Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D12276g7.353ON25825813580.0
Ecym_47207.353ON2612753884e-45
ACL145W7.353ON2342393672e-42
KAFR0L015007.353ON2792812944e-31
Suva_10.2947.353ON2752792936e-31
Skud_12.2637.353ON2742782928e-31
YLR199C (PBA1)7.353ON2762802771e-28
Kpol_530.287.353ON2742792604e-26
Smik_12.2587.353ON2742782586e-26
TBLA0E020707.353ON2522722577e-26
KNAG0B026007.353ON2792802526e-25
TDEL0C019507.353ON2732812472e-24
NCAS0E028507.353ON2812872378e-23
SAKL0F11440g7.353ON2722752369e-23
TPHA0F030007.353ON2822872361e-22
NDAI0E044507.353ON2212182277e-22
ZYRO0F11770g7.353ON2722812229e-21
CAGL0A03993g7.353ON2722792001e-17
KLTH0H01188g7.353ON2672801842e-15
Kwal_56.246507.353ON2521581753e-14
SAKL0H06446g8.680ON306106740.65
Suva_6.2571.163ON60941740.68
Smik_10.551.163ON81831711.6
TDEL0A062508.680ON301106701.9
CAGL0M02145g8.680ON333105692.3
KAFR0L004306.42ON65745683.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D12276g
         (258 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D12276g Chr4 complement(1046970..1047737,1047816..1047824) ...   527   0.0  
Ecym_4720 Chr4 complement(1412286..1413065,1413130..1413135) [78...   154   4e-45
ACL145W Chr3 (93920..94624) [705 bp, 234 aa] {ON} Syntenic homol...   145   2e-42
KAFR0L01500 Chr12 (275836..275841,275908..276741) [840 bp, 279 a...   117   4e-31
Suva_10.294 Chr10 complement(520639..521304,521305..521466) [828...   117   6e-31
Skud_12.263 Chr12 complement(494506..495168,495169..495330) [825...   117   8e-31
YLR199C Chr12 complement(547853..548677,548764..548769) [831 bp,...   111   1e-28
Kpol_530.28 s530 complement(73093..73911,74024..74029) [825 bp, ...   104   4e-26
Smik_12.258 Chr12 complement(494861..495523,495524..495685) [825...   103   6e-26
TBLA0E02070 Chr5 (504410..504415,504472..505224) [759 bp, 252 aa...   103   7e-26
KNAG0B02600 Chr2 complement(505952..506785,506899..506904) [840 ...   101   6e-25
TDEL0C01950 Chr3 complement(342242..343057,343116..343121) [822 ...   100   2e-24
NCAS0E02850 Chr5 complement(560339..561178,561273..561278) [846 ...    96   8e-23
SAKL0F11440g Chr6 (888319..888324,888382..889194) [819 bp, 272 a...    96   9e-23
TPHA0F03000 Chr6 (657195..657200,657311..658153) [849 bp, 282 aa...    96   1e-22
NDAI0E04450 Chr5 complement(1004080..1004745) [666 bp, 221 aa] {...    92   7e-22
ZYRO0F11770g Chr6 (961232..961237,961318..962130) [819 bp, 272 a...    90   9e-21
CAGL0A03993g Chr1 (400841..400846,400992..401804) [819 bp, 272 a...    82   1e-17
KLTH0H01188g Chr8 complement(118222..119019,119088..119093) [804...    75   2e-15
Kwal_56.24650 s56 (1089568..1090326) [759 bp, 252 aa] {ON} YLR19...    72   3e-14
SAKL0H06446g Chr8 (568689..569609) [921 bp, 306 aa] {ON} similar...    33   0.65 
Suva_6.257 Chr6 (455656..457485) [1830 bp, 609 aa] {ON} YJL176C ...    33   0.68 
Smik_10.55 Chr10 complement(90082..92538) [2457 bp, 818 aa] {ON}...    32   1.6  
TDEL0A06250 Chr1 complement(1094782..1095687) [906 bp, 301 aa] {...    32   1.9  
CAGL0M02145g Chr13 (257734..258735) [1002 bp, 333 aa] {ON} simil...    31   2.3  
KAFR0L00430 Chr12 (79235..81208) [1974 bp, 657 aa] {ON} Anc_6.41...    31   3.7  

>KLLA0D12276g Chr4 complement(1046970..1047737,1047816..1047824)
           [777 bp, 258 aa] {ON} similar to uniprot|Q05778
           Saccharomyces cerevisiae YLR199C Hypothetical ORF
          Length = 258

 Score =  527 bits (1358), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/258 (100%), Positives = 258/258 (100%)

Query: 1   MLTFKQWQNDQVPRHQIDPVVQSDPYSLVNKTTPTVTIEPESLDISPYNHCIVLPTSLKW 60
           MLTFKQWQNDQVPRHQIDPVVQSDPYSLVNKTTPTVTIEPESLDISPYNHCIVLPTSLKW
Sbjct: 1   MLTFKQWQNDQVPRHQIDPVVQSDPYSLVNKTTPTVTIEPESLDISPYNHCIVLPTSLKW 60

Query: 61  LLPKSIINLVHIGIISGTLSNMNEWESMKPVPGMYDTEEHMINSTEQFVIHYNLWRLEDT 120
           LLPKSIINLVHIGIISGTLSNMNEWESMKPVPGMYDTEEHMINSTEQFVIHYNLWRLEDT
Sbjct: 61  LLPKSIINLVHIGIISGTLSNMNEWESMKPVPGMYDTEEHMINSTEQFVIHYNLWRLEDT 120

Query: 121 LIAIIDENEVKYPAIVTNFMTRNLAQLLRDIKDITILVNSDKITELKQLSYLVPPEFITG 180
           LIAIIDENEVKYPAIVTNFMTRNLAQLLRDIKDITILVNSDKITELKQLSYLVPPEFITG
Sbjct: 121 LIAIIDENEVKYPAIVTNFMTRNLAQLLRDIKDITILVNSDKITELKQLSYLVPPEFITG 180

Query: 181 SITNFILALPRKELKVIVVPSEGPIGFEKYNFPTVDALVDEMSKLLCSYPSQTEYYVSEC 240
           SITNFILALPRKELKVIVVPSEGPIGFEKYNFPTVDALVDEMSKLLCSYPSQTEYYVSEC
Sbjct: 181 SITNFILALPRKELKVIVVPSEGPIGFEKYNFPTVDALVDEMSKLLCSYPSQTEYYVSEC 240

Query: 241 LKLWKLDECTTTQGGLYI 258
           LKLWKLDECTTTQGGLYI
Sbjct: 241 LKLWKLDECTTTQGGLYI 258

>Ecym_4720 Chr4 complement(1412286..1413065,1413130..1413135) [786
           bp, 261 aa] {ON} similar to Ashbya gossypii ACL145W
           1-intron
          Length = 261

