Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D12298g7.352ON1151075376e-72
Ecym_47217.352ON1071073856e-49
TPHA0F029907.352ON1071033803e-48
ACL146C7.352ON1071073804e-48
KAFR0L014907.352ON1071033725e-47
Suva_10.2957.352ON114993683e-46
SAKL0F11418g7.352ON1151073674e-46
Kpol_530.297.352ON1071013657e-46
Kwal_56.246487.352ON1131033571e-44
ZYRO0F11748g7.352ON1091033562e-44
Skud_12.2647.352ON114983562e-44
Smik_12.2597.352ON114993511e-43
YLR200W (YKE2)7.352ON114993502e-43
NDAI0E044607.352ON1061043474e-43
CAGL0A03971g7.352ON1061033459e-43
TDEL0C019607.352ON107983441e-42
KLTH0H01210g7.352ON1131033406e-42
KNAG0B026107.352ON119983372e-41
TBLA0E004407.352ON1151033363e-41
NCAS0E028607.352ON105993336e-41
TBLA0A098806.100ON109794680.59
Skud_2.47.441ON115126616.0
KLTH0C05346g7.447ON10228587.4
TBLA0D046107.186ON117434608.0
KLLA0E06447g7.441ON116126608.2
ACR191C7.441ON114942608.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D12298g
         (115 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D12298g Chr4 (1048089..1048436) [348 bp, 115 aa] {ON} simil...   211   6e-72
Ecym_4721 Chr4 (1413362..1413685) [324 bp, 107 aa] {ON} similar ...   152   6e-49
TPHA0F02990 Chr6 complement(656466..656789) [324 bp, 107 aa] {ON...   150   3e-48
ACL146C Chr3 complement(93269..93592) [324 bp, 107 aa] {ON} Synt...   150   4e-48
KAFR0L01490 Chr12 complement(275355..275678) [324 bp, 107 aa] {O...   147   5e-47
Suva_10.295 Chr10 (521814..522158) [345 bp, 114 aa] {ON} YLR200W...   146   3e-46
SAKL0F11418g Chr6 complement(887825..888172) [348 bp, 115 aa] {O...   145   4e-46
Kpol_530.29 s530 (74361..74684) [324 bp, 107 aa] {ON} (74361..74...   145   7e-46
Kwal_56.24648 s56 complement(1088138..1088479) [342 bp, 113 aa] ...   142   1e-44
ZYRO0F11748g Chr6 complement(960734..961063) [330 bp, 109 aa] {O...   141   2e-44
Skud_12.264 Chr12 (495654..495998) [345 bp, 114 aa] {ON} YLR200W...   141   2e-44
Smik_12.259 Chr12 (496033..496377) [345 bp, 114 aa] {ON} YLR200W...   139   1e-43
YLR200W Chr12 (549012..549356) [345 bp, 114 aa] {ON}  YKE2Subuni...   139   2e-43
NDAI0E04460 Chr5 (1005674..1005994) [321 bp, 106 aa] {ON} Anc_7....   138   4e-43
CAGL0A03971g Chr1 complement(400291..400611) [321 bp, 106 aa] {O...   137   9e-43
TDEL0C01960 Chr3 (343261..343584) [324 bp, 107 aa] {ON} Anc_7.35...   137   1e-42
KLTH0H01210g Chr8 (119243..119584) [342 bp, 113 aa] {ON} similar...   135   6e-42
KNAG0B02610 Chr2 (507118..507477) [360 bp, 119 aa] {ON} Anc_7.35...   134   2e-41
TBLA0E00440 Chr5 (82880..83227) [348 bp, 115 aa] {ON} Anc_7.352 ...   134   3e-41
NCAS0E02860 Chr5 (561551..561868) [318 bp, 105 aa] {ON} Anc_7.35...   132   6e-41
TBLA0A09880 Chr1 (2428069..2431362) [3294 bp, 1097 aa] {ON} Anc_...    31   0.59 
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...    28   6.0  
KLTH0C05346g Chr3 (460241..460549) [309 bp, 102 aa] {ON} similar...    27   7.4  
TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]...    28   8.0  
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...    28   8.2  
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...    28   8.8  

