDAI0E044707.351ON2642485101e-63
KNAG0B026207.351ON2652474952e-61
TPHA0F035401.509ON97139692.6
KLLA0B14058g1.520ON19467647.2
TPHA0I031407.521ON21946647.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D12320g
         (250 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D12320g Chr4 complement(1048556..1049308) [753 bp, 250 aa] ...   408   e-145
KLTH0H01232g Chr8 complement(119673..120446) [774 bp, 257 aa] {O...   273   3e-92
SAKL0F11396g Chr6 (886970..887734) [765 bp, 254 aa] {ON} similar...   268   5e-90
ZYRO0F11726g Chr6 (959943..960698) [756 bp, 251 aa] {ON} similar...   255   5e-85
Kwal_56.24644 s56 (1087270..1088046) [777 bp, 258 aa] {ON} YLR20...   254   1e-84
TDEL0C01970 Chr3 complement(343645..344427) [783 bp, 260 aa] {ON...   248   5e-82
YLR201C Chr12 complement(549511..550293) [783 bp, 260 aa] {ON}  ...   240   5e-79
ACL147W Chr3 (92477..93217) [741 bp, 246 aa] {ON} Syntenic homol...   238   2e-78
Ecym_4722 Chr4 complement(1413860..1414621) [762 bp, 253 aa] {ON...   233   1e-76
Kpol_530.30 s530 complement(75011..75793) [783 bp, 260 aa] {ON} ...   232   4e-76
Skud_12.265 Chr12 complement(496162..496944) [783 bp, 260 aa] {O...   231   2e-75
CAGL0A03949g Chr1 (399220..400026) [807 bp, 268 aa] {ON} similar...   229   1e-74
Smik_12.260 Chr12 complement(496547..497329) [783 bp, 260 aa] {O...   228   3e-74
Suva_10.296 Chr10 complement(522345..523127) [783 bp, 260 aa] {O...   228   3e-74
TPHA0F02980 Chr6 (655375..656169) [795 bp, 264 aa] {ON} Anc_7.35...   214   8e-69
TBLA0E00450 Chr5 complement(83483..84322) [840 bp, 279 aa] {ON} ...   209   1e-66
KAFR0L01480 Chr12 (274514..275308) [795 bp, 264 aa] {ON} Anc_7.3...   207   4e-66
NCAS0E02870 Chr5 complement(561968..562753) [786 bp, 261 aa] {ON...   202   3e-64
NDAI0E04470 Chr5 complement(1006109..1006903) [795 bp, 264 aa] {...   201   1e-63
KNAG0B02620 Chr2 complement(507597..508394) [798 bp, 265 aa] {ON...   195   2e-61
TPHA0F03540 Chr6 (762007..764922) [2916 bp, 971 aa] {ON} Anc_1.5...    31   2.6  
KLLA0B14058g Chr2 complement(1237669..1238253) [585 bp, 194 aa] ...    29   7.2  
TPHA0I03140 Chr9 (697331..697990) [660 bp, 219 aa] {ON} Anc_7.521      29   7.5  

>KLLA0D12320g Chr4 complement(1048556..1049308) [753 bp, 250 aa]
           {ON} similar to uniprot|Q05779 Saccharomyces cerevisiae
           YLR201C FMP53,
          Length = 250

 Score =  408 bits (1048), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 207/250 (82%), Positives = 207/250 (82%)

Query: 1   MSRVFTRLYHPNNLEHALPKIIKPLTYGTDSVQFKVLSNALNKHVPQYGFNERAIVQSLN 60
           MSRVFTRLYHPNNLEHALPKIIKPLTYGTDSVQFKVLSNALNKHVPQYGFNERAIVQSLN
Sbjct: 1   MSRVFTRLYHPNNLEHALPKIIKPLTYGTDSVQFKVLSNALNKHVPQYGFNERAIVQSLN 60

Query: 61  EXXXXXXXXXXXXXXXXXXXXXXXXXXLELVKFHLVSKRNQLIXXXXXXXXXXXXXXXXX 120
           E                          LELVKFHLVSKRNQLI                 
Sbjct: 61  ELGMGSSYLSVLGSSNSPSFFNVSPSVLELVKFHLVSKRNQLITDLPLDSDKPLPDLKTL 120

Query: 121 FLQRLKLNEHVAPHLSQLLSIMSVPGEFLASTALSELHKLTDDMIFYSNEQDHNDFAWYS 180
           FLQRLKLNEHVAPHLSQLLSIMSVPGEFLASTALSELHKLTDDMIFYSNEQDHNDFAWYS
Sbjct: 121 FLQRLKLNEHVAPHLSQLLSIMSVPGEFLASTALSELHKLTDDMIFYSNEQDHNDFAWYS 180

Query: 181 KRIALSTAYVSSELFMAQDKSHNFQETMEFAQSKLNKVSQLGSMYNNTEEYLWFTLLSSI 240
           KRIALSTAYVSSELFMAQDKSHNFQETMEFAQSKLNKVSQLGSMYNNTEEYLWFTLLSSI
Sbjct: 181 KRIALSTAYVSSELFMAQDKSHNFQETMEFAQSKLNKVSQLGSMYNNTEEYLWFTLLSSI 240

Query: 241 NLAKSQITRG 250
           NLAKSQITRG
Sbjct: 241 NLAKSQITRG 250

>KLTH0H01232g Chr8 complement(119673..120446) [774 bp, 257 aa] {ON}
           similar to uniprot|Q05779 Saccharomyces cerevisiae
           YLR201C FMP53
          Length = 257

 Score =  273 bits (699), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 139/254 (54%), Positives = 170/254 (66%), Gaps = 4/254 (1%)

Query: 1   MSRVFTR-LYHPNNLEHALPKIIKPLTYGTDSVQFKVLSNALNKHVPQYGFNERAIVQSL 59
           +SR+  R LYHP+ LEH L     PLTYG  S QFKVL +ALNKHVP YGFNERA+V SL
Sbjct: 4   LSRILARRLYHPSALEHQLAHSFAPLTYGPGSTQFKVLEHALNKHVPSYGFNERALVASL 63