 Score =  154 bits (388), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 98/275 (35%), Positives = 153/275 (55%), Gaps = 32/275 (11%)

Query: 2   LTFKQWQNDQVPRHQIDPVVQSDPYSLVNKTTPTVTIEPESLDISP-YNHCIVLPTSLKW 60
           + FKQW+ D++PRHQ+  +  +DP SL+    P +T++    DI+  Y   I LP+SL W
Sbjct: 1   MIFKQWEFDRIPRHQVQSINSADPTSLLLSPEPVITLDN---DINKGYEKAIALPSSLTW 57

Query: 61  LLPKSIINLVHIGIISGTLSNMNEWESMKPVP---------GMYDTEEHMINSTEQFVIH 111
           LLP  +I+   I  ++  L      +S  P P         G Y+ +  +  ST++    
Sbjct: 58  LLPADLIHFKQISCLTAVLK-----QSSNPDPVEIEDVNTSGFYEVD--VKPSTKEVRAS 110

Query: 112 YNLWRLED-TLIAIIDENEVKYPAIVTNFMTRNLAQLLR-DIKDITILVNSDKITELKQL 169
           Y ++ L+D TL+ +I E+E+++P I+ NF+   LA++LR  I+ + +L+NSDKI   K L
Sbjct: 111 YPIYELDDHTLVVLIKEDELQHPPILHNFLAIALAKVLRTAIQKVYLLINSDKIIGFKSL 170

Query: 170 SYLVPPEFITGSITNFILAL----PRKELK--VIVVPSEGPIGFEKYNFPTVDALVDEMS 223
           S L PPEFI G++   + AL      KE +  ++VV SEGP G+E +N   VD LV+ M 
Sbjct: 171 SELQPPEFIAGALAAIVTALNSQSSSKEFQHEIMVVQSEGPRGYEIHNITVVDLLVEYMK 230

Query: 224 KLLCSYPSQTEYYVSECLKLWKLDECTTTQGGLYI 258
             L      +E YV+   + WK +  +  Q GLY+
Sbjct: 231 STL----GYSEEYVTSAYRRWKSNSASQFQSGLYL 261

>ACL145W Chr3 (93920..94624) [705 bp, 234 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR199C
          Length = 234

 Score =  145 bits (367), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 87/239 (36%), Positives = 131/239 (54%), Gaps = 10/239 (4%)

Query: 24  DPYSLVNKTTPTVTIEPESLDISPYNHCIVLPTSLKWLLPKSIINLVHIGIISGTLSNMN 83
           DP+SL+    P V    +  +   Y+  +V+P++L WL+P  ++ L  +  + GTL+   
Sbjct: 2   DPHSLLAGAEPQVEFSGKLGER--YSAALVVPSTLSWLMPPEMVQLTPVAQLVGTLTQAG 59

Query: 84  EWESMKPVPGMYDTEEHMINSTEQFV-IHYNLW-RLEDTLIAIIDENEVKYPAIVTNFMT 141
             E    +       E  +   E+ V + Y L+ R    L+ +++EN++KYP IV N + 
Sbjct: 60  GGECATRLVAADQFYEADVPQAERHVRVAYQLYERGPGQLVVVVEENDLKYPPIVHNRLA 119

Query: 142 RNLAQLLRDI-KDITILVNSDKITELKQLSYLVPPEFITG-SITNFILALPRKELKVIVV 199
           + LA+ LR +  + T+LVNSDK T +K L  LVPPEFITG          P    +V+VV
Sbjct: 120 QQLAEKLRAVGAETTVLVNSDKSTGVKDLEELVPPEFITGALAALVCALAPSGAGRVLVV 179

Query: 200 PSEGPIGFEKYNFPTVDALVDEMSKLLCSYPSQTEYYVSECLKLWKLDECTTTQGGLYI 258
            SEGP GFEK+N   VDALV+ + ++L   P     YV+ C + WKL   +  QGGLY+
Sbjct: 180 QSEGPHGFEKHNLTVVDALVERVRQILDQPPE----YVAACTRHWKLQAGSQFQGGLYL 234

>KAFR0L01500 Chr12 (275836..275841,275908..276741) [840 bp, 279 aa]
           {ON} Anc_7.353 YLR199C
          Length = 279

 Score =  117 bits (294), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 90/281 (32%), Positives = 136/281 (48%), Gaps = 26/281 (9%)

Query: 2   LTFKQWQNDQVPRHQID-PVVQSDPYSLVNKTTPTVTIEPESLDISPYNHCIVLPTSLKW 60
           + FKQW     PRHQ+D PV+  +  SL     P V I P +++ S Y   I+    +  
Sbjct: 1   MLFKQWNELVEPRHQLDSPVILKNEESLQESPLPQVEI-PSTVNFSDYKKIILTTKVMNP 59

Query: 61  LLPKSIINLVHIGIISGTL-----------SNMNEWESMKPVPGMYDTEEHMINSTEQFV 109
           L PK+++ +  +G I  TL            N   W+  +  P  ++           F 
Sbjct: 60  LFPKNLLKMEDLGNIETTLLLTESKMTDDEQNHYSWDFNENFPNEFNPSMESATGNNNFS 119

Query: 110 IHYNLWRLE--DTLIAIIDENEVKYPAIVTNFMTRNL-AQLLRDIKDITILVNSDKI--- 163
             + ++R+   DTL+  IDEN +K   I  N +++ L + +  D   I +L  SDKI   
Sbjct: 120 FKFPIYRISSTDTLLISIDENFLKVSPIFLNLISKKLTSSINNDKSSILLLGASDKISNN 179

Query: 164 --TELKQLSYLVPPEFITGSITNFI---LALPRKELKVIVVPSEGPIGFEKYNFPTVDAL 218
             T   +   + PPEFITG I + +   L +     + I+VPSEGPIGFEK +  T++ L
Sbjct: 180 IKTVTNKNCSINPPEFITGFIGSLLYELLEIGTDNFECIIVPSEGPIGFEKLSLSTMEEL 239

Query: 219 VDEMSKLLCSYPSQTEYYVSECLKLWKLD-ECTTTQGGLYI 258
           +++    L S      YY  EC + WKL+   T+TQ GLYI
Sbjct: 240 INQFFHELGSQMDFKTYY-DECHRNWKLEGSATSTQSGLYI 279

>Suva_10.294 Chr10 complement(520639..521304,521305..521466) [828
           bp, 275 aa] {ON} YLR199C (REAL)
          Length = 275

 Score =  117 bits (293), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 84/279 (30%), Positives = 142/279 (50%), Gaps = 28/279 (10%)