>KLLA0D12298g Chr4 (1048089..1048436) [348 bp, 115 aa] {ON} similar
           to uniprot|P52553 Saccharomyces cerevisiae YLR200W YKE2
           Yeast nuclear gene
          Length = 115

 Score =  211 bits (537), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 107/107 (100%), Positives = 107/107 (100%)

Query: 1   MSAEETTQKYTKLQGELEELIVARQKLETQLQENKIVSDEFSSLKDDATVYKLTGGVLLP 60
           MSAEETTQKYTKLQGELEELIVARQKLETQLQENKIVSDEFSSLKDDATVYKLTGGVLLP
Sbjct: 1   MSAEETTQKYTKLQGELEELIVARQKLETQLQENKIVSDEFSSLKDDATVYKLTGGVLLP 60

Query: 61  VEQFEAKGNVEKRLEFIEIEIKRCETNIKSKQQELEVARSELMKLRS 107
           VEQFEAKGNVEKRLEFIEIEIKRCETNIKSKQQELEVARSELMKLRS
Sbjct: 61  VEQFEAKGNVEKRLEFIEIEIKRCETNIKSKQQELEVARSELMKLRS 107

>Ecym_4721 Chr4 (1413362..1413685) [324 bp, 107 aa] {ON} similar to
           Ashbya gossypii ACL146C
          Length = 107

 Score =  152 bits (385), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 79/107 (73%), Positives = 88/107 (82%)

Query: 1   MSAEETTQKYTKLQGELEELIVARQKLETQLQENKIVSDEFSSLKDDATVYKLTGGVLLP 60
           MS E+   KYT+LQGELE+LIV RQKLETQLQENKIV++E  SLK+D  VYKLTGGVLLP
Sbjct: 1   MSVEQVAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLP 60

Query: 61  VEQFEAKGNVEKRLEFIEIEIKRCETNIKSKQQELEVARSELMKLRS 107
           VE  EA  NV KRLEFI+ EI RCE NIK+KQQELE AR EL+KLRS
Sbjct: 61  VEHEEANSNVSKRLEFIQGEIDRCEGNIKNKQQELEQARDELIKLRS 107

>TPHA0F02990 Chr6 complement(656466..656789) [324 bp, 107 aa] {ON}
           Anc_7.352 YLR200W
          Length = 107

 Score =  150 bits (380), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 73/103 (70%), Positives = 85/103 (82%)

Query: 5   ETTQKYTKLQGELEELIVARQKLETQLQENKIVSDEFSSLKDDATVYKLTGGVLLPVEQF 64
           +   KY  +QGELEELI+ARQKLETQLQENKIV+DEF+ L +D  +YKLTG V+LP+EQF
Sbjct: 3   DVAAKYQSVQGELEELIIARQKLETQLQENKIVNDEFNDLNEDTPIYKLTGNVMLPIEQF 62

Query: 65  EAKGNVEKRLEFIEIEIKRCETNIKSKQQELEVARSELMKLRS 107
           EAK NVEKRLEFIE EIKRCE NIK+KQ EL+  R ELMK+R 
Sbjct: 63  EAKSNVEKRLEFIENEIKRCEENIKTKQDELDKLRGELMKMRG 105

>ACL146C Chr3 complement(93269..93592) [324 bp, 107 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR200W
           (YKE2)
          Length = 107

 Score =  150 bits (380), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 90/107 (84%)

Query: 1   MSAEETTQKYTKLQGELEELIVARQKLETQLQENKIVSDEFSSLKDDATVYKLTGGVLLP 60
           MSAE+   KYT+LQGELEEL+V RQKLETQLQENKIV++E  +L+ +  VYKLTGGVLLP
Sbjct: 1   MSAEQVATKYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGVLLP 60

Query: 61  VEQFEAKGNVEKRLEFIEIEIKRCETNIKSKQQELEVARSELMKLRS 107
           VEQ EA+GNV KRLEFIE EI+RCE NIK KQ+E+E AR+ L+KLR 
Sbjct: 61  VEQEEAEGNVSKRLEFIEGEIRRCEQNIKQKQEEMEGARAALVKLRG 107

