Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D01859g8.837ON37137113400.0
NCAS0C004308.837ON3693758581e-113
SAKL0D01540g8.837ON3652156901e-87
CAGL0M02937g8.837ON3732186859e-87
NDAI0K004408.837ON4042246836e-86
TBLA0D032308.837ON3752186772e-85
TDEL0B006008.837ON3692206702e-84
Smik_13.4898.837ON3722186684e-84
ABL129W8.837ON3452196621e-83
YMR276W (DSK2)8.837ON3732186607e-83
KAFR0B039008.837ON3792216591e-82
Kpol_1068.118.837ON3812236591e-82
Skud_13.4488.837ON3642186562e-82
ZYRO0G14124g8.837ON3692356562e-82
TPHA0I002208.837ON3772226572e-82
Suva_13.4648.837ON3662196483e-81
Kwal_27.102758.837ON3792236468e-81
Ecym_46088.837ON4062306498e-81
KLTH0C03938g8.837ON3762266302e-78
KNAG0J002908.837ON3672285771e-70
TBLA0B032408.837ON2842201565e-11
TDEL0G017504.16ON77701295e-09
Kwal_YGOB_Anc_5.7015.701ON128701327e-09
KLTH0E01078g5.701ON128701327e-09
ZYRO0G06622g5.701ON128701327e-09
KAFR0D022305.701ON128701327e-09
KAFR0H002205.701ON128701327e-09
Suva_11.3305.701ON128701327e-09
Skud_11.3335.701ON128701327e-09
YIL148W (RPL40A)5.701ON128701327e-09
YKR094C (RPL40B)5.701ON128701327e-09
SAKL0E14894g5.701ON128701318e-09
Kpol_1043.695.701ON128701318e-09
KLLA0A00616g5.701ON128701318e-09
TPHA0E002405.701ON128701318e-09
TPHA0D046005.701ON128701318e-09
TBLA0E021105.701ON128701318e-09
CAGL0G02475g5.701ON128701318e-09
NDAI0H002704.16ON77701279e-09
NDAI0E050305.701ON128701319e-09
NCAS0A032105.701ON128701319e-09
NCAS0G002405.701ON128701319e-09
Ecym_40195.701ON128701319e-09
TDEL0B022005.701ON128701311e-08
AFR285C5.701ON128701311e-08
KNAG0L021205.701ON128701311e-08
KNAG0J028804.16ON153701302e-08
TPHA0K022504.16ON153701302e-08
Ecym_84084.16ON153701302e-08
Skud_9.205.701ON125571273e-08
Smik_11.3575.701ON125571273e-08
Smik_9.215.701ON124571273e-08
Suva_10.34singletonON151701283e-08
KNAG0C065805.701ON149701284e-08
Ecym_41818.386ON152701284e-08
ZYRO0C04026g8.386ON152701274e-08
KLTH0F08734g8.386ON150701275e-08
SAKL0H13926g8.386ON154701275e-08
TPHA0C023908.386ON150701275e-08
AGL128W8.386ON152701275e-08
Kwal_23.33118.386ON150701275e-08
KLLA0D18304g8.386ON150701275e-08
Suva_9.405.701ON144571265e-08
TBLA0G006704.16ON229701306e-08
NDAI0D049304.16ON229701306e-08
KAFR0I014704.16ON229701306e-08
Kwal_55.206074.16ON231701306e-08
YLR167W (RPS31)8.386ON152701266e-08
KAFR0H020008.386ON152701266e-08
NCAS0C029408.386ON152701267e-08
NDAI0G022808.386ON152701267e-08
KNAG0A027308.386ON150701267e-08
TDEL0F051008.386ON150701258e-08
Suva_10.33singletonON254701308e-08
Kpol_1030.58.386ON152701258e-08
Kpol_1024.168.386ON152701258e-08
CAGL0G08173g8.386ON152701259e-08
SAKL0H25784g4.16ON305701301e-07
Suva_10.2668.386ON152701241e-07
Skud_12.2348.386ON152701241e-07
Smik_12.2298.386ON152701241e-07
KLTH0E05852g4.16ON409701311e-07
Suva_10.304.16ON381701301e-07
Skud_12.294.16ON381701301e-07
YLL039C (UBI4)4.16ON381701301e-07
ACL062C4.16ON382701301e-07
TBLA0H031808.386ON152701241e-07
KLLA0E00749g4.16ON381701301e-07
ZYRO0G07854g4.16ON460701302e-07
NCAS0C058504.16ON388701302e-07
NDAI0F003005.701ON187761252e-07
Smik_12.184.16ON460701302e-07
Kpol_1070.64.16ON533701302e-07
CAGL0D05082g4.16ON533701302e-07
Kpol_1036.628.311ON77571172e-07
Suva_10.32singletonON62561144e-07
TDEL0F043808.311ON77561129e-07
KLLA0F17974g8.311ON77701102e-06
ZYRO0D05962g8.311ON77561031e-05
CAGL0B01589g8.311ON77561031e-05
TPHA0C008908.311ON77701032e-05