Query: 4   FKQWQNDQVPRHQID-PVVQSDPYSLVNKTTPTVTIEPESLDISPYNHCIVLPTSLKWLL 62
           FKQW +   PRHQ+D P +  +  SL     P V + P+ LD+S Y+  ++    +  L 
Sbjct: 1   FKQWNDLPEPRHQLDFPEISKNLQSLEVCPVPKVEL-PQDLDVSQYSRVVITTKIMNPLF 59

Query: 63  PKSIINLVHIGIISGTL----------SNMNEWESMKPVPGMYDTEEHMINSTEQFVIHY 112
           PK+++ L+ IG I  +L          ++ + W   +  P   +       S E+ + ++
Sbjct: 60  PKNLLKLISIGEIKTSLMVKELNPIQPTDAHSWNYDENFPNEINPNSRTATSNEETLYNF 119

Query: 113 N--LWRLEDTLIAIIDENEVKYPAIVTNFMTRNLA-QLLRDIKDITILVNSDKITELKQL 169
           +  ++    TL+  I+EN +    I  N ++R++A QL++   D+ I+  SD+I+ +K +
Sbjct: 120 SFPIYSFGKTLLFSIEENFINISPIFGNMISRSIASQLVKTSPDVIIIGTSDRISNMKIM 179

Query: 170 S----YLVPPEFITGSITNFILAL-----PRKELKVIVVPSEGPIGFEKYNFPTVDALVD 220
           +     L PPEF+TG I + +  L        + K +VVPSEGP GFEK++   + +L+D
Sbjct: 180 TEDECTLQPPEFVTGFIGSVLTQLITGANKGMKFKCLVVPSEGPNGFEKFSLSDMGSLID 239

Query: 221 EMSKLLCSYPSQTEYYVSECLKLWKLDECT-TTQGGLYI 258
             S+      S+   Y  EC +LW+ D      Q GLYI
Sbjct: 240 VCSQWFGLDHSK---YSEECHRLWRCDSAAIGAQSGLYI 275

>Skud_12.263 Chr12 complement(494506..495168,495169..495330) [825
           bp, 274 aa] {ON} YLR199C (REAL)
          Length = 274

 Score =  117 bits (292), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 86/278 (30%), Positives = 141/278 (50%), Gaps = 27/278 (9%)

Query: 4   FKQWQNDQVPRHQID-PVVQSDPYSLVNKTTPTVTIEPESLDISPYNHCIVLPTSLKWLL 62
           FKQW +   PRHQ+D P +  +  SL     P V + P+ L++S Y+  I+    +  L 
Sbjct: 1   FKQWNDLPEPRHQLDFPEISKNLQSLEFCPIPRVEL-PQDLNVSQYSTVIITTKIMNPLF 59

Query: 63  PKSIINLVHIGIISGTLSNMNE----------WESMKPVPGMYD-TEEHMINSTEQFVIH 111
           PK+++ L  IG +  +L+  N           W   +  P   D   E   +   Q+   
Sbjct: 60  PKNLLQLTSIGEVKSSLTVKNSSPTQSTDAYSWNYDENFPNEVDPISESETSKETQYNFS 119

Query: 112 YNLWRLEDTLIAIIDENEVKYPAIVTNFMTRNL-AQLLRDIKDITILVNSDKITELKQLS 170
           + ++   +TL+  I+EN +    I  N ++R++ +QL++   DI ++ +SD+I+ +K+++
Sbjct: 120 FPIYSFGETLLFSIEENFINISPIFGNMISRSIVSQLIKTSPDIIVIGSSDRISNMKKMT 179

Query: 171 Y----LVPPEFITGSITNFILALPRKE-----LKVIVVPSEGPIGFEKYNFPTVDALVDE 221
                L PPEFITG I + +  L   E      K ++VPSEGP GFEK +   + +L+D 
Sbjct: 180 KSECTLQPPEFITGFIGSVLTQLIIGENKGMNFKCLIVPSEGPNGFEKISLSDMGSLIDV 239

Query: 222 MSKLLCSYPSQTEYYVSECLKLWKLDECT-TTQGGLYI 258
            S+ L    S+   Y  EC +LW+ D      Q GLYI
Sbjct: 240 CSQWLGFDHSK---YSQECYRLWRCDSAAIGAQSGLYI 274

>YLR199C Chr12 complement(547853..548677,548764..548769) [831 bp,
           276 aa] {ON}  PBA1Protein involved in 20S proteasome
           assembly; forms a heterodimer with Add66p that binds to
           proteasome precursors; similar to human PAC1 constituent
           of the PAC1-PAC2 complex involved in proteasome assembly
          Length = 276

 Score =  111 bits (277), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 87/280 (31%), Positives = 136/280 (48%), Gaps = 27/280 (9%)

Query: 2   LTFKQWQNDQVPRHQID-PVVQSDPYSLVNKTTPTVTIEPESLDISPYNHCIVLPTSLKW 60
           + FKQW +   P+H +D P +  +  SL     P V   P+ LD+  Y+  ++    +  
Sbjct: 1   MLFKQWNDLPEPKHLLDLPEISKNLQSLEVCPVPKVEF-PQDLDVPQYSTAVITTKIMNP 59

Query: 61  LLPKSIINLVHIGIISGTL----------SNMNEWESMKPVPGMYDTEEHMINSTEQ-FV 109
           L PK+++ L  IG I  TL          S  + W   +  P   D ++    + E  + 
Sbjct: 60  LFPKNLLQLTSIGEIKTTLTVKSPSLPQSSGKHSWNYDENFPNEVDPDQKNDTADETVYG 119

Query: 110 IHYNLWRLEDTLIAIIDENEVKYPAIVTNFMTRNL-AQLLRDIKDITILVNSDKITELKQ 168
             + ++    TL+  ++EN +    I  N ++R++ +QL +   DI ++  SDKI  +K 
Sbjct: 120 FSFPIYSFGKTLLFSMEENFISISPIFGNMISRSIISQLAQFSPDIIVIGTSDKIASMKV 179

Query: 169 LS----YLVPPEFITGSITNFILAL---PRKELK--VIVVPSEGPIGFEKYNFPTVDALV 219
           ++     L PPEFITG I + +  L   P K LK   +V PSEGP GFEK +   + +LV
Sbjct: 180 MTENECTLQPPEFITGFIGSVLTQLIVGPSKGLKFKCLVAPSEGPNGFEKLSLSDMGSLV 239

Query: 220 DEMSKLLCSYPSQTEYYVSECLKLWKLDECT-TTQGGLYI 258
           D   + L   PS+   Y  EC +LW+ D      Q GLYI
Sbjct: 240 DLCGQWLGFEPSR---YSEECYRLWRCDSAAIGAQSGLYI 276