Query: 60  NEXXXXXXXXXXXXXXXXXXXXXXXXXXLELVKFHLVSKRNQL---IXXXXXXXXXXXXX 116
           N+                          LEL+KFHLV+KR  L   +             
Sbjct: 64  NDLDLGPSLLSVIGASNSPSFLNASPAVLELIKFHLVTKRYALTKELDPARTSSPAEPPA 123

Query: 117 XXXXFLQRLKLNEHVAPHLSQLLSIMSVPGEFLASTALSELHKLTDDMIFYSNEQDHNDF 176
               F +RL+LN+ +APHL+QLLS +S+PGEFL  TAL ELH+L+DDM+++S E D NDF
Sbjct: 124 LETLFHRRLELNKPIAPHLTQLLSSLSIPGEFLVQTALPELHRLSDDMVYFSKEPDANDF 183

Query: 177 AWYSKRIALSTAYVSSELFMAQDKSHNFQETMEFAQSKLNKVSQLGSMYNNTEEYLWFTL 236
           AWYSKRIALS A+VSSELFMAQD+S N+ +T EFA  KL+ VS+LG  YNNTEEY+W+TL
Sbjct: 184 AWYSKRIALSCAFVSSELFMAQDRSANYADTFEFAAEKLHNVSKLGQYYNNTEEYMWYTL 243

Query: 237 LSSINLAKSQITRG 250
           L S+NLAKSQ+TR 
Sbjct: 244 LMSVNLAKSQLTRS 257

>SAKL0F11396g Chr6 (886970..887734) [765 bp, 254 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201C FMP53
          Length = 254

 Score =  268 bits (684), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 131/248 (52%), Positives = 171/248 (68%), Gaps = 1/248 (0%)

Query: 2   SRVFTRLYHPNNLEHALPKIIKPLTYGTDSVQFKVLSNALNKHVPQYGFNERAIVQSLNE 61
           S++  R YHPNNLEHA  K++ PL Y  DS Q+K+L+NAL++ VP+YGFNERA+  S ++
Sbjct: 7   SKIARRGYHPNNLEHASSKVLPPLIYSKDSPQWKILANALDEQVPKYGFNERALTSSCSD 66

Query: 62  XXXXXXXXXXXXXXXXXXXXXXXXXXLELVKFHLVSKRNQLIXXXXXXXXXXXXXXXXXF 121
                                     LEL+KFHLVSKR  L                  F
Sbjct: 67  LGYSSSFLSVLGASNSPSFFNSSPAVLELLKFHLVSKRYSLTDGVADGTLESPSLENL-F 125

Query: 122 LQRLKLNEHVAPHLSQLLSIMSVPGEFLASTALSELHKLTDDMIFYSNEQDHNDFAWYSK 181
           L+RL++N+ +A HLSQLLS +++PG FLA  A+ ELH+L+DDM+++SNE DHNDFAWYSK
Sbjct: 126 LKRLEMNKPIAAHLSQLLSCLALPGAFLAEYAIPELHRLSDDMVYFSNEPDHNDFAWYSK 185

Query: 182 RIALSTAYVSSELFMAQDKSHNFQETMEFAQSKLNKVSQLGSMYNNTEEYLWFTLLSSIN 241
           R+A+STAYVSSELFMAQDKS ++Q+T++FA+ KL  + QLG  YNN EEY W+TLLSSI+
Sbjct: 186 RLAISTAYVSSELFMAQDKSIDYQDTVKFAKEKLKNIKQLGEAYNNVEEYAWYTLLSSIS 245

Query: 242 LAKSQITR 249
           LAKSQ+TR
Sbjct: 246 LAKSQMTR 253

>ZYRO0F11726g Chr6 (959943..960698) [756 bp, 251 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201C FMP53
          Length = 251

 Score =  255 bits (651), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 133/250 (53%), Positives = 163/250 (65%), Gaps = 3/250 (1%)

Query: 1   MSRVFTRLYHPNNLEHALPKIIKPLTYGTDSVQFKVLSNALNKHVPQYGFNERAIVQSLN 60
           + +V  R YHP+  EH     + PL YG DS Q+ VLS+AL   VP  GFNERAIV SLN
Sbjct: 5   LCQVSLRRYHPSKGEHLNSSRLGPLNYGLDSPQYAVLSHALKVSVPVVGFNERAIVHSLN 64

Query: 61  EXXXXXXXXXXXXXXXXXXXXXXXXXXLELVKFHLVSKRNQLIXXXXXXXXXXXXXXXXX 120
           +                          +ELVKFHLV KR QL                  
Sbjct: 65  QLNYPSTMLSVIGASNSPSLLHSSPAVMELVKFHLVQKRLQL---SQDLSSEEKPSLEDL 121

Query: 121 FLQRLKLNEHVAPHLSQLLSIMSVPGEFLASTALSELHKLTDDMIFYSNEQDHNDFAWYS 180
           F++RL+LN  +A HLSQLLS +SVPG F   TAL ELH+L+DD+I+YSNE+DH+DFAWYS
Sbjct: 122 FIKRLELNVPIAGHLSQLLSHVSVPGPFTVDTALPELHRLSDDLIYYSNEKDHHDFAWYS 181

Query: 181 KRIALSTAYVSSELFMAQDKSHNFQETMEFAQSKLNKVSQLGSMYNNTEEYLWFTLLSSI 240
           KR+ +S AYVSSELFMAQDKSHN++ET +FA+ KL +  QLG  YNNTEE+LW+TLL+SI
Sbjct: 182 KRLGISCAYVSSELFMAQDKSHNYEETFQFARDKLQRTMQLGEYYNNTEEWLWYTLLNSI 241

Query: 241 NLAKSQITRG 250
           NLAKSQ+ RG
Sbjct: 242 NLAKSQMARG 251

>Kwal_56.24644 s56 (1087270..1088046) [777 bp, 258 aa] {ON} YLR201C
           - Hypothetical ORF [contig 161] FULL
          Length = 258