>KAFR0L01490 Chr12 complement(275355..275678) [324 bp, 107 aa] {ON}
           Anc_7.352 YLR200W
          Length = 107

 Score =  147 bits (372), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 77/103 (74%), Positives = 87/103 (84%)

Query: 5   ETTQKYTKLQGELEELIVARQKLETQLQENKIVSDEFSSLKDDATVYKLTGGVLLPVEQF 64
           E   +Y KLQ ELEELIVARQKLETQLQENKIV+DEF SLK++  VYKLTG VLLP+EQ 
Sbjct: 3   ELAAQYQKLQSELEELIVARQKLETQLQENKIVNDEFKSLKEETQVYKLTGNVLLPIEQD 62

Query: 65  EAKGNVEKRLEFIEIEIKRCETNIKSKQQELEVARSELMKLRS 107
           EA+GNV+KRLEFIE EI RCE NIKSKQ E+E  R+EL+KLRS
Sbjct: 63  EARGNVDKRLEFIEKEITRCEGNIKSKQTEIENIRNELVKLRS 105

>Suva_10.295 Chr10 (521814..522158) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  146 bits (368), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 74/99 (74%), Positives = 83/99 (83%)

Query: 9   KYTKLQGELEELIVARQKLETQLQENKIVSDEFSSLKDDATVYKLTGGVLLPVEQFEAKG 68
           KY  LQ ELEE IVARQKLETQLQENKIV++EF  LK+D  VYKLTG VLLPVEQ EA+G
Sbjct: 7   KYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNVLLPVEQSEARG 66

Query: 69  NVEKRLEFIEIEIKRCETNIKSKQQELEVARSELMKLRS 107
           NVEKRLEFIE EIKRCE NI+ KQ+ELE  R+EL+KL +
Sbjct: 67  NVEKRLEFIETEIKRCEKNIRGKQEELEQVRNELVKLNN 105

>SAKL0F11418g Chr6 complement(887825..888172) [348 bp, 115 aa] {ON}
           similar to uniprot|P52553 Saccharomyces cerevisiae
           YLR200W YKE2 Yeast nuclear gene
          Length = 115

 Score =  145 bits (367), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 92/107 (85%)

Query: 1   MSAEETTQKYTKLQGELEELIVARQKLETQLQENKIVSDEFSSLKDDATVYKLTGGVLLP 60
           ++A++ + +YT +Q ELE+L++ARQKLETQLQENKIV DEF +L+D++ VYKLTGGVLLP
Sbjct: 4   LNAQKLSMQYTTMQSELEDLVIARQKLETQLQENKIVQDEFDTLRDESQVYKLTGGVLLP 63

Query: 61  VEQFEAKGNVEKRLEFIEIEIKRCETNIKSKQQELEVARSELMKLRS 107
           VEQ EAKGNVEKRL+FI+ EI RCE NIK KQ +LE  R+EL++LR+
Sbjct: 64  VEQEEAKGNVEKRLQFIKNEITRCEENIKEKQTQLERLRNELVRLRT 110

>Kpol_530.29 s530 (74361..74684) [324 bp, 107 aa] {ON}
           (74361..74684) [324 nt, 108 aa]
          Length = 107

 Score =  145 bits (365), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 83/101 (82%)

Query: 7   TQKYTKLQGELEELIVARQKLETQLQENKIVSDEFSSLKDDATVYKLTGGVLLPVEQFEA 66
             KY K+QGELEE+IVAR++LETQLQENKIV++EF  LK+D  VYKLTG VLLPVEQFEA
Sbjct: 5   ANKYQKIQGELEEVIVARRQLETQLQENKIVNEEFEGLKEDTQVYKLTGNVLLPVEQFEA 64