>Kpol_530.28 s530 complement(73093..73911,74024..74029) [825 bp, 274
           aa] {ON} complement(73093..73911,74024..74029) [825 nt,
           275 aa]
          Length = 274

 Score =  104 bits (260), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 86/279 (30%), Positives = 142/279 (50%), Gaps = 27/279 (9%)

Query: 2   LTFKQWQNDQVPRHQID-PVVQSDPYSLVNKTTPTVTIEPESLDISPYNHCIVLPTSLKW 60
           + FKQW     PRH++D P++  +  SL   + P V + PE+ D+S Y + ++    +  
Sbjct: 1   MLFKQWNEFVAPRHELDSPIIARNDDSLQLLSLPEVHM-PET-DLSKYKNVVLTTKIMDP 58

Query: 61  LLPKSIINLVHIGIISGTLSNMNEWESMKPVPGMYDTEEHMIN-------STEQFVIHYN 113
           L P  +++   I  I+ TL      +  +     +D EE+  N       S  + ++ ++
Sbjct: 59  LFPSKLLSAEKIADITTTLKIDESQDVGESENHSWDYEENFPNEVGFKRDSNNRRLLSFS 118

Query: 114 --LWRLEDTLIAIIDENEVKYPAIVTNFMTRNLAQ--LLRDIKDITILV--NSDKITELK 167
             ++  +DT+I +I+EN +K  AI +N +   +    L+    D+  +    SD+I  +K
Sbjct: 119 SPIFAFKDTIIIMIEENFIKMSAIFSNVIAEQVINHLLINGNPDLNFIAIGTSDRILNIK 178

Query: 168 QLSY----LVPPEFITGSITNFILALPRKELKV---IVVPSEGPIGFEKYNFPTVDALVD 220
           +L+     L PPEF+TG I + +  L  KE+ V   I+ PSEGPIGFEK     +  L+D
Sbjct: 179 KLTQDHCSLEPPEFVTGFIGSILTQLISKEVNVFTGILAPSEGPIGFEKMTLDVIKELID 238

Query: 221 EMSKLLCSYPSQTEYYVSECLKLWKLDECT-TTQGGLYI 258
              +LL      TEY V +C ++W+LD      Q GLYI
Sbjct: 239 ICQELL--DIKSTEYSV-DCQRMWRLDGAAIGAQSGLYI 274

>Smik_12.258 Chr12 complement(494861..495523,495524..495685) [825
           bp, 274 aa] {ON} YLR199C (REAL)
          Length = 274

 Score =  103 bits (258), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 80/278 (28%), Positives = 134/278 (48%), Gaps = 27/278 (9%)

Query: 4   FKQWQNDQVPRHQID-PVVQSDPYSLVNKTTPTVTIEPESLDISPYNHCIVLPTSLKWLL 62
           FKQW     PRH +D P +  + +SL     P V + P+ LD+S Y+  ++    +  L 
Sbjct: 1   FKQWNEIPEPRHLLDFPEISKNLHSLEACPVPKVEL-PQDLDVSQYSTVVITTKIMNPLF 59

Query: 63  PKSIINLVHIGIISGTLSNMNEWESMKPVPGMYDTEEHMINSTE-----------QFVIH 111
           PK+++ L+ +G I  TL+ +N           ++ +E+  N  +           ++   
Sbjct: 60  PKNLLQLIAVGKIETTLTVVNSGSVQSTGDHSWNFDENFPNEVDPVPRGAMSDETKYDFS 119

Query: 112 YNLWRLEDTLIAIIDENEVKYPAIVTNFMTRNL-AQLLRDIKDITILVNSDKITELKQLS 170
           + ++    TL+  I+EN +    I  N ++R + ++L+    +I ++  SDKI  +K ++
Sbjct: 120 FPIYSFGKTLLFSIEENFLSISPIFGNMISRCIVSRLVESSPEIIVIGTSDKIANMKVMT 179

Query: 171 ----YLVPPEFITGSITNFILAL-----PRKELKVIVVPSEGPIGFEKYNFPTVDALVDE 221
                L PPEFITG I + +  L        + K +VVPSEGP G+EK +   + +LV  
Sbjct: 180 KDECSLKPPEFITGFIGSVLTQLVGGVNKGMKFKCLVVPSEGPNGYEKLSLSDMGSLVSL 239

Query: 222 MSKLLCSYPSQTEYYVSECLKLWKLDECT-TTQGGLYI 258
             + L    S    Y  EC +LW+ D      Q GLYI
Sbjct: 240 CGQWLGFDHSS---YHEECYRLWRCDSAAIGAQSGLYI 274

>TBLA0E02070 Chr5 (504410..504415,504472..505224) [759 bp, 252 aa]
           {ON} Anc_7.353 YLR199C
          Length = 252

 Score =  103 bits (257), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 83/272 (30%), Positives = 124/272 (45%), Gaps = 35/272 (12%)

Query: 2   LTFKQWQNDQVPRHQIDPVVQSDPY-----SLVNKTTPTVTIEPESLDISPYNHCIVLPT 56
           + FKQW     PRH +D +    P      SL     P V +     DI+ Y   IV   
Sbjct: 1   MLFKQWDEWAEPRHHVDSLAAIPPNHRNADSLQEAPLPLVKVPDTLQDITIYEQIIVATR 60

Query: 57  SLKWLLPKSIINLVHIGIISGTLSNMNEWESMKPVPGMYDTEEHMINSTEQFVIHYNLWR 116
            L  L PK I+N   +G I   L N++E  +      +Y   E                 
Sbjct: 61  VLMPLFPKEILNFTSLGNIEVKL-NVSEATAHLVKTPIYKCNER---------------- 103

Query: 117 LEDTLIAIIDENEVKYPAIVTNFMTRNLAQLLRDIKDITILVNSDKITELKQLSYL---- 172
              TLI I+DEN ++   I  N +++ +  +  +     I   SD+I+++K +++L    
Sbjct: 104 ---TLIIIVDENVMQVCPIFLNVISKTICTMFGNQLKFLIFGTSDRISKIKTINHLNCTL 160

Query: 173 VPPEFITGSITNFILAL---PRKELKVIVVPSEGPIGFEKYNFPTVDALVDEMSKLLCSY 229
           +PPEFITG I + I  L      +    +VPSEGP+GFEK    T++ L+ E  +++ + 
Sbjct: 161 IPPEFITGFIGSIISDLSLTANSKFNGFLVPSEGPLGFEKLTLETMEFLIKEGGRIVKTI 220

Query: 230 PS--QTEYYVSECLKLWKLDECT-TTQGGLYI 258
            S    E Y  EC + W+L   T  TQ GLYI
Sbjct: 221 DSNLNLELYEKECYRNWRLTGTTIGTQSGLYI 252