SAKL0H15818g8.311ON77561005e-05
KAFR0E005301.480ON379561095e-05
NCAS0B035208.311ON7756987e-05
CAGL0L01309g1.480ON392671071e-04
NDAI0J010708.311ON7756971e-04
YDR139C (RUB1)8.311ON7757918e-04
KLTH0C03410g1.480ON39155990.001
Suva_10.31singletonON6458890.001
KAFR0C030008.142ON39744970.002
Kwal_27.101521.480ON38155950.003
SAKL0D11814g1.480ON40067960.003
NDAI0B01850singletonON40344930.006
TDEL0B046908.142ON44257920.007
SAKL0H24772g8.142ON41461920.007
KLTH0G12540g8.311ON7744830.009
NCAS0B045908.142ON44742910.011
KLLA0E22133g1.480ON38353880.024
AFR358W1.480ON41367880.025
TBLA0D022108.142ON56338880.026
Smik_7.918.142ON39938860.038
YGL181W (GTS1)8.142ON39638860.040
CAGL0L06028g8.142ON50538850.061
Suva_5.321.480ON40953840.070
TBLA0B021601.480ON40457820.11
Suva_7.818.142ON40138820.12
Skud_5.531.480ON39753810.14
ZYRO0D08140g6.343ON7338730.20
NDAI0G003301.480ON42753800.20
Smik_5.561.480ON39753790.28
NCAS0G041201.480ON39251790.30
YEL037C (RAD23)1.480ON39853780.35
Ecym_35721.480ON44368780.40
Ecym_31765.299ON20870760.43
Skud_12.992.411ON117170780.44
AGR326C5.150ON20259750.54
Suva_2.3008.311ON8641690.84
TPHA0O004401.480ON36926741.1
Skud_7.908.142ON39638731.4
ZYRO0F05192g1.480ON38458731.6
TPHA0H004008.142ON46638721.9
Kpol_541.508.142ON51138722.3
TDEL0C025901.480ON36826703.3
Kpol_370.61.480ON40453686.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D01859g
         (371 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D01859g Chr4 (161628..162743) [1116 bp, 371 aa] {ON} simila...   520   0.0  
NCAS0C00430 Chr3 complement(67718..68827) [1110 bp, 369 aa] {ON}...   335   e-113
SAKL0D01540g Chr4 complement(124423..125520) [1098 bp, 365 aa] {...   270   1e-87
CAGL0M02937g Chr13 (331097..332218) [1122 bp, 373 aa] {ON} highl...   268   9e-87
NDAI0K00440 Chr11 complement(99224..100438) [1215 bp, 404 aa] {O...   267   6e-86
TBLA0D03230 Chr4 complement(796939..798066) [1128 bp, 375 aa] {O...   265   2e-85
TDEL0B00600 Chr2 complement(115615..116724) [1110 bp, 369 aa] {O...   262   2e-84
Smik_13.489 Chr13 (801868..802986) [1119 bp, 372 aa] {ON} YMR276...   261   4e-84
ABL129W Chr2 (153723..154760) [1038 bp, 345 aa] {ON} Syntenic ho...   259   1e-83
YMR276W Chr13 (818827..819948) [1122 bp, 373 aa] {ON}  DSK2Nucle...   258   7e-83
KAFR0B03900 Chr2 (810391..811530) [1140 bp, 379 aa] {ON} Anc_8.8...   258   1e-82
Kpol_1068.11 s1068 complement(21199..22344) [1146 bp, 381 aa] {O...   258   1e-82
Skud_13.448 Chr13 (792186..793277) [1092 bp, 364 aa] {ON} YMR276...   257   2e-82
ZYRO0G14124g Chr7 (1125418..1126527) [1110 bp, 369 aa] {ON} simi...   257   2e-82
TPHA0I00220 Chr9 (39858..40991) [1134 bp, 377 aa] {ON} Anc_8.837...   257   2e-82
Suva_13.464 Chr13 (801516..802616) [1101 bp, 366 aa] {ON} YMR276...   254   3e-81
Kwal_27.10275 s27 complement(273277..274416) [1140 bp, 379 aa] {...   253   8e-81
Ecym_4608 Chr4 (1185310..1186530) [1221 bp, 406 aa] {ON} similar...   254   8e-81
KLTH0C03938g Chr3 complement(344354..345484) [1131 bp, 376 aa] {...   247   2e-78
KNAG0J00290 Chr10 complement(44234..45337) [1104 bp, 367 aa] {ON...   226   1e-70
TBLA0B03240 Chr2 (756434..757288) [855 bp, 284 aa] {ON} Anc_8.83...    65   5e-11
TDEL0G01750 Chr7 (343412..343645) [234 bp, 77 aa] {ON} Anc_4.16 ...    54   5e-09
Kwal_YGOB_Anc_5.701 s55 (88799..88806,89169..89547) [387 bp, 128...    55   7e-09