Query: 67  KGNVEKRLEFIEIEIKRCETNIKSKQQELEVARSELMKLRS 107
           + NVEKRLEFIE EIK+CE NIKSKQ EL   R ELMK R 
Sbjct: 65  RSNVEKRLEFIEAEIKKCEDNIKSKQTELNKLRDELMKGRG 105

>Kwal_56.24648 s56 complement(1088138..1088479) [342 bp, 113 aa]
           {ON} YLR200W (YKE2) - Polypeptide 6 of a Yeast
           Non-native Actin Binding Complex, homolog of a component
           of the bovine NABC complex [contig 161] FULL
          Length = 113

 Score =  142 bits (357), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 73/103 (70%), Positives = 82/103 (79%)

Query: 2   SAEETTQKYTKLQGELEELIVARQKLETQLQENKIVSDEFSSLKDDATVYKLTGGVLLPV 61
           SA+E T  YT  Q ELEEL+ ARQ+LETQLQENKIV DEF SLK++  VYKLTG VLLPV
Sbjct: 4   SAQELTMNYTTAQQELEELVTARQRLETQLQENKIVQDEFDSLKEETQVYKLTGKVLLPV 63

Query: 62  EQFEAKGNVEKRLEFIEIEIKRCETNIKSKQQELEVARSELMK 104
           EQFEAK NV KRLEFI  EIKRCE NIK+KQ  LE  R+EL++
Sbjct: 64  EQFEAKSNVSKRLEFINTEIKRCEDNIKNKQSLLEKLRAELLQ 106

>ZYRO0F11748g Chr6 complement(960734..961063) [330 bp, 109 aa] {ON}
           highly similar to uniprot|P52553 Saccharomyces
           cerevisiae YLR200W YKE2 Yeast nuclear gene
          Length = 109

 Score =  141 bits (356), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 72/103 (69%), Positives = 82/103 (79%)

Query: 5   ETTQKYTKLQGELEELIVARQKLETQLQENKIVSDEFSSLKDDATVYKLTGGVLLPVEQF 64
           E   +Y KLQGELE  IVARQKLETQLQENKIV DEF+ LK D+ VYKLTG VLLPVEQ 
Sbjct: 3   ELAAQYQKLQGELENFIVARQKLETQLQENKIVDDEFNGLKSDSKVYKLTGNVLLPVEQD 62

Query: 65  EAKGNVEKRLEFIEIEIKRCETNIKSKQQELEVARSELMKLRS 107
           +A+ NV KRLEFI+ EI RCE NIK KQ+E E  ++EL+KLRS
Sbjct: 63  DARTNVSKRLEFIQTEIDRCENNIKGKQEEQERVKAELIKLRS 105

>Skud_12.264 Chr12 (495654..495998) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  141 bits (356), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 80/98 (81%)

Query: 10  YTKLQGELEELIVARQKLETQLQENKIVSDEFSSLKDDATVYKLTGGVLLPVEQFEAKGN 69
           Y  LQ ELEE IVARQKLETQLQENKIV++EF  + DD  VYKLTG VLLPVEQ EA+GN
Sbjct: 8   YQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNVLLPVEQSEARGN 67

Query: 70  VEKRLEFIEIEIKRCETNIKSKQQELEVARSELMKLRS 107
           V+KRLEFIE EIKRCE NI+ KQ ELE  R+EL+KL +
Sbjct: 68  VDKRLEFIETEIKRCERNIREKQDELEKVRNELIKLNN 105

>Smik_12.259 Chr12 (496033..496377) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  139 bits (351), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 69/99 (69%), Positives = 83/99 (83%)

Query: 9   KYTKLQGELEELIVARQKLETQLQENKIVSDEFSSLKDDATVYKLTGGVLLPVEQFEAKG 68
           KY  LQGELEE IVARQKLETQLQENKIV++EF  L+++  VYKLTG VLLPV+Q EA+G
Sbjct: 7   KYQHLQGELEEFIVARQKLETQLQENKIVNEEFDQLEENTPVYKLTGNVLLPVDQSEARG 66