 Score =  254 bits (649), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 129/246 (52%), Positives = 161/246 (65%), Gaps = 3/246 (1%)

Query: 7   RLYHPNNLEHALPKIIKPLTYGTDSVQFKVLSNALNKHVPQYGFNERAIVQSLNEXXXXX 66
           R Y PN LE+ L   + PL YGT S+QFKVL +AL  HVP YGFNERA+V SLN+     
Sbjct: 12  RFYQPNPLEYQLTTKLAPLAYGTQSIQFKVLDHALKNHVPSYGFNERALVASLNDLGLGS 71

Query: 67  XXXXXXXXXXXXXXXXXXXXXLELVKFHLVSKRNQL---IXXXXXXXXXXXXXXXXXFLQ 123
                                LELVKFHLV+KR  L   +                 F +
Sbjct: 72  QVLSSIGAPNSPPLLNSSPAVLELVKFHLVTKRYALTKDLDIARCASPAEPPALETLFHK 131

Query: 124 RLKLNEHVAPHLSQLLSIMSVPGEFLASTALSELHKLTDDMIFYSNEQDHNDFAWYSKRI 183
           RL+LN  +A H++QLL+I+++PGEFL  +AL ELH+L+DDMI++S E D NDFAWYSKR 
Sbjct: 132 RLELNIPIAQHMTQLLAILAMPGEFLLQSALPELHRLSDDMIYFSKEPDANDFAWYSKRA 191

Query: 184 ALSTAYVSSELFMAQDKSHNFQETMEFAQSKLNKVSQLGSMYNNTEEYLWFTLLSSINLA 243
           A+S A+VSSELFMAQDKS N+ +T EFA  KL+ V++LG  Y NTEEY+W+TLL S+NLA
Sbjct: 192 AISCAFVSSELFMAQDKSPNYADTFEFAADKLHNVTKLGQYYTNTEEYMWYTLLMSVNLA 251

Query: 244 KSQITR 249
           KSQITR
Sbjct: 252 KSQITR 257

>TDEL0C01970 Chr3 complement(343645..344427) [783 bp, 260 aa] {ON}
           Anc_7.351 YLR201C
          Length = 260

 Score =  248 bits (632), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 129/251 (51%), Positives = 162/251 (64%), Gaps = 2/251 (0%)

Query: 2   SRVFTRLYHPNNLEHALPKIIK-PLTYGTDSVQFKVLSNALNKHVPQYGFNERAIVQSLN 60
           SR+F R Y P   E+  P   + PL YG DS Q+KVLS+ L K VP YGFNERAIV SLN
Sbjct: 10  SRIFARGYRPAGFEYINPINSRGPLKYGKDSPQYKVLSHTLAKSVPMYGFNERAIVNSLN 69

Query: 61  EXXXXXXXXXXXXXXXXXXXXXXXXXXLELVKFHLVSKRNQLIXXXXXXXXXXXXXXXXX 120
           E                          +EL+KFHLV KR  L                  
Sbjct: 70  ELGYPSTMLSVIGSSNGPSFFHSSPALMELLKFHLVDKRLNLTENISLETPVDQLPSLEH 129

Query: 121 F-LQRLKLNEHVAPHLSQLLSIMSVPGEFLASTALSELHKLTDDMIFYSNEQDHNDFAWY 179
             ++RL++N  VA HLSQLLS +S+PG FL   ++ ELH+L+DDMI++S E+DHNDFAWY
Sbjct: 130 LVIKRLEMNVPVAKHLSQLLSQLSIPGPFLVDYSMPELHRLSDDMIYFSTEKDHNDFAWY 189

Query: 180 SKRIALSTAYVSSELFMAQDKSHNFQETMEFAQSKLNKVSQLGSMYNNTEEYLWFTLLSS 239
           SKR+A+S AYVSSELFMAQD+S +++ET EFA+ KL++VS LG  YNNTEE+ W+TLLS+
Sbjct: 190 SKRLAVSCAYVSSELFMAQDRSPDYKETFEFAREKLHRVSTLGEYYNNTEEFAWYTLLST 249

Query: 240 INLAKSQITRG 250
           INL KSQ+ RG
Sbjct: 250 INLVKSQLARG 260

>YLR201C Chr12 complement(549511..550293) [783 bp, 260 aa] {ON}
           COQ9Protein required for ubiquinone (coenzyme Q)
           biosynthesis and respiratory growth; localizes to the
           matrix face of the mitochondrial inner membrane in a
           large complex with ubiquinone biosynthetic enzymes
          Length = 260

 Score =  240 bits (612), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 118/248 (47%), Positives = 165/248 (66%), Gaps = 2/248 (0%)

Query: 5   FTRLYHPNNLEHALPKIIKPLTYGTDSVQFKVLSNALNKHVPQYGFNERAIVQSLNEXXX 64
           F RLYH N +EH  P  IKPLTYG +S Q+KVLS AL K VP++GF+ER+IV+SLNE   
Sbjct: 13  FFRLYHSNPIEHVKPIHIKPLTYGKESPQYKVLSLALQKFVPEHGFSERSIVESLNELGY 72

Query: 65  XXXXXXXXXXXXXXXXXXXXXXXLELVKFHLVSKRNQLIXXXXXXXXXXXXXXXXX--FL 122
                                  +EL+KF LV KR +L                     L
Sbjct: 73  PSSMISSIGAPNSPSFFHSSTAVMELIKFQLVDKRYRLTEGINPDVTPQYKLPSLEHLLL 132

Query: 123 QRLKLNEHVAPHLSQLLSIMSVPGEFLASTALSELHKLTDDMIFYSNEQDHNDFAWYSKR 182
           +RL++++ +  HLS+L+S +++P  FL  TA+ ELH+L+DDMI++SNE+DH+D AWY+KR
Sbjct: 133 KRLEMDKPIGGHLSELMSQLAIPSAFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKR 192