KLTH0E01078g Chr5 (105372..105379,105743..106121) [387 bp, 128 a...    55   7e-09
ZYRO0G06622g Chr7 (527968..527975,528043..528421) [387 bp, 128 a...    55   7e-09
KAFR0D02230 Chr4 (449707..449714,450088..450466) [387 bp, 128 aa...    55   7e-09
KAFR0H00220 Chr8 (32171..32178,32513..32891) [387 bp, 128 aa] {O...    55   7e-09
Suva_11.330 Chr11 complement(602690..603068,603446..603453) [387...    55   7e-09
Skud_11.333 Chr11 complement(599496..599874,600245..600252) [387...    55   7e-09
YIL148W Chr9 (68708..68715,69150..69528) [387 bp, 128 aa] {ON}  ...    55   7e-09
YKR094C Chr11 complement(617996..618374,618743..618750) [387 bp,...    55   7e-09
SAKL0E14894g Chr5 complement(1235488..1235866,1236205..1236212) ...    55   8e-09
Kpol_1043.69 s1043 complement(145335..145721) [387 bp, 128 aa] {...    55   8e-09
KLLA0A00616g Chr1 (59180..59187,59727..60105) [387 bp, 128 aa] {...    55   8e-09
TPHA0E00240 Chr5 (33468..33475,34104..34482) [387 bp, 128 aa] {O...    55   8e-09
TPHA0D04600 Chr4 complement(1005511..1005889,1006076..1006083) [...    55   8e-09
TBLA0E02110 Chr5 complement(516651..517029,517297..517304) [387 ...    55   8e-09
CAGL0G02475g Chr7 complement(220990..221368,222103..222110) [387...    55   8e-09
NDAI0H00270 Chr8 complement(45883..46116) [234 bp, 77 aa] {ON} A...    54   9e-09
NDAI0E05030 Chr5 complement(1148916..1149294,1149627..1149634) [...    55   9e-09
NCAS0A03210 Chr1 (633779..633786,634077..634455) [387 bp, 128 aa...    55   9e-09
NCAS0G00240 Chr7 (39394..39401,39701..40079) [387 bp, 128 aa] {O...    55   9e-09
Ecym_4019 Chr4 (48709..48716,49112..49490) [387 bp, 128 aa] {ON}...    55   9e-09
TDEL0B02200 Chr2 (395520..395527,395598..395976) [387 bp, 128 aa...    55   1e-08
AFR285C Chr6 complement(950588..950966,951128..951135) [387 bp, ...    55   1e-08
KNAG0L02120 Chr12 complement(379968..380346,380662..380669) [387...    55   1e-08
KNAG0J02880 Chr10 (550889..551350) [462 bp, 153 aa] {ON} Anc_4.1...    55   2e-08
TPHA0K02250 Chr11 (482029..482490) [462 bp, 153 aa] {ON} Anc_4.1...    55   2e-08
Ecym_8408 Chr8 (845058..845519) [462 bp, 153 aa] {ON} similar to...    55   2e-08
Skud_9.20 Chr9 (46249..46623) [375 bp, 125 aa] {ON} YKR094C (REAL)     54   3e-08
Smik_11.357 Chr11 complement(608082..608456) [375 bp, 125 aa] {O...    54   3e-08
Smik_9.21 Chr9 (46848..47219) [372 bp, 124 aa] {ON} YKR094C (REAL)     54   3e-08
Suva_10.34 Chr10 complement(69167..69622) [456 bp, 151 aa] {ON} ...    54   3e-08
KNAG0C06580 Chr3 complement(1275504..1275945,1276297..1276304) [...    54   4e-08
Ecym_4181 Chr4 complement(379972..380430) [459 bp, 152 aa] {ON} ...    54   4e-08
ZYRO0C04026g Chr3 (318229..318687) [459 bp, 152 aa] {ON} similar...    54   4e-08
KLTH0F08734g Chr6 complement(754886..755338) [453 bp, 150 aa] {O...    54   5e-08
SAKL0H13926g Chr8 complement(1189515..1189979) [465 bp, 154 aa] ...    54   5e-08
TPHA0C02390 Chr3 complement(536137..536589) [453 bp, 150 aa] {ON...    54   5e-08
AGL128W Chr7 (470174..470632) [459 bp, 152 aa] {ON} Syntenic hom...    54   5e-08
Kwal_23.3311 s23 complement(238458..238910) [453 bp, 150 aa] {ON...    54   5e-08
KLLA0D18304g Chr4 (1545371..1545823) [453 bp, 150 aa] {ON} simil...    54   5e-08
Suva_9.40 Chr9 (63806..64240) [435 bp, 144 aa] {ON} YIL148W (REAL)     53   5e-08