Query: 69  NVEKRLEFIEIEIKRCETNIKSKQQELEVARSELMKLRS 107
           NV+KRLEFIE EI RCE NIK KQ++LE  R++L+KL +
Sbjct: 67  NVDKRLEFIEAEITRCEKNIKDKQEQLEKVRNDLIKLNN 105

>YLR200W Chr12 (549012..549356) [345 bp, 114 aa] {ON}  YKE2Subunit
           of the heterohexameric Gim/prefoldin protein complex
           involved in the folding of alpha-tubulin, beta-tubulin,
           and actin
          Length = 114

 Score =  139 bits (350), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 71/99 (71%), Positives = 82/99 (82%)

Query: 9   KYTKLQGELEELIVARQKLETQLQENKIVSDEFSSLKDDATVYKLTGGVLLPVEQFEAKG 68
           KY +LQ ELEE IVARQKLETQLQENKIV++EF  L++D  VYKLTG VLLPVEQ EA+ 
Sbjct: 7   KYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVEQSEART 66

Query: 69  NVEKRLEFIEIEIKRCETNIKSKQQELEVARSELMKLRS 107
           NV+KRLEFIE EI RCE NI+ KQ+ELE  RSEL+KL +
Sbjct: 67  NVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIKLNN 105

>NDAI0E04460 Chr5 (1005674..1005994) [321 bp, 106 aa] {ON} Anc_7.352
           YLR200W
          Length = 106

 Score =  138 bits (347), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 83/104 (79%)

Query: 3   AEETTQKYTKLQGELEELIVARQKLETQLQENKIVSDEFSSLKDDATVYKLTGGVLLPVE 62
           A     KY  LQGELE+LI+ARQKLETQLQENKIV +EF+ L  ++ VYKLTG VLLPV+
Sbjct: 2   ASNLPSKYQVLQGELEDLIMARQKLETQLQENKIVIEEFNQLPSESQVYKLTGNVLLPVD 61

Query: 63  QFEAKGNVEKRLEFIEIEIKRCETNIKSKQQELEVARSELMKLR 106
           Q EA  NV+KRLEFI+ EI RCE NIK+KQQEL+  RSE++K+R
Sbjct: 62  QEEAHSNVDKRLEFIQTEISRCENNIKNKQQELDNVRSEILKMR 105

>CAGL0A03971g Chr1 complement(400291..400611) [321 bp, 106 aa] {ON}
           similar to uniprot|P52553 Saccharomyces cerevisiae
           YLR200w YKE2 Gim complex component
          Length = 106

 Score =  137 bits (345), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 72/103 (69%), Positives = 83/103 (80%), Gaps = 1/103 (0%)

Query: 1   MSAEETTQKYTKLQGELEELIVARQKLETQLQENKIVSDEFSSLKDDATVYKLTGGVLLP 60
           MSAE    KY  LQ ELEEL+ ARQKLETQLQENKIV++EF++LK+D  VYKLTG VLLP
Sbjct: 1   MSAE-LGAKYQSLQNELEELVTARQKLETQLQENKIVNEEFATLKEDTVVYKLTGNVLLP 59

Query: 61  VEQFEAKGNVEKRLEFIEIEIKRCETNIKSKQQELEVARSELM 103
           VE  +AK NV+KRLEFI  EIKRCE NI+SKQQELE  R +L+
Sbjct: 60  VEHDDAKNNVDKRLEFIGEEIKRCEDNIRSKQQELETIRGQLI 102

>TDEL0C01960 Chr3 (343261..343584) [324 bp, 107 aa] {ON} Anc_7.352
           YLR200W
          Length = 107

 Score =  137 bits (344), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 79/98 (80%)

Query: 10  YTKLQGELEELIVARQKLETQLQENKIVSDEFSSLKDDATVYKLTGGVLLPVEQFEAKGN 69
           Y  LQ ELE L++ARQKLETQLQENKIVS+EFS LK+D  VYKLTG VLLPVEQ EA  N
Sbjct: 8   YQALQSELEVLVIARQKLETQLQENKIVSEEFSELKEDTQVYKLTGNVLLPVEQSEANSN 67