>KNAG0B02600 Chr2 complement(505952..506785,506899..506904) [840 bp,
           279 aa] {ON} Anc_7.353 YLR199C
          Length = 279

 Score =  101 bits (252), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 85/280 (30%), Positives = 125/280 (44%), Gaps = 24/280 (8%)

Query: 2   LTFKQWQNDQVPRHQID-PVVQSDPYSLVNKTTPTVTIEPESLDISPYNHCIVLPTSLKW 60
           + FK W     PRH +D PV+  +  SL     PTVT+ P   D      C      +  
Sbjct: 1   MLFKHWNEFVEPRHHLDAPVMVPNQESLQALPLPTVTV-PAGFDWGKVRDCDPDHKIMNP 59

Query: 61  LLPKSIINLVHIG-----------IISGTLSNMNE-WESMKPVPGMYDTEEHMINSTEQF 108
           L   S  + +  G           ++S   + +++ W+  +  P  +D        T+  
Sbjct: 60  LFNTSHTHAMTRGELVTSLQLNESVVSQAATELSQHWDYRENFPNEFDPASDTREDTKSI 119

Query: 109 VIHYNLWRLE--DTLIAIIDENEVKYPAIVTNFMTRNLAQLLRDIKDITILVNSDKITEL 166
           V+   +  L   +TL+  +DEN +K   I TN + R L  LL     I ++ +SDKI   
Sbjct: 120 VLRLPIVELNGMNTLLISVDENFLKVSPIFTNVVARKLRTLLNTQTKILLVGSSDKIYST 179

Query: 167 KQLSY----LVPPEFITGSITNFILALPRKEL---KVIVVPSEGPIGFEKYNFPTVDALV 219
           K +S     L PPEFITG +   I  L +      K  +V SEGP GFEK +  ++D L+
Sbjct: 180 KMVSLNECTLQPPEFITGFLGGMIDELVKNRFSNFKGFIVQSEGPTGFEKLSLESMDELI 239

Query: 220 DEMSKLLCSYPSQTEYYVSECLKLWKLDECT-TTQGGLYI 258
           D +     SY    + +   C KLWKLD    + Q GLYI
Sbjct: 240 DFIIDEWSSYNINADAFRENCHKLWKLDGAAMSAQSGLYI 279

>TDEL0C01950 Chr3 complement(342242..343057,343116..343121) [822 bp,
           273 aa] {ON} Anc_7.353 YLR199C
          Length = 273

 Score = 99.8 bits (247), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 84/281 (29%), Positives = 135/281 (48%), Gaps = 32/281 (11%)

Query: 2   LTFKQWQNDQVPRHQID-PVVQSDPYSLVNKTTPTVTIEPESLDISPYNHCIVLPTSLKW 60
           + FKQW     PRHQ+D PV+ ++  +L     P VT+ P  +D+  ++  I+    +  
Sbjct: 1   MLFKQWNEIAEPRHQLDSPVIIANEGTLQTSVLPQVTLPP--IDLQNFSRVILTSAIMNP 58

Query: 61  LLPKSIINLVHIG-------IISGTLS---NMNEWESMKPVPGMYDTEEHMINSTEQFVI 110
           L P+ ++    +G       + SG ++    M+ W   +  P   D    +   ++ F +
Sbjct: 59  LFPEKLLKSTILGDLKVILDLSSGKMALDHPMHSWNFDENFPNEVDPAYVVEERSKTFEL 118

Query: 111 HYNLWRLEDTLIAIIDENEVKYPAIVTNFMTRN----LAQLLRDIKDITILVNSDKITEL 166
              +     TL+  + EN +K   I  N + ++    LAQ   +  ++ +L  SD+ITEL
Sbjct: 119 CAPIVSFGRTLLISVKENFLKTSPIFLNQIAKSVVCKLAQGAFE-GEVVVLGTSDQITEL 177

Query: 167 KQLS----YLVPPEFITGSITNFILALPRKEL--KVIVVPSEGPIGFEKYNFPTVDALVD 220
           K +S     L PPEF+T  +   I  L  K L  + ++ PSEGP+GFEK N  T++ L+ 
Sbjct: 178 KPVSDKETTLNPPEFVTSFVGAVITQLIEKSLPFQGLIAPSEGPVGFEKLNLVTMEELIT 237

Query: 221 EMSKLLCS--YPSQTEYYVSECLKLWKLDECT-TTQGGLYI 258
                LC     S  E Y +EC + W+LD      Q GLYI
Sbjct: 238 -----LCHQWVDSNKEIYRNECYRRWRLDGAALGAQSGLYI 273

>NCAS0E02850 Chr5 complement(560339..561178,561273..561278) [846 bp,
           281 aa] {ON} Anc_7.353 YLR199C
          Length = 281

 Score = 95.9 bits (237), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 83/287 (28%), Positives = 133/287 (46%), Gaps = 36/287 (12%)

Query: 2   LTFKQWQNDQVPRHQID-PVVQSDPYSLVNKTTPTVTIEPESLDISPYNHCIVLPTSLKW 60
           + FKQW     PRHQ+D P++  +  SL     P V     S+    Y   I+    +  
Sbjct: 1   MLFKQWNEFIEPRHQLDFPILSKNDESLQASPIPKVLFP--SIAFQNYEKIIITTQLMNP 58

Query: 61  LLPKSIINLVHIGIISGTLS----------NMNEWESMKPVPGMYDTE-EHMINSTEQFV 109
           L P+ +I   ++G I   L+          + + W   +  P  +D + E   N  + F 
Sbjct: 59  LFPEKLIESKNLGKIETQLTLTEDQNAVNEDGHSWNFNENFPNEFDPDNEDRENQQQAFN 118

Query: 110 IHYNLWRLEDTLIAIIDENEVKYPAIVTNFMTRNL-AQLLRDIKDITILVNSDKITELKQ 168
             + ++ +   +I  I +N +K   I +N +++ L  QL R IK + IL +SD+I  +K+
Sbjct: 119 FEFPVFAVGKVVIISIQDNFLKISPIFSNIISKKLIEQLPRTIKPL-ILGSSDRIASVKE 177

Query: 169 LS----YLVPPEFITGSITNFILALP-----------RKELKVIVVPSEGPIGFEKYNFP 213
           ++     LVPPEFITG I + +  L            + +   I+VPSEGP+GFEK N  
Sbjct: 178 INDHTCTLVPPEFITGFIASLLTELTIHNETLQNGENKFQFDAILVPSEGPLGFEKLNLT 237