TBLA0G00670 Chr7 (142636..143325) [690 bp, 229 aa] {ON} Anc_4.16...    55   6e-08
NDAI0D04930 Chr4 (1172741..1173430) [690 bp, 229 aa] {ON}              55   6e-08
KAFR0I01470 Chr9 (306964..307653) [690 bp, 229 aa] {ON} Anc_5.70...    55   6e-08
Kwal_55.20607 s55 complement(488683..489378) [696 bp, 231 aa] {O...    55   6e-08
YLR167W Chr12 (498947..499405) [459 bp, 152 aa] {ON}  RPS31Fusio...    53   6e-08
KAFR0H02000 Chr8 complement(369778..370236) [459 bp, 152 aa] {ON...    53   6e-08
NCAS0C02940 Chr3 complement(552015..552473) [459 bp, 152 aa] {ON...    53   7e-08
NDAI0G02280 Chr7 complement(511522..511980) [459 bp, 152 aa] {ON...    53   7e-08
KNAG0A02730 Chr1 complement(296966..297418) [453 bp, 150 aa] {ON...    53   7e-08
TDEL0F05100 Chr6 (959574..960026) [453 bp, 150 aa] {ON} Anc_8.38...    53   8e-08
Suva_10.33 Chr10 complement(68388..69152) [765 bp, 254 aa] {ON} ...    55   8e-08
Kpol_1030.5 s1030 complement(10263..10721) [459 bp, 152 aa] {ON}...    53   8e-08
Kpol_1024.16 s1024 complement(58683..59141) [459 bp, 152 aa] {ON...    53   8e-08
CAGL0G08173g Chr7 (776549..777007) [459 bp, 152 aa] {ON} highly ...    53   9e-08
SAKL0H25784g Chr8 (2259314..2260231) [918 bp, 305 aa] {ON} highl...    55   1e-07
Suva_10.266 Chr10 (471118..471576) [459 bp, 152 aa] {ON} YLR167W...    52   1e-07
Skud_12.234 Chr12 (445677..446135) [459 bp, 152 aa] {ON} YLR167W...    52   1e-07
Smik_12.229 Chr12 (446071..446529) [459 bp, 152 aa] {ON} YLR167W...    52   1e-07
KLTH0E05852g Chr5 complement(528861..530090) [1230 bp, 409 aa] {...    55   1e-07
Suva_10.30 Chr10 complement(67747..67841,68061..68288,68558..690...    55   1e-07
Skud_12.29 Chr12 complement(55051..55829,56058..56424) [1146 bp,...    55   1e-07
YLL039C Chr12 complement(64062..65207) [1146 bp, 381 aa] {ON}  U...    55   1e-07
ACL062C Chr3 complement(255353..256501) [1149 bp, 382 aa] {ON} S...    55   1e-07
TBLA0H03180 Chr8 (775282..775740) [459 bp, 152 aa] {ON} Anc_8.38...    52   1e-07
KLLA0E00749g Chr5 complement(74948..76093) [1146 bp, 381 aa] {ON...    55   1e-07
ZYRO0G07854g Chr7 complement(634289..635671) [1383 bp, 460 aa] {...    55   2e-07
NCAS0C05850 Chr3 (1203331..1204497) [1167 bp, 388 aa] {ON}             55   2e-07
NDAI0F00300 Chr6 (66116..66679) [564 bp, 187 aa] {ON} Anc_5.701        53   2e-07
Smik_12.18 Chr12 complement(49088..49552,49091..49552,49091..495...    55   2e-07
Kpol_1070.6 s1070 complement(16980..18581) [1602 bp, 533 aa] {ON...    55   2e-07
CAGL0D05082g Chr4 (488733..490334) [1602 bp, 533 aa] {ON} simila...    55   2e-07
Kpol_1036.62 s1036 complement(173662..173746,173844..173992) [23...    50   2e-07
Suva_10.32 Chr10 complement(68200..68385) [186 bp, 62 aa] {ON} Y...    49   4e-07
TDEL0F04380 Chr6 complement(823866..823950,824011..824159) [234 ...    48   9e-07
KLLA0F17974g Chr6 (1644903..1645051,1645153..1645237) [234 bp, 7...    47   2e-06
ZYRO0D05962g Chr4 (506710..506858,506936..507020) [234 bp, 77 aa...    44   1e-05
CAGL0B01589g Chr2 (145132..145280,145404..145488) [234 bp, 77 aa...    44   1e-05
TPHA0C00890 Chr3 (187882..188030,188103..188187) [234 bp, 77 aa]...    44   2e-05
SAKL0H15818g Chr8 (1379077..1379225,1379297..1379381) [234 bp, 7...    43   5e-05
KAFR0E00530 Chr5 complement(113019..114158) [1140 bp, 379 aa] {O...    47   5e-05
NCAS0B03520 Chr2 complement(621285..621369,621473..621621) [234 ...    42   7e-05