Query: 70  VEKRLEFIEIEIKRCETNIKSKQQELEVARSELMKLRS 107
           V KRLEFI+ EI RCE N+K+KQQE E  R+EL+KLR 
Sbjct: 68  VAKRLEFIQTEIGRCENNLKAKQQEQEKLRAELIKLRG 105

>KLTH0H01210g Chr8 (119243..119584) [342 bp, 113 aa] {ON} similar to
           uniprot|P52553 Saccharomyces cerevisiae YLR200W YKE2
           Yeast nuclear gene
          Length = 113

 Score =  135 bits (340), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 69/103 (66%), Positives = 80/103 (77%)

Query: 2   SAEETTQKYTKLQGELEELIVARQKLETQLQENKIVSDEFSSLKDDATVYKLTGGVLLPV 61
           SA++ T  Y   Q ELEEL++ARQKLETQLQENKIV DEF  L+++  VYKLTG VLLPV
Sbjct: 4   SAQDLTMNYNTSQHELEELVIARQKLETQLQENKIVQDEFDGLREETQVYKLTGNVLLPV 63

Query: 62  EQFEAKGNVEKRLEFIEIEIKRCETNIKSKQQELEVARSELMK 104
           EQFEAK NV KRLEFI  EI RCE NIK+KQ  LE  R+EL++
Sbjct: 64  EQFEAKSNVSKRLEFITAEINRCEENIKTKQGLLEKLRAELLQ 106

>KNAG0B02610 Chr2 (507118..507477) [360 bp, 119 aa] {ON} Anc_7.352
           YLR200W
          Length = 119

 Score =  134 bits (337), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 80/98 (81%)

Query: 9   KYTKLQGELEELIVARQKLETQLQENKIVSDEFSSLKDDATVYKLTGGVLLPVEQFEAKG 68
           KY K Q  LEELIVARQKLETQLQENKIV +EF +LK+D+ VYKLTG VLLPV+Q EA+ 
Sbjct: 7   KYQKAQSALEELIVARQKLETQLQENKIVIEEFDALKEDSKVYKLTGSVLLPVDQDEART 66

Query: 69  NVEKRLEFIEIEIKRCETNIKSKQQELEVARSELMKLR 106
           NV+KRLEFI  EI RCE NIK KQ+ LE  RSELMKL+
Sbjct: 67  NVDKRLEFINGEIDRCEENIKEKQETLEGLRSELMKLQ 104

>TBLA0E00440 Chr5 (82880..83227) [348 bp, 115 aa] {ON} Anc_7.352
           YLR200W
          Length = 115

 Score =  134 bits (336), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 79/103 (76%)

Query: 1   MSAEETTQKYTKLQGELEELIVARQKLETQLQENKIVSDEFSSLKDDATVYKLTGGVLLP 60
           MS+ E   KY   Q ELE  IV RQKLETQLQENKIV+DEF  LK++  V+KLTG VLLP
Sbjct: 1   MSSNELATKYQTFQNELEGFIVTRQKLETQLQENKIVNDEFEKLKEETKVFKLTGNVLLP 60

Query: 61  VEQFEAKGNVEKRLEFIEIEIKRCETNIKSKQQELEVARSELM 103
           +EQ EA+ N++KRLEFI+ EI RCE NIK+KQ E+E  RSELM
Sbjct: 61  IEQDEARSNIDKRLEFIQTEIDRCEKNIKAKQAEMEKIRSELM 103

>NCAS0E02860 Chr5 (561551..561868) [318 bp, 105 aa] {ON} Anc_7.352
           YLR200W
          Length = 105

 Score =  132 bits (333), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 67/99 (67%), Positives = 78/99 (78%)

Query: 9   KYTKLQGELEELIVARQKLETQLQENKIVSDEFSSLKDDATVYKLTGGVLLPVEQFEAKG 68
           +Y  LQ ELE  I+ARQKLETQLQENKIV DEF  L D+  VYKLTG VLLPVEQ EA+ 
Sbjct: 7   QYQSLQSELESFIIARQKLETQLQENKIVMDEFEQLVDETKVYKLTGNVLLPVEQDEARS 66