Query: 183 IALSTAYVSSELFMAQDKSHNFQETMEFAQSKLNKVSQLGSMYNNTEEYLWFTLLSSINL 242
           +A+S+ Y+ S+LFMAQDKSHN++ET  FA+ KL++V +LG  YNNTEE+ W+TL+S++NL
Sbjct: 193 LAVSSTYIGSKLFMAQDKSHNYKETFTFAKDKLHRVMRLGEYYNNTEEFAWYTLMSTVNL 252

Query: 243 AKSQITRG 250
            KSQ+ RG
Sbjct: 253 IKSQLVRG 260

>ACL147W Chr3 (92477..93217) [741 bp, 246 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR201C
          Length = 246

 Score =  238 bits (607), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 119/250 (47%), Positives = 157/250 (62%), Gaps = 4/250 (1%)

Query: 1   MSRVFTRLYHPNNLEHALPKIIKPLTYGTDSVQFKVLSNALNKHVPQYGFNERAIVQSLN 60
           M RV  RLYHPN LEHA+   ++PL Y  DS Q+KVL  AL  HVP  GFNERAIV++  
Sbjct: 1   MFRVCRRLYHPNTLEHAVGNRLRPLAYEQDSPQYKVLQRALEAHVPVLGFNERAIVRAAG 60

Query: 61  EXXXXXXXXXXXXXXXXXXXXXXXXXXLELVKFHLVSKRNQLIXXXXXXXXXXXXXXXXX 120
           +                          LELVKFHLV+KR  L                  
Sbjct: 61  DLGYGSAVLSALAAPNSPALLNVPSAVLELVKFHLVTKRVAL----ADAAAQGNVSMEQL 116

Query: 121 FLQRLKLNEHVAPHLSQLLSIMSVPGEFLASTALSELHKLTDDMIFYSNEQDHNDFAWYS 180
           FLQR++ +  +A  L+QLLSI+S+PGEFL +TA+ EL +L+DD+I+YS E+DH D AWYS
Sbjct: 117 FLQRVEADRPLAGQLTQLLSILSLPGEFLVNTAMPELFRLSDDLIYYSGEKDHPDLAWYS 176

Query: 181 KRIALSTAYVSSELFMAQDKSHNFQETMEFAQSKLNKVSQLGSMYNNTEEYLWFTLLSSI 240
           KR A++ AYVS+ LFMA+D+S   +ET+ FA+ +L +V  LG+ YNN EE+ W+ LL ++
Sbjct: 177 KRAAVAMAYVSTNLFMARDRSPALEETLHFARRRLQQVDSLGTAYNNVEEFAWYQLLMAM 236

Query: 241 NLAKSQITRG 250
           NL KSQ+TRG
Sbjct: 237 NLVKSQLTRG 246

>Ecym_4722 Chr4 complement(1413860..1414621) [762 bp, 253 aa] {ON}
           similar to Ashbya gossypii ACL147W
          Length = 253

 Score =  233 bits (595), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 113/246 (45%), Positives = 157/246 (63%), Gaps = 5/246 (2%)

Query: 5   FTRLYHPNNLEHALPKIIKPLTYGTDSVQFKVLSNALNKHVPQYGFNERAIVQSLNEXXX 64
           F R YH N+ E+A+   ++PL YG  S Q+KVL+ AL K+VP  GF + AIV + NE   
Sbjct: 13  FRRFYHVNSAEYAVGNTLRPLIYGRCSPQYKVLNCALEKYVPFKGFKDSAIVDAANELGY 72

Query: 65  XXXXXXXXXXXXXXXXXXXXXXXLELVKFHLVSKRNQLIXXXXXXXXXXXXXXXXXFLQR 124
                                   ELVKFHLV+KR  L                  FL+R
Sbjct: 73  NSAVLAAIGANNSPAMFNVSTSVQELVKFHLVTKRYGL-----QEDQEGTKTLEELFLKR 127

Query: 125 LKLNEHVAPHLSQLLSIMSVPGEFLASTALSELHKLTDDMIFYSNEQDHNDFAWYSKRIA 184
           L+ N+ + PHL ++LSI+++PG+FL +T L EL +L DDMI+YS E+D ND AWYSKR+A
Sbjct: 128 LEANKSLGPHLKEVLSILAIPGDFLVNTGLPELFQLADDMIYYSTEKDFNDLAWYSKRLA 187

Query: 185 LSTAYVSSELFMAQDKSHNFQETMEFAQSKLNKVSQLGSMYNNTEEYLWFTLLSSINLAK 244
           +S AY+S+ELFMA+D S NFQ TMEFA+ ++N++ ++G+ YNN EE+ WF LL+++NLA+
Sbjct: 188 VSMAYISTELFMAKDSSPNFQATMEFAKGRINQIDEMGTAYNNIEEFAWFQLLTTVNLAR 247

Query: 245 SQITRG 250
           SQ+ RG
Sbjct: 248 SQLVRG 253

>Kpol_530.30 s530 complement(75011..75793) [783 bp, 260 aa] {ON}
           complement(75011..75793) [783 nt, 261 aa]
          Length = 260

 Score =  232 bits (592), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 113/247 (45%), Positives = 158/247 (63%), Gaps = 1/247 (0%)

Query: 5   FTRLYHPNNLEHALPKIIKPLTYGTDSVQFKVLSNALNKHVPQYGFNERAIVQSLNEXXX 64
            TR YHPN  E+     + PL YG DS Q+K+LS++L+  VP++GFNERAIV S+N    
Sbjct: 14  LTRFYHPNPKEYVPQLTLPPLLYGKDSKQYKILSHSLDVSVPEFGFNERAIVNSINLLGY 73

Query: 65  XXXXXXXXXXXXXXXXXXXXXXXLELVKFHLVSKRNQLIXXXXXXXXXXXXXXXXXFL-Q 123
                                  +EL+KF+LV+KR QL                   L +
Sbjct: 74  PSSILSVIGSSNTPSFLHSSTALMELLKFNLVAKRYQLSEDIPLDTPVEELPSLEDLLIK 133