CAGL0L01309g Chr12 complement(148931..150109) [1179 bp, 392 aa] ...    46   1e-04
NDAI0J01070 Chr10 (247102..247250,247366..247450) [234 bp, 77 aa...    42   1e-04
YDR139C Chr4 complement(733618..733702,733776..733924) [234 bp, ...    40   8e-04
KLTH0C03410g Chr3 complement(295299..296474) [1176 bp, 391 aa] {...    43   0.001
Suva_10.31 Chr10 complement(68008..68199) [192 bp, 64 aa] {ON} Y...    39   0.001
KAFR0C03000 Chr3 (597127..598320) [1194 bp, 397 aa] {ON} Anc_8.1...    42   0.002
Kwal_27.10152 s27 complement(216695..217840) [1146 bp, 381 aa] {...    41   0.003
SAKL0D11814g Chr4 (981832..983034) [1203 bp, 400 aa] {ON} simila...    42   0.003
NDAI0B01850 Chr2 complement(440321..441532) [1212 bp, 403 aa] {O...    40   0.006
TDEL0B04690 Chr2 (832571..833899) [1329 bp, 442 aa] {ON} Anc_8.1...    40   0.007
SAKL0H24772g Chr8 complement(2155837..2157081) [1245 bp, 414 aa]...    40   0.007
KLTH0G12540g Chr7 (1065801..1065949,1066013..1066097) [234 bp, 7...    37   0.009
NCAS0B04590 Chr2 complement(835478..836821) [1344 bp, 447 aa] {O...    40   0.011
KLLA0E22133g Chr5 complement(1974635..1975786) [1152 bp, 383 aa]...    39   0.024
AFR358W Chr6 (1087725..1088966) [1242 bp, 413 aa] {ON} Syntenic ...    39   0.025
TBLA0D02210 Chr4 (555236..556927) [1692 bp, 563 aa] {ON} Anc_8.1...    39   0.026
Smik_7.91 Chr7 (152642..153637,153905..154108) [1200 bp, 399 aa]...    38   0.038
YGL181W Chr7 (157906..159096) [1191 bp, 396 aa] {ON}  GTS1Protei...    38   0.040
CAGL0L06028g Chr12 complement(677581..679098) [1518 bp, 505 aa] ...    37   0.061
Suva_5.32 Chr5 complement(56798..58027) [1230 bp, 409 aa] {ON} Y...    37   0.070
TBLA0B02160 Chr2 complement(496901..498115) [1215 bp, 404 aa] {O...    36   0.11 
Suva_7.81 Chr7 (153418..154434,154933..155121) [1206 bp, 401 aa]...    36   0.12 
Skud_5.53 Chr5 complement(79502..80695) [1194 bp, 397 aa] {ON} Y...    36   0.14 
ZYRO0D08140g Chr4 (705216..705437) [222 bp, 73 aa] {ON} similar ...    33   0.20 
NDAI0G00330 Chr7 complement(54805..56088) [1284 bp, 427 aa] {ON}...    35   0.20 
Smik_5.56 Chr5 complement(83505..84698) [1194 bp, 397 aa] {ON} Y...    35   0.28 
NCAS0G04120 Chr7 (768760..769938) [1179 bp, 392 aa] {ON} Anc_1.4...    35   0.30 
YEL037C Chr5 complement(81407..82603) [1197 bp, 398 aa] {ON}  RA...    35   0.35 
Ecym_3572 Chr3 complement(1083184..1084515) [1332 bp, 443 aa] {O...    35   0.40 
Ecym_3176 Chr3 (337312..337325,337385..337997) [627 bp, 208 aa] ...    34   0.43 
Skud_12.99 Chr12 (196796..200311) [3516 bp, 1171 aa] {ON} YLR032...    35   0.44 
AGR326C Chr7 complement(1338531..1339139) [609 bp, 202 aa] {ON} ...    33   0.54 
Suva_2.300 Chr2 complement(528809..528920,529056..529204) [261 b...    31   0.84 
TPHA0O00440 Chr15 (78697..79806) [1110 bp, 369 aa] {ON} Anc_1.48...    33   1.1  
Skud_7.90 Chr7 (163529..164719) [1191 bp, 396 aa] {ON} YGL181W (...    33   1.4  
ZYRO0F05192g Chr6 (434982..436136) [1155 bp, 384 aa] {ON} simila...    33   1.6  
TPHA0H00400 Chr8 (77122..78522) [1401 bp, 466 aa] {ON} Anc_8.142...    32   1.9  
Kpol_541.50 s541 complement(162130..163665) [1536 bp, 511 aa] {O...    32   2.3  
TDEL0C02590 Chr3 complement(448900..450006) [1107 bp, 368 aa] {O...    32   3.3  
Kpol_370.6 s370 (10094..11308) [1215 bp, 404 aa] {ON} (10094..11...    31   6.2  