Query: 214 TVDALVDEMSKLLCSYPS-QTEYYVSECLKLWKL-DECTTTQGGLYI 258
            +  L+D   +    +P+   + Y  E  + WKL       Q GLYI
Sbjct: 238 VIQDLIDLFKE---EWPNLDPKVYAEESYRNWKLAGSVLGAQSGLYI 281

>SAKL0F11440g Chr6 (888319..888324,888382..889194) [819 bp, 272 aa]
           {ON} similar to uniprot|Q05778 Saccharomyces cerevisiae
           YLR199c
          Length = 272

 Score = 95.5 bits (236), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 76/275 (27%), Positives = 124/275 (45%), Gaps = 21/275 (7%)

Query: 2   LTFKQWQNDQVPRHQID-PVVQSDPYSLVNKTTPTVTIEPESLDISPYNHCIVLPTSLKW 60
           + FK W     PRHQ+D P   +  Y  + KT     I  E +DIS +N  ++    L+ 
Sbjct: 1   MLFKHWNEQAEPRHQLDTPYAPNVNYESLQKTPLPTVILTEPIDISQFNQIVLCTKVLRP 60

Query: 61  LLPKSIINLVHIGIISGTLSNMNEWESMKPVPGM------YDTEEHMINSTEQFVIHYNL 114
           L P +I  +  I     T+    +  ++K   G       Y+ E       E+ ++ + +
Sbjct: 61  LFPSTICPMTTISEFQVTIPP--QPTAIKKAHGSSYGDEDYEQESLPDKKPEEIIVSFQV 118

Query: 115 WRLEDTLIAIIDENEVKYPAIVTNFMTRNLAQLLRDIKDITILV--NSDKITELKQLSY- 171
            +  D L   I+EN +    I  N +++ + +L +    +  +V   SD+IT LK +   
Sbjct: 119 EKFNDILFICIEENFLHVSPIAWNLLSQQIIRLCKSKNTLQTIVLGTSDRITTLKSVGST 178

Query: 172 -----LVPPEFITGSITNFILALPRKEL--KVIVVPSEGPIGFEKYNFPTVDALVDEMSK 224
                L PPEF+T    + I  L   +L  K ++ PSEGP GFEK +  ++D L +   +
Sbjct: 179 LGLPDLEPPEFVTNCTASLITTLILHDLPFKSLIAPSEGPSGFEKLSLVSMDQLAESCFE 238

Query: 225 LLCSYPSQTEYYVSECLKLWKLD-ECTTTQGGLYI 258
           L+         Y+ EC + W+L       Q GLYI
Sbjct: 239 LVKPV-ENVSSYIEECHRAWRLQGTAMGAQTGLYI 272

>TPHA0F03000 Chr6 (657195..657200,657311..658153) [849 bp, 282 aa]
           {ON} Anc_7.353 YLR199C
          Length = 282

 Score = 95.5 bits (236), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 83/287 (28%), Positives = 136/287 (47%), Gaps = 35/287 (12%)

Query: 2   LTFKQWQNDQVPRHQI-DPVVQSDPYSLVNKTTPTVTIEPESLDISPYNHCIVLPTSLKW 60
           + FKQW +   PRHQ+  P + ++  SL  +  P V++   +L    + + IV   ++  
Sbjct: 1   MLFKQWNDLAEPRHQLMSPSLSTNIESLQLQNIPEVSMT--NLKYEDFENVIVTTKTMNA 58

Query: 61  LLPKSIINLVHIGIISGTLS-NMNE---------WESMKPVPGMYD-------TEEHMIN 103
           L P   +NL  +G +S +L  N NE         W+  +  P   D         E   N
Sbjct: 59  LFPNKTLNLTKVGELSSSLVLNENEKVPTAEHYSWDYKENFPNEVDIYSQEAIESEIGSN 118

Query: 104 STEQFVIHYNLWRLEDTLIAIIDENEVKYPAIVTNFMTRNLAQLLRDIKDITI----LVN 159
            ++++     +   + TL+  I+EN +K   I +N     + +++    +  I    L  
Sbjct: 119 ESKKYNFQIPIMAYDKTLLISIEENFIKMSPIFSNLTAEKILKVILTFCNSNIGILTLGT 178

Query: 160 SDKITELKQL----SYLVPPEFITGSITNFILALPRKEL---KVIVVPSEGPIGFEKYNF 212
           SD++  +++L    S LV PEFITG + +FI  L   E+   K ++VPSEGPIGFEK + 
Sbjct: 179 SDRVAAIRKLTPENSTLVAPEFITGFVGSFISQLVILEVPNYKAVIVPSEGPIGFEKLSI 238

Query: 213 PTVDALVDEMSKLLCSYPSQTEYYVSECLKLWKL-DECTTTQGGLYI 258
            T+  L+D   + L     +   Y +E  +LWK+       Q GLYI
Sbjct: 239 ETISELIDICKENLNINDPK---YSNESHRLWKVAGSAMGAQTGLYI 282

>NDAI0E04450 Chr5 complement(1004080..1004745) [666 bp, 221 aa] {ON}
           Anc_7.353 YLR199C
          Length = 221

 Score = 92.0 bits (227), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 65/218 (29%), Positives = 108/218 (49%), Gaps = 20/218 (9%)

Query: 61  LLPKSIINLVHIGIISGTLS----------NMNEWESMKPVPGMYD-TEEHMINSTEQFV 109
           L P+ ++ LV +  IS TL+            + W   +  P  +D +++ M +S + + 
Sbjct: 4   LFPEDLLPLVSVSNISTTLTLNPDQLMGNEGKHSWNYNENFPNEFDPSDKDMKSSEKSYD 63

Query: 110 IHYNLWRLEDTLIAIIDENEVKYPAIVTNFMTRNLAQLLRDIKDITILVNSDKITELKQL 169
            ++ ++ ++ TL+  I EN +K   I +N +++ L Q L   K+I IL  SD++  ++++
Sbjct: 64  FNFPIFAIDRTLVISIQENFLKISPIFSNVISQTLVQALPLNKEILILGTSDRVAVMRKI 123

Query: 170 S----YLVPPEFITGSITNFILAL----PRKELKVIVVPSEGPIGFEKYNFPTVDALVDE 221
           S     L PPEF+TG I + I  L     +     I+VPSEGP GFEK N   +  L+D 
Sbjct: 124 SNEIDTLEPPEFVTGFIGSLITELNLHNAKYNFDAIIVPSEGPTGFEKLNLTIMQDLIDI 183

Query: 222 MSKLLCSYPSQTEYYVSECLKLWKL-DECTTTQGGLYI 258
                      ++ Y  +C + WKL       Q GLYI
Sbjct: 184 FKNEWNYLNIDSKVYTEQCYRHWKLAGAAIGAQSGLYI 221