Query: 124 RLKLNEHVAPHLSQLLSIMSVPGEFLASTALSELHKLTDDMIFYSNEQDHNDFAWYSKRI 183
           RLK++  + PHLSQL++ +S+PG FL  T+L ELH+L DDMI++S+E+DH DFAWY+KR+
Sbjct: 134 RLKMDVPIGPHLSQLIAQLSIPGPFLTDTSLPELHRLADDMIYFSSEKDHPDFAWYAKRM 193

Query: 184 ALSTAYVSSELFMAQDKSHNFQETMEFAQSKLNKVSQLGSMYNNTEEYLWFTLLSSINLA 243
            +STAY+SS+LFMAQD+S  + +T EFA+ KL ++ +LG  YNN EEY W+ L++SIN+A
Sbjct: 194 GVSTAYMSSKLFMAQDRSPGYVDTFEFAKDKLKRIMKLGDYYNNAEEYAWYVLMNSINMA 253

Query: 244 KSQITRG 250
           KS+  RG
Sbjct: 254 KSKAARG 260

>Skud_12.265 Chr12 complement(496162..496944) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  231 bits (589), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 116/248 (46%), Positives = 162/248 (65%), Gaps = 2/248 (0%)

Query: 5   FTRLYHPNNLEHALPKIIKPLTYGTDSVQFKVLSNALNKHVPQYGFNERAIVQSLNEXXX 64
           F RLYH N +EH  P  IKPLTYG  S Q+KVLS AL ++VP++GF+ER+IV+SLN+   
Sbjct: 13  FHRLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSERSIVESLNKLGY 72

Query: 65  XXXXXXXXXXXXXXXXXXXXXXXLELVKFHLVSKRNQLIXXXXXXXXXXXXXXXXX--FL 122
                                  +ELVKF LV KR +L                     L
Sbjct: 73  PSSMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTSRYKLPSLEHLLL 132

Query: 123 QRLKLNEHVAPHLSQLLSIMSVPGEFLASTALSELHKLTDDMIFYSNEQDHNDFAWYSKR 182
           +RL++++ +   L+ L+S ++VP   L  TA+ ELH+L+DDMI++SNE+DH+D AWY+KR
Sbjct: 133 KRLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNEEDHHDSAWYAKR 192

Query: 183 IALSTAYVSSELFMAQDKSHNFQETMEFAQSKLNKVSQLGSMYNNTEEYLWFTLLSSINL 242
           +A+S+ Y+ S+LFMAQDKSH+F+ET  FA+ KL+KV +LG  YNNTEE+ W+TL+S++NL
Sbjct: 193 LAVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEEFAWYTLMSTVNL 252

Query: 243 AKSQITRG 250
            KSQ+ RG
Sbjct: 253 VKSQLARG 260

>CAGL0A03949g Chr1 (399220..400026) [807 bp, 268 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201c
          Length = 268

 Score =  229 bits (584), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 112/244 (45%), Positives = 155/244 (63%), Gaps = 1/244 (0%)

Query: 7   RLYHPNNLEHALPKIIKPLTYGTDSVQFKVLSNALNKHVPQYGFNERAIVQSLNEXXXXX 66
           R YHP + E+  PK+ +PLTY  +S +FK+LS+ +   VPQ+GF E+AIV SLN      
Sbjct: 24  RRYHPTSNEYVNPKVWEPLTYTPESPEFKLLSHTMENSVPQHGFTEKAIVNSLNAMKMPS 83

Query: 67  XXXXXXXXXXXXXXXXXXXXXLELVKFHLVSKRNQLIXXXXXXXXXXXXXXXXXFL-QRL 125
                                +EL+KF LV KR++++                  L +RL
Sbjct: 84  GMLTTIGASNSATFLHSSPAVMELIKFQLVEKRHRMVEGITEIAEASKLPSLESLLLKRL 143

Query: 126 KLNEHVAPHLSQLLSIMSVPGEFLASTALSELHKLTDDMIFYSNEQDHNDFAWYSKRIAL 185
           K++  +A HL+Q+ + + VP  F+ + +L EL +L DDMI+YSNE+DH+DFAWY+KR AL
Sbjct: 144 KMDVPIASHLTQMTAQLMVPSSFMTNVSLPELERLADDMIYYSNEKDHHDFAWYTKRAAL 203

Query: 186 STAYVSSELFMAQDKSHNFQETMEFAQSKLNKVSQLGSMYNNTEEYLWFTLLSSINLAKS 245
           +T Y++S+ FMAQDKSHNF ETMEFAQ KL+KV  LG  YNN EE+ WFTL+S++NL KS
Sbjct: 204 ATTYLASKAFMAQDKSHNFMETMEFAQDKLHKVMTLGDYYNNVEEFGWFTLMSAVNLTKS 263

Query: 246 QITR 249
           Q+ R
Sbjct: 264 QMAR 267

>Smik_12.260 Chr12 complement(496547..497329) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  228 bits (581), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 115/246 (46%), Positives = 165/246 (67%), Gaps = 2/246 (0%)

Query: 7   RLYHPNNLEHALPKIIKPLTYGTDSVQFKVLSNALNKHVPQYGFNERAIVQSLNEXXXXX 66
           RLYHPN +EH     IKPLTYG +S Q+KVLS AL ++VP++GF+ER+IV+SLNE     
Sbjct: 15  RLYHPNPIEHVKSHHIKPLTYGKESPQYKVLSLALEQYVPKHGFSERSIVESLNELGYPS 74

Query: 67  XXXXXXXXXXXXXXXXXXXXXLELVKFHLVSKRNQLIXXX--XXXXXXXXXXXXXXFLQR 124
                                +EL+KF LV KR +L                     L+R
Sbjct: 75  SMISSISASNSPSFFHSSTAVMELIKFQLVDKRYRLTEAINPDVTPQYKLPSLEHLLLRR 134