>KLLA0D01859g Chr4 (161628..162743) [1116 bp, 371 aa] {ON} similar
           to uniprot|P48510 Saccharomyces cerevisiae YMR276W DSK2
           Nuclear-enriched ubiquitin-like polyubiquitin- binding
           protein required for spindle pole body (SPB) duplication
           and for transit through the G2/M phase of the cell cycle
           involved in proteolysis interacts with the proteasome
          Length = 371

 Score =  520 bits (1340), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/371 (73%), Positives = 273/371 (73%)

Query: 1   MSQISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVES 60
           MSQISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVES
Sbjct: 1   MSQISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVES 60

Query: 61  YKIQDGHSVHMVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGQTGGFNPLADLTG 120
           YKIQDGHSVHMVK                                 GQTGGFNPLADLTG
Sbjct: 61  YKIQDGHSVHMVKSGGASAATTGSTTTGSAASPAATNSAAPSNISAGQTGGFNPLADLTG 120

Query: 121 ARYAGLANLPSADMFGPDGGLNSSNGANPESMLQMLENPIFQSQMNEMLSNPQMVDFLIQ 180
           ARYAGLANLPSADMFGPDGGLNSSNGANPESMLQMLENPIFQSQMNEMLSNPQMVDFLIQ
Sbjct: 121 ARYAGLANLPSADMFGPDGGLNSSNGANPESMLQMLENPIFQSQMNEMLSNPQMVDFLIQ 180