Query: 69  NVEKRLEFIEIEIKRCETNIKSKQQELEVARSELMKLRS 107
           NVEKRLEFI+ EI +CE NIK KQ+ELE  R+E++K+R 
Sbjct: 67  NVEKRLEFIQSEITKCEKNIKQKQEELEKVRAEIIKMRG 105

>TBLA0A09880 Chr1 (2428069..2431362) [3294 bp, 1097 aa] {ON}
           Anc_6.100 YOR191W
          Length = 1097

 Score = 30.8 bits (68), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 45/94 (47%), Gaps = 17/94 (18%)

Query: 7   TQKYTKLQ------------GELEELIVARQKLETQLQENKIVSDEFSSLKDDATVYKLT 54
           TQ YTKLQ             E +ELI  ++KLE  + +  I  D F+SL  D  + KL 
Sbjct: 46  TQIYTKLQYAKRNRNTNTIISERQELIKEKRKLEDLMDQGLISFDSFNSLSKD--IQKLN 103

Query: 55  GGVLLPVEQFEAKGNVEKRLEFIEIEIKRCETNI 88
               L V++     N +KR   IEIE  + E N+
Sbjct: 104 N---LQVQKDVGSSNRKKRQLIIEIEKVKKENNL 134

>Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON}
           YBL105C (REAL)
          Length = 1151

 Score = 28.1 bits (61), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 17/26 (65%)

Query: 81  IKRCETNIKSKQQELEVARSELMKLR 106
           I++C TNI+  +Q LE  +  L KLR
Sbjct: 37  IQKCNTNIREARQNLEYLQDNLKKLR 62

>KLTH0C05346g Chr3 (460241..460549) [309 bp, 102 aa] {ON} similar
          to uniprot|P47128 Saccharomyces cerevisiae YJR082C EAF6
          Esa1p-associated factor subunit of the NuA4
          acetyltransferase complex
          Length = 102

 Score = 26.9 bits (58), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 18/28 (64%)

Query: 4  EETTQKYTKLQGELEELIVARQKLETQL 31
          +E  Q Y KL+ EL+E +V R+ LE Q 
Sbjct: 2  DEAHQHYQKLKQELQEALVDRETLEKQW 29

>TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]
           {ON} Anc_7.186 YFR031C
          Length = 1174

 Score = 27.7 bits (60), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 23/34 (67%)

Query: 72  KRLEFIEIEIKRCETNIKSKQQELEVARSELMKL 105
           KR E I +EIK CE +I  +Q +LE  ++ ++++
Sbjct: 749 KRNEAISLEIKSCENSITQEQNKLESIQNSIIQI 782

>KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa]
           {ON} uniprot|Q8J213 Kluyveromyces lactis KLLA0E06413g
           PKC1 Protein kinase C
          Length = 1161

 Score = 27.7 bits (60), Expect = 8.2,   Method: Composition-based stats.
 Identities = 12/26 (46%), Positives = 16/26 (61%)

Query: 81  IKRCETNIKSKQQELEVARSELMKLR 106
           I++C TNI+  QQ +E     L KLR
Sbjct: 43  IQKCNTNIREAQQNIEYLEQILAKLR 68

>ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL105C
           (PKC1)
          Length = 1149

 Score = 27.7 bits (60), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 65  EAKGNVEKRLEFIEIEIKRCETNIKSKQQELEVARSELMKLR 106
           +   N++KR + + + I++C TNI+  QQ ++     L KL 
Sbjct: 25  QGASNLKKRTDNVMV-IQKCNTNIREAQQNIQYLEDTLKKLH 65

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.127    0.318 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 10,084,364
Number of extensions: 397799
Number of successful extensions: 2204
Number of sequences better than 10.0: 202
Number of HSP's gapped: 2192
Number of HSP's successfully gapped: 216
Length of query: 115
Length of database: 53,481,399
Length adjustment: 85
Effective length of query: 30
Effective length of database: 43,734,789
Effective search space: 1312043670
Effective search space used: 1312043670
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 59 (27.3 bits)