>ZYRO0F11770g Chr6 (961232..961237,961318..962130) [819 bp, 272 aa]
           {ON} weakly similar to uniprot|Q05778 Saccharomyces
           cerevisiae YLR199C Hypothetical ORF
          Length = 272

 Score = 90.1 bits (222), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 81/281 (28%), Positives = 131/281 (46%), Gaps = 33/281 (11%)

Query: 2   LTFKQWQNDQVPRHQIDP--VVQSDPYSLVNKTTPTVTIEPESLDISPYNHCIVLPTSLK 59
           + FKQW     PRH +D    V  D  SL   + P V  E  +++ + ++   +    + 
Sbjct: 1   MLFKQWNEIAEPRHHLDSPLAVGIDDESLQKGSLPLV--ELPNINWNKFHKIFLTTGIMD 58

Query: 60  WLLPKSIINLVHIGIISGTLS-NMNE--------WESMKPVPGMYDTEEHMINSTEQFVI 110
            L PK ++ ++ +G I  TL+ + N+        W   +  P   +      N   Q + 
Sbjct: 59  PLFPKELLGVMKLGDIRTTLTIDRNQQHENGEYSWNFEENFPNEVNLNGGQDNDDGQSLT 118

Query: 111 HYN-LWRLEDTLIAIIDENEVKYPAIVTNFMTRNLAQLLRDIKDIT-----ILVNSDKIT 164
               +    D L+  + EN +K   I+ N     +AQ+L  + D T     +L  SD+IT
Sbjct: 119 FVTTVEAFGDCLLVGVKENFLKVSPIIYN----RIAQVLLSVFDGTHHELKVLGTSDRIT 174

Query: 165 ELKQLSYLV----PPEFITGSITNFILALPRKEL--KVIVVPSEGPIGFEKYNFPTVDAL 218
           ELK +S+L     PPEF+TG I + +  L  K +  +  + PSEG IGFEK +  T+  L
Sbjct: 175 ELKSISHLRSDLQPPEFVTGFIGSILTQLTVKNIPFEGFIAPSEGAIGFEKMSMNTMPEL 234

Query: 219 VDEMSKLLCSYPSQTEYYVSECLKLWKLDE-CTTTQGGLYI 258
           +D   + +      +E Y SEC + W+LD     +  GLY+
Sbjct: 235 IDICGQWIN---GNSEKYRSECYRHWRLDSGAVGSLSGLYV 272

>CAGL0A03993g Chr1 (400841..400846,400992..401804) [819 bp, 272 aa]
           {ON} similar to uniprot|Q05778 Saccharomyces cerevisiae
           YLR199c
          Length = 272

 Score = 81.6 bits (200), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 79/279 (28%), Positives = 130/279 (46%), Gaps = 29/279 (10%)

Query: 2   LTFKQWQNDQVPRHQID-PVVQSDPYSLVNKTTPTVTIEPESLDISPYNHCIVLPTSLK- 59
           + FKQW     PR+ +D P + ++  SL     P V I  E  +       I+   ++  
Sbjct: 1   MLFKQWNELSEPRNHLDAPNLVNNTESLQLLPLPDVHIPDELFEGGNVKRVILTTKTMDT 60

Query: 60  WLLPKSIINLVHIGIISGTL---SNMNEWESMKPVPGMYDTEEHMINSTE--------QF 108
           + L    + +  +  I+ +L    N+   E+       +D  E+  N  E         F
Sbjct: 61  FFLLDKTMKVKKLADITCSLEIPKNLQTHEATH----TWDFGENFPNEVEPLQDEEQRTF 116

Query: 109 VIHYNLWRLED-TLIAIIDENEVKYPAIVTNFMTRNLAQLLRDIKDITILVNSDKITELK 167
            + + ++ LED TL   IDEN +    I T  ++  +++ L    +I IL  SD+I + K
Sbjct: 117 SLRFPIYLLEDQTLYVSIDENFLTVSPIFTAQISDVISKKLNRGHEIVILGCSDRIEDTK 176

Query: 168 QLS----YLVPPEFITGSITNFILALPRKE---LKVIVVPSEGPIGFEKYNFPTVDALVD 220
             +     LVPPEF+TG + + +  L +         + PSEGP GFEK +  TVD+++D
Sbjct: 177 ICTNNNCSLVPPEFVTGFLGSLMSDLTKTNDQLFTAAIFPSEGPQGFEKLSSTTVDSIID 236

Query: 221 EMSKLLCSYPSQTEYYVSECLKLWKLDECTT-TQGGLYI 258
             S+L+ +  S+   Y  EC K WK +  +   Q GLY+
Sbjct: 237 FCSQLVSTDKSR---YTEECYKRWKRNASSNGAQSGLYL 272

>KLTH0H01188g Chr8 complement(118222..119019,119088..119093) [804
           bp, 267 aa] {ON} similar to uniprot|Q05778 Saccharomyces
           cerevisiae YLR199C Hypothetical ORF
          Length = 267

 Score = 75.5 bits (184), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 69/280 (24%), Positives = 125/280 (44%), Gaps = 36/280 (12%)

Query: 2   LTFKQWQNDQVPRHQIDPVVQ--SDPYSLVNKTTPTVTIEPESLDISPYNHCIVLPTSLK 59
           + FKQW     PRH +D  ++  +D  SL     P V +E + +D + +    ++    +
Sbjct: 1   MLFKQWNEYSEPRHHLDAPLEENTDLDSLQPAPLPEVMLE-KPIDTAGFKRAFIVTNIFR 59

Query: 60  WLLPKSIINLVHIGIISGTLSNMNEWESMKPVPGMY----DTEEHMINSTEQFVIHYNLW 115
            L    +     I       S +  W++      +Y     T+E   ++ E   + + + 
Sbjct: 60  SLFEDRLARAEQIS------SFVVVWQTKGREQHLYREDYQTQEDSRSTDETKRLEFPVH 113

Query: 116 RLED-TLIAIIDENEVKYPAIVTNFMTRNLAQLLRDIKDITILVNSDKITELKQLSY--- 171
           +L+D TL   + E+ +  P I  N ++R +A+L   + ++ +  +SD++  +K + +   
Sbjct: 114 KLDDGTLFICVREDFLHVPPISINLLSREIAKLCGGL-EVLLFGSSDRVERVKYVGFPGN 172

Query: 172 -------LVPPEFITGSITNFILALPRKELKV--IVVPSEGPIGFEKYNFPTVDALVDEM 222
                  L PPE IT    + +  L   +++    V PSEGP G+EK +  T+D L+D  
Sbjct: 173 VGKGLPLLTPPELITNFTASIMTQLLSNKVRFDGYVAPSEGPSGYEKLSMETMDLLID-- 230