Query: 125 LKLNEHVAPHLSQLLSIMSVPGEFLASTALSELHKLTDDMIFYSNEQDHNDFAWYSKRIA 184
           L++++ +   LS+L+S +++P  FL  TA+ ELH+L+DDMI++SNE+DH+D AWY+KR+A
Sbjct: 135 LEMDKPIGGCLSELMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKRLA 194

Query: 185 LSTAYVSSELFMAQDKSHNFQETMEFAQSKLNKVSQLGSMYNNTEEYLWFTLLSSINLAK 244
           +S+ Y+ S+LFMAQDKSHN+++T +FA+ KLN+V +LG  YNNTEE+ W+TL+S++NL K
Sbjct: 195 VSSTYIGSKLFMAQDKSHNYKDTFDFAKHKLNRVMRLGEYYNNTEEFAWYTLMSTVNLVK 254

Query: 245 SQITRG 250
           SQ+ RG
Sbjct: 255 SQLVRG 260

>Suva_10.296 Chr10 complement(522345..523127) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  228 bits (580), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 113/246 (45%), Positives = 159/246 (64%), Gaps = 2/246 (0%)

Query: 7   RLYHPNNLEHALPKIIKPLTYGTDSVQFKVLSNALNKHVPQYGFNERAIVQSLNEXXXXX 66
           RLYH N +EH  P  IKPL YG  S Q+KVLS AL ++VP++GF ER+IV+SLN+     
Sbjct: 15  RLYHSNPIEHVNPLHIKPLAYGKQSPQYKVLSLALQEYVPKHGFTERSIVESLNKLGYPS 74

Query: 67  XXXXXXXXXXXXXXXXXXXXXLELVKFHLVSKRNQLIXXXXXXXXXXXXXXXXX--FLQR 124
                                +EL+KF LV KR +L                     L+R
Sbjct: 75  SMISSIGASNSPSFVHSSTAVMELLKFQLVDKRYRLTEGINPDVTPHYKLPSLEHLLLKR 134

Query: 125 LKLNEHVAPHLSQLLSIMSVPGEFLASTALSELHKLTDDMIFYSNEQDHNDFAWYSKRIA 184
           L++++ V   L+ L+S +++P  FL  TA+ ELH+L+DDMI++SNE+DH+D AWY+KR+A
Sbjct: 135 LEMDKPVGEQLTDLMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKRLA 194

Query: 185 LSTAYVSSELFMAQDKSHNFQETMEFAQSKLNKVSQLGSMYNNTEEYLWFTLLSSINLAK 244
           +S+ Y+ S+LFMAQDKSH+F ET  FA+ KL++V +LG  YNNTEE+ W+TL+S++NL K
Sbjct: 195 VSSTYIGSQLFMAQDKSHDFHETFAFAKDKLHRVMRLGEYYNNTEEFAWYTLMSTVNLVK 254

Query: 245 SQITRG 250
           SQ+ RG
Sbjct: 255 SQLARG 260

>TPHA0F02980 Chr6 (655375..656169) [795 bp, 264 aa] {ON} Anc_7.351
           YLR201C
          Length = 264

 Score =  214 bits (545), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 107/253 (42%), Positives = 159/253 (62%), Gaps = 4/253 (1%)

Query: 2   SRVFTRLYHPNNLEHALPKIIKPLTYGTDSVQFKVLSNALNKHVPQYGFNERAIVQSLNE 61
           S V  R +HP   E+ LP  + P TY  DS QFK+LS+A++  V ++GF+ERAI++++ E
Sbjct: 12  SGVNARFFHPATDEYVLPNKLSPCTYTKDSPQFKILSHAIDNTVTKFGFSERAIIEAMKE 71

Query: 62  XXXXXXXXXXXXXXXXXXXXX--XXXXXLELVKFHLVSKRNQLIXXXX--XXXXXXXXXX 117
                                       +EL+KF+LV KR ++I                
Sbjct: 72  LKIENQSTMLSAIGSSNSPSFLHSSPSVMELLKFNLVLKRYRMIEGLDPLTMQQEELPSL 131

Query: 118 XXXFLQRLKLNEHVAPHLSQLLSIMSVPGEFLASTALSELHKLTDDMIFYSNEQDHNDFA 177
               L+RL+++  +  H+S  +S + +PG FL  +AL ELH+L DDMI++SNE+DH+DFA
Sbjct: 132 ESLLLKRLEMDIPIGKHISAFMSQLVIPGPFLLDSALPELHRLADDMIYFSNEKDHHDFA 191

Query: 178 WYSKRIALSTAYVSSELFMAQDKSHNFQETMEFAQSKLNKVSQLGSMYNNTEEYLWFTLL 237
           WYSKR+ +S+AY+SS+LFMAQD S N++ET++FA+ KL KV +LG  YNNTEEY W+ LL
Sbjct: 192 WYSKRLGVSSAYISSKLFMAQDNSCNYKETLQFAKDKLEKVMRLGDYYNNTEEYAWYVLL 251

Query: 238 SSINLAKSQITRG 250
           +S+N+ KS+++R 
Sbjct: 252 NSVNMVKSRMSRA 264

>TBLA0E00450 Chr5 complement(83483..84322) [840 bp, 279 aa] {ON}
           Anc_7.351 YLR201C
          Length = 279

 Score =  209 bits (532), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 100/229 (43%), Positives = 150/229 (65%), Gaps = 1/229 (0%)

Query: 22  IKPLTYGTDSVQFKVLSNALNKHVPQYGFNERAIVQSLNEXXXXXXXXXXXXXXXXXXXX 81
           ++PL YG DS Q+++L +A+   VP +GF ERAI+ S+N+                    
Sbjct: 52  LEPLLYGKDSAQYRILEDAVQNSVPTFGFTERAIINSINKLGYNSSMISVLGSSNTHNIL 111

Query: 82  XXXXXXLELVKFHLVSKRNQLIXXXXXXXXXXXXXXXXXFLQRLKLNEHVAPHLSQLLSI 141
                 LEL+KF+LVSKR +L                   L+RL++++ +   L+++++ 
Sbjct: 112 HSSPAVLELLKFNLVSKRLKL-SEGIDPETKDLPSLEYLLLKRLQMDKAIQSRLNEMITK 170