Query: 181 QNPQLQALGPRARDMLQSPFFRQMMTDPQMIRQSMQMANSMGMXXXXXXXXXXXXXXXXX 240
           QNPQLQALGPRARDMLQSPFFRQMMTDPQMIRQSMQMANSMGM                 
Sbjct: 181 QNPQLQALGPRARDMLQSPFFRQMMTDPQMIRQSMQMANSMGMSPDGAASAFPAPGSASG 240

Query: 241 XXXXNEXXXXXXXXXXXXXXXXXXXXXXPFAGXXXXXXXXXXXXXXXXXXXXXXQQPQFN 300
               NE                      PFAG                      QQPQFN
Sbjct: 241 AGGANETSTNDADSAATGAAASSTGQANPFAGLFGATPGNAAAANPFAGLFPGGQQPQFN 300

Query: 301 QELLASMFGGNSNATGAAPAVDNRPPEERYESQLRQLNDMGFFDFDRNVAALRRAGGSVQ 360
           QELLASMFGGNSNATGAAPAVDNRPPEERYESQLRQLNDMGFFDFDRNVAALRRAGGSVQ
Sbjct: 301 QELLASMFGGNSNATGAAPAVDNRPPEERYESQLRQLNDMGFFDFDRNVAALRRAGGSVQ 360

Query: 361 GALDALLNGDV 371
           GALDALLNGDV
Sbjct: 361 GALDALLNGDV 371

>NCAS0C00430 Chr3 complement(67718..68827) [1110 bp, 369 aa] {ON}
           Anc_8.837 YMR276W
          Length = 369

 Score =  335 bits (858), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 188/375 (50%), Positives = 217/375 (57%), Gaps = 15/375 (4%)

Query: 4   ISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKI 63
           IS+HVKSGQNNW V I+ A+TI   KE I+ VS VPA NQRLI+SGKILKD +TVE YKI
Sbjct: 3   ISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFYKI 62

Query: 64  QDGHSVHMVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGQTGGFNPLADLTGARY 123
            DG S+HMVK                                 G+TGGFNPL+DLT ARY
Sbjct: 63  LDGLSIHMVKSGGGSANKNKSPPPQANTTATPVAPNMAA----GETGGFNPLSDLTSARY 118

Query: 124 AGLANLPSADMFGPDGGLNSSNGANPESMLQMLENPIFQSQMNEMLSNPQMVDFLIQQNP 183
           AG  NLPSAD FGPDGGLN+S G N + ML+ML+NP+FQSQMNEMLSNPQM+DF+IQ NP
Sbjct: 119 AGYLNLPSADTFGPDGGLNNS-GPNQDEMLRMLDNPVFQSQMNEMLSNPQMLDFIIQANP 177

Query: 184 QLQALGPRARDMLQSPFFRQMMTDPQMIRQSMQMANSM-------GMXXXXXXXXXXXXX 236
           QLQA+GP+AR +LQ+P FRQM+T+P MIRQSMQMA +M       G              
Sbjct: 178 QLQAMGPQARQILQNPMFRQMLTNPDMIRQSMQMARAMNGGVDPNGNGQANTSSDFPAPG 237

Query: 237 XXXXXXXXNEXXXXXXXXXXXXXXXXXXXXXXPFAGXXXXXXXXXXXXXXXXXXXXXXQQ 296
                                           PFA                         
Sbjct: 238 GDDDNTVSENTPSTTNTASTNPSSTATTNAANPFASLFNPAMNPFAAGMANTNAAGSGNP 297

Query: 297 PQFNQELLASMFGGNSNATGAAPAVDNRPPEERYESQLRQLNDMGFFDFDRNVAALRRAG 356
           P F+    ASMF   +         D RPPEERYE QLRQLNDMGFFDFDRNVAALRR+G
Sbjct: 298 PAFDPSFFASMFQPPAAQQQQE---DTRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSG 354