Query: 223 SKLLCSYP---SQTEYYVSECLKLWKLDECT-TTQGGLYI 258
              LC         E YV  C + W+L+      Q GLY+
Sbjct: 231 ---LCWSEVRFGNREDYVKSCHRNWRLNGTVMGAQTGLYL 267

>Kwal_56.24650 s56 (1089568..1090326) [759 bp, 252 aa] {ON} YLR199C
           - Hypothetical ORF [contig 161] FULL
          Length = 252

 Score = 72.0 bits (175), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 55/158 (34%), Positives = 83/158 (52%), Gaps = 24/158 (15%)

Query: 118 EDTLIAIIDENEVKYPAIVTNFMTRNLAQLLRDIKDITILVNSDKITELKQLSY------ 171
           EDT +  + E+ +  P IV N +++ +A+L RD++ + ++  SD+I E+K +        
Sbjct: 102 EDTFLLCVAEDFLHVPPIVGNLLSQEMAKLCRDLR-VLVIGTSDRIEEVKYVGSAQNGRN 160

Query: 172 ----LVPPEFIT---GSITNFILALPRKELKVIVVPSEGPIGFEKYNFPTVDALVDEMSK 224
               L PPE IT    SIT  +L L +      V PSEGP G+EK +  T+D L+D    
Sbjct: 161 GVPPLTPPELITSFTASITTQLL-LCKVPFDGYVAPSEGPSGYEKLSMETMDKLID---- 215

Query: 225 LLCSYPSQT---EYYVSECLKLWKLDECTT-TQGGLYI 258
            LC     T   + YV E  + W+L   +T TQ GLY+
Sbjct: 216 -LCWSEISTGNRDEYVKETHRNWRLHGTSTGTQTGLYL 252

>SAKL0H06446g Chr8 (568689..569609) [921 bp, 306 aa] {ON} similar to
           uniprot|Q12052 Saccharomyces cerevisiae YPL157W TGS1
           TrimethylGuanosine Synthase
          Length = 306

 Score = 33.1 bits (74), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 48/106 (45%), Gaps = 6/106 (5%)

Query: 142 RNLAQLLRDIKDITILVNSDKITELKQLSYLVPPEFITGSITNFIL-ALPRKELKVIVVP 200
           R++ +  ++ + +   +N+  I   ++L + V PE I      F+   LP  ++ + V  
Sbjct: 47  RSIFKYWKNREKLFSQINTSNIHLTRELWFSVTPELIAKFTARFVRTCLPEAKVIMDVFC 106

Query: 201 SEG--PIGFEKYNFPTVDALVDEMSKLLCSYPSQTEYYVSECLKLW 244
             G   I F  Y FP V  +   M  L C+Y +   Y V +  +LW
Sbjct: 107 GGGGNSIQFAMY-FPKVYGIDYSMEHLYCTYKNSQAYQVDD--RLW 149

>Suva_6.257 Chr6 (455656..457485) [1830 bp, 609 aa] {ON} YJL176C
           (REAL)
          Length = 609

 Score = 33.1 bits (74), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 1/41 (2%)

Query: 21  VQSDPYSLVNKTTPTVTIEPESLDISPYNHCIVLPTSLKWL 61
           +   P  +  K  PT   EPE+ DI P  H IV+P+  KW 
Sbjct: 68  INGHPEDVETKIKPTTKTEPETFDI-PQAHEIVIPSYSKWF 107

>Smik_10.55 Chr10 complement(90082..92538) [2457 bp, 818 aa] {ON}
           YJL176C (REAL)
          Length = 818

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 18/31 (58%), Gaps = 1/31 (3%)

Query: 31  KTTPTVTIEPESLDISPYNHCIVLPTSLKWL 61
           K TP    EPE+ DI P  H IV+P+  KW 
Sbjct: 285 KKTPITKTEPETFDI-PQAHEIVIPSYSKWF 314

>TDEL0A06250 Chr1 complement(1094782..1095687) [906 bp, 301 aa] {ON}
           Anc_8.680 YPL157W
          Length = 301

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 47/106 (44%), Gaps = 6/106 (5%)

Query: 142 RNLAQLLRDIKDITILVNSDKITELKQLSYLVPPEFITGSITNFILALPRKELKVIVVPS 201
           + L +  ++ K++   ++   I    +L Y V PE I   +  FI A      +V+ V  
Sbjct: 46  KQLYKYWKNRKNLFSKIDGAPIYMTNELWYSVTPEVIAKFLAKFIRACLPDATRVMDVFC 105

Query: 202 EGP---IGFEKYNFPTVDALVDEMSKLLCSYPSQTEYYVSECLKLW 244
            G    I F K  FP V  +   +  L C+Y +   Y VS+  ++W
Sbjct: 106 GGGGNTIQFAKL-FPRVYGVDASLEHLYCTYRNAKSYDVSD--RIW 148

>CAGL0M02145g Chr13 (257734..258735) [1002 bp, 333 aa] {ON} similar
           to uniprot|Q12052 Saccharomyces cerevisiae YPL157w
          Length = 333

 Score = 31.2 bits (69), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 44/105 (41%), Gaps = 4/105 (3%)

Query: 142 RNLAQLLRDIKDITILVNSDKITELKQLSYLVPPEFITGSITNFILA-LPRKELKVIVVP 200
           + L +  R  + +   VNS  I    +L + V PE I   + NFI A LP  +  + V  
Sbjct: 80  KELVKYWRKRRTLFSKVNSMPIYMTSELWFSVTPERIARFLANFISACLPNAKRILDVFS 139

Query: 201 SEGPIGFEKYN-FPTVDALVDEMSKLLCSYPSQTEYYVSECLKLW 244
             G    +  N F  V  L   +  L CS  +   Y VS   KLW
Sbjct: 140 GGGGNSIQFANVFDRVYCLDSNLEHLYCSIKNGQSYGVSN--KLW 182

>KAFR0L00430 Chr12 (79235..81208) [1974 bp, 657 aa] {ON} Anc_6.41
           YMR006C
          Length = 657

 Score = 30.8 bits (68), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 1/45 (2%)

Query: 128 NEVKYPAIVTNFMTRNLAQLLRDIKDITILV-NSDKITELKQLSY 171
           N    P+ +TNF+T  L +L RD  DI I   N  K TE    +Y
Sbjct: 345 NSTSLPSFLTNFITHYLEELSRDSDDIAIYAPNPFKATEFVDSNY 389

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 30,124,086
Number of extensions: 1326099
Number of successful extensions: 3805
Number of sequences better than 10.0: 49
Number of HSP's gapped: 3851
Number of HSP's successfully gapped: 49
Length of query: 258
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 151
Effective length of database: 41,212,137
Effective search space: 6223032687
Effective search space used: 6223032687
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)