Query: 142 MSVPGEFLASTALSELHKLTDDMIFYSNEQDHNDFAWYSKRIALSTAYVSSELFMAQDKS 201
           +S+PG FLA T++ EL +L+DDMI++SNE+DH+D AWYSKR+A+ST Y++S++FMAQD S
Sbjct: 171 LSIPGTFLAETSIPELFRLSDDMIYFSNEKDHHDMAWYSKRLAVSTTYIASQIFMAQDTS 230

Query: 202 HNFQETMEFAQSKLNKVSQLGSMYNNTEEYLWFTLLSSINLAKSQITRG 250
            +  +T+EFAQ KLNKV  LG  YNNTEE+LWFTL++S+N+ KSQ+ R 
Sbjct: 231 VDCYKTLEFAQDKLNKVMNLGEYYNNTEEFLWFTLMTSVNIVKSQLARS 279

>KAFR0L01480 Chr12 (274514..275308) [795 bp, 264 aa] {ON} Anc_7.351
           YLR201C
          Length = 264

 Score =  207 bits (527), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 106/247 (42%), Positives = 154/247 (62%), Gaps = 3/247 (1%)

Query: 3   RVFTRLYHPNNLEHALPKIIKPLTYGTDSVQFKVLSNALNKHVPQYGFNERAIVQSLNEX 62
           +   RLYHP + E+  P  I PLTY  DS+Q K+LS++L ++VP  GFNE++I++S+N+ 
Sbjct: 20  KCLRRLYHPASNEYVNPTTISPLTYSMDSIQSKILSHSLKEYVPTSGFNEKSILKSINDL 79

Query: 63  XXXXXXXXXXXXXXXXXXXXXXXXXLELVKFHLVSKRNQLIXXXXXXXXXXXXXXXXXFL 122
                                    LEL+K++LVSKR +L                    
Sbjct: 80  GYSSSMMSVIGASNSPSFAHSSPAVLELIKYNLVSKRIELTKDTNDNTTTTLKELLL--- 136

Query: 123 QRLKLNEHVAPHLSQLLSIMSVPGEFLASTALSELHKLTDDMIFYSNEQDHNDFAWYSKR 182
           +RL+++  ++  L  L + ++ PG+F+   +L EL +L DDMIF+SNE+DH+D AWYSKR
Sbjct: 137 KRLEMDIPISSQLRGLFAQLATPGKFMFDVSLPELFQLADDMIFFSNEKDHHDMAWYSKR 196

Query: 183 IALSTAYVSSELFMAQDKSHNFQETMEFAQSKLNKVSQLGSMYNNTEEYLWFTLLSSINL 242
           +A+S AYV+S++FM QD S+NFQ TM+FA  K+++V  LG  YNN EEY WFTL++SINL
Sbjct: 197 LAVSMAYVTSKMFMIQDTSNNFQMTMDFASDKVDRVMNLGEYYNNVEEYAWFTLMNSINL 256

Query: 243 AKSQITR 249
            KSQ +R
Sbjct: 257 VKSQFSR 263

>NCAS0E02870 Chr5 complement(561968..562753) [786 bp, 261 aa] {ON}
           Anc_7.351 YLR201C
          Length = 261

 Score =  202 bits (514), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 101/247 (40%), Positives = 149/247 (60%), Gaps = 3/247 (1%)

Query: 7   RLYHPNNLEHALPKIIKPLTYGTDSVQFKVLSNALNKHVPQYGFNERAIVQSLNEXXXXX 66
           R YHP+  E+  P  + PLTY  +SVQ+K+LSNAL K VP++GF E+AI  SLNE     
Sbjct: 15  RSYHPSLKEYVKPATLSPLTYNKESVQYKILSNALTKWVPKHGFKEKAITDSLNELGFSS 74

Query: 67  XXXXXXXXXXXXXX-XXXXXXXLELVKFHLVSKRNQLIX--XXXXXXXXXXXXXXXXFLQ 123
                                 +EL+KF LVSKR +L                     L+
Sbjct: 75  SLLSVIGASNSPAIFRSISPAVMELIKFQLVSKRYELTENLCPDTTPKNELPSLESLLLK 134

Query: 124 RLKLNEHVAPHLSQLLSIMSVPGEFLASTALSELHKLTDDMIFYSNEQDHNDFAWYSKRI 183
           RL++++ +   +  L + ++ P  FL   AL ELH+L+DDMI++SNE+DH+D AWY+KR+
Sbjct: 135 RLEMDKAIGKQIPHLFAELATPSSFLFDVALPELHRLSDDMIYFSNEKDHHDMAWYTKRL 194

Query: 184 ALSTAYVSSELFMAQDKSHNFQETMEFAQSKLNKVSQLGSMYNNTEEYLWFTLLSSINLA 243
            +S AYVSS+L+MAQD S +F++T+ FA+ KL+++ +LG  YNNTEEY W+  + S NL 
Sbjct: 195 GVSCAYVSSKLYMAQDNSRDFEDTLSFAKDKLHRIMKLGEYYNNTEEYAWYMFMVSTNLV 254

Query: 244 KSQITRG 250
           ++++ R 
Sbjct: 255 RARLARS 261

>NDAI0E04470 Chr5 complement(1006109..1006903) [795 bp, 264 aa] {ON}
           Anc_7.351 YLR201C
          Length = 264

 Score =  201 bits (510), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 104/248 (41%), Positives = 149/248 (60%), Gaps = 4/248 (1%)

Query: 7   RLYHPNNLEHALPKIIKPLTYGTDSVQFKVLSNALNKHVPQYGFNERAIVQSLNEXXXXX 66
           R +H N LE+A    + PLTY  DSVQ+K+LSNALNK VP+ GF + AI  SLNE     
Sbjct: 17  RAFHSNTLEYAKAATLSPLTYNKDSVQYKILSNALNKWVPKKGFTDEAITSSLNELDLSS 76