Query: 357 GSVQGALDALLNGDV 371
           G+V+ AL+ALLNGDV
Sbjct: 355 GNVESALNALLNGDV 369

>SAKL0D01540g Chr4 complement(124423..125520) [1098 bp, 365 aa] {ON}
           similar to uniprot|P48510 Saccharomyces cerevisiae
           YMR276W DSK2 Nuclear-enriched ubiquitin-like
           polyubiquitin- binding protein required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle involved in proteolysis
           interacts with the proteasome
          Length = 365

 Score =  270 bits (690), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 134/215 (62%), Positives = 153/215 (71%), Gaps = 2/215 (0%)

Query: 4   ISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKI 63
           I++H+KSGQN W V IE   T+   KE IS VS +P  NQRLIYSGKILKD +TVESYKI
Sbjct: 3   ITLHIKSGQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKI 62

Query: 64  QDGHSVHMVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGQTGGFNPLADLTGARY 123
            D H+VH+V+                                 GQTGGFNPLADLTGARY
Sbjct: 63  ADDHAVHLVRSGGPKPAASKSESTSATDTGAAAAAAVPSNISSGQTGGFNPLADLTGARY 122

Query: 124 AGLANLPSADMFGPDGGLNSSNGANPESMLQMLENPIFQSQMNEMLSNPQMVDFLIQQNP 183
           AG ANLPSADMFGPDGGL  +N  N + +L ML+NPI QSQMNEMLSNPQMVDF+IQQNP
Sbjct: 123 AGYANLPSADMFGPDGGL--TNAPNSDEILNMLDNPIVQSQMNEMLSNPQMVDFMIQQNP 180

Query: 184 QLQALGPRARDMLQSPFFRQMMTDPQMIRQSMQMA 218
           QLQA+GPRAR++LQS +FRQMMT+P MIRQSMQ A
Sbjct: 181 QLQAMGPRARELLQSDYFRQMMTNPDMIRQSMQFA 215

 Score =  119 bits (299), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 59/76 (77%), Positives = 63/76 (82%), Gaps = 1/76 (1%)

Query: 297 PQFNQELLASMFGGNSNATGAAPAV-DNRPPEERYESQLRQLNDMGFFDFDRNVAALRRA 355
           PQF+  LL+S  GGN+ A G      DNRPPEERYE QLRQLNDMGFFDFDRNVAALRR+
Sbjct: 290 PQFDPSLLSSFLGGNTAAPGQQQQPQDNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRS 349

Query: 356 GGSVQGALDALLNGDV 371
           GGSVQGALDALLNGDV
Sbjct: 350 GGSVQGALDALLNGDV 365

>CAGL0M02937g Chr13 (331097..332218) [1122 bp, 373 aa] {ON} highly
           similar to uniprot|P48510 Saccharomyces cerevisiae
           YMR276w DSK2
          Length = 373

 Score =  268 bits (685), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 157/218 (72%), Gaps = 4/218 (1%)

Query: 4   ISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKI 63
           I++H+KSGQN W V I+ + TI   KE I+ VS +P+ NQRLIYSGKILKD +TVESY I
Sbjct: 3   ITIHIKSGQNKWDVSIDPSQTILNLKEEIAKVSEIPSGNQRLIYSGKILKDDQTVESYNI 62

Query: 64  QDGHSVHMVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGQTGGFNPLADLTGARY 123
           +D H++HMVK                                 GQTGGFNPLADLTGARY
Sbjct: 63  KDDHAIHMVKSGGNASTSNAPTNANESSNSSTTAVPSNIAS--GQTGGFNPLADLTGARY 120

Query: 124 AGLANLPSADMFGPDGGLNSSNGANPESMLQMLENPIFQSQMNEMLSNPQMVDFLIQQNP 183
           AG ANLPSADMFGPDGG+N  N  + + ML+M+ENPIFQSQMNEMLSNP+M+DF+IQ NP
Sbjct: 121 AGYANLPSADMFGPDGGIN--NAPDQDEMLRMMENPIFQSQMNEMLSNPEMLDFMIQSNP 178

Query: 184 QLQALGPRARDMLQSPFFRQMMTDPQMIRQSMQMANSM 221
           QLQA+GP+AR MLQSPFFRQM