Query: 67  XXXXXXXXXXXXXX-XXXXXXXLELVKFHLVSKRNQL---IXXXXXXXXXXXXXXXXXFL 122
                                 +EL+KF LVSKR QL   I                  +
Sbjct: 77  SLFSVLGSSNSPSIFRSISPAVMELLKFQLVSKRYQLTENITPYIETAKDKLPSLETLLI 136

Query: 123 QRLKLNEHVAPHLSQLLSIMSVPGEFLASTALSELHKLTDDMIFYSNEQDHNDFAWYSKR 182
           +RLK+++ +   LS L + + +P   L + AL EL  L+DD+I++SNE+DH+D AWY+KR
Sbjct: 137 ERLKMDQPLNNQLSSLFNQLIIPSPLLFNVALPELFNLSDDLIYFSNEKDHHDMAWYAKR 196

Query: 183 IALSTAYVSSELFMAQDKSHNFQETMEFAQSKLNKVSQLGSMYNNTEEYLWFTLLSSINL 242
           + +S AYVSS+L+M ++   NF +T++FA+ KL+++  LG  YNNTEEY W+TL+ S+NL
Sbjct: 197 LGVSCAYVSSKLYMVKNNGENFDKTIDFAKDKLHRIMNLGEYYNNTEEYAWYTLMVSMNL 256

Query: 243 AKSQITRG 250
            K+++ RG
Sbjct: 257 VKARLARG 264

>KNAG0B02620 Chr2 complement(507597..508394) [798 bp, 265 aa] {ON}
           Anc_7.351 YLR201C
          Length = 265

 Score =  195 bits (495), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 94/247 (38%), Positives = 150/247 (60%), Gaps = 3/247 (1%)

Query: 6   TRLYHPNNLEHALPKIIKPLTYGTDSVQFKVLSNALNKHVPQYGFNERAIVQSLNEXXXX 65
           TRLYHPN +E+A   ++ PLTY  DS Q ++L++ L   VP +GF ERA+++S+      
Sbjct: 18  TRLYHPNPIEYANSTVVAPLTYTMDSPQSRILTHCLQNEVPHWGFTERALLKSIQAVGYD 77

Query: 66  XXXXXXXXXXXXXXXXXXXXXXLELVKFHLVSKRNQL---IXXXXXXXXXXXXXXXXXFL 122
                                 +ELVKF+LV KR+ L   +                  +
Sbjct: 78  SSMMSVLGASNSPSIFHSSPAVMELVKFNLVKKRHALTESLAAAGLGSPAALPSLEHLLV 137

Query: 123 QRLKLNEHVAPHLSQLLSIMSVPGEFLASTALSELHKLTDDMIFYSNEQDHNDFAWYSKR 182
           +RL+++  ++  L  L + +++P +F+ + A+ EL +L+DDMI++SNE+DH D AWYSKR
Sbjct: 138 KRLQMDVPLSKQLGDLFTQLALPSQFMVNVAVPELFRLSDDMIYFSNEKDHFDTAWYSKR 197

Query: 183 IALSTAYVSSELFMAQDKSHNFQETMEFAQSKLNKVSQLGSMYNNTEEYLWFTLLSSINL 242
           + +S AY +S+LFMAQD S N Q+T+EFA+ KL+++  LG  YNN EEY W+++++++N 
Sbjct: 198 LGVSLAYTTSKLFMAQDNSLNCQDTIEFARDKLHRIMTLGEYYNNVEEYAWYSIMTTVNR 257

Query: 243 AKSQITR 249
           AK+  +R
Sbjct: 258 AKAGFSR 264

>TPHA0F03540 Chr6 (762007..764922) [2916 bp, 971 aa] {ON} Anc_1.509
           YJR061W
          Length = 971

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 23/39 (58%)

Query: 154 LSELHKLTDDMIFYSNEQDHNDFAWYSKRIALSTAYVSS 192
           L+E+ K  D  +F+ +   +ND  WYSK+  +S  +V S
Sbjct: 215 LAEIEKEIDSPLFHKDRMKYNDMKWYSKQRRMSETHVFS 253

>KLLA0B14058g Chr2 complement(1237669..1238253) [585 bp, 194 aa]
           {ON} similar to uniprot|P47119 Saccharomyces cerevisiae
           YJR069C HAM1 Protein of unknown function that is
           involved in DNA repair mutant is sensitive to the base
           analog 6-N- hydroxylaminopurine while gene disruption
           does not increase the rate of spontaneous mutagenesis
          Length = 194

 Score = 29.3 bits (64), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 28/67 (41%), Gaps = 14/67 (20%)

Query: 169 NEQDHNDFAWYSKRIALSTAYVSSELFMAQDKSHNFQETMEFAQSKLNKVSQLGSMYNNT 228
           + + H +F W S                  D+S N +   E A+   NK+SQ G  +   
Sbjct: 140 DSRGHTNFGWDS--------------IFQPDESQNNETYAEMAKEDKNKISQRGRAFAQL 185

Query: 229 EEYLWFT 235
           +EYL+ T
Sbjct: 186 KEYLYNT 192

>TPHA0I03140 Chr9 (697331..697990) [660 bp, 219 aa] {ON} Anc_7.521
          Length = 219

 Score = 29.3 bits (64), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 1/46 (2%)

Query: 159 KLTDDMIFYSNEQDHNDFAWYSKRIALSTAYVSSELFMAQDKSHNF 204
           KLTD   F SN   HNDF +  K + +  AY      +   +S+ F
Sbjct: 5   KLTDTS-FSSNTSTHNDFRYNKKLVIVGDAYTGKTALLVACRSNQF 49

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.131    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 20,431,279
Number of extensions: 695208
Number of successful extensions: 2424
Number of sequences better than 10.0: 35
Number of HSP's gapped: 2452
Number of HSP's successfully gapped: 35
Length of query: 250
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 143
Effective length of database: 41,212,137
Effective search space: 5893335591
Effective search space used: 5893335591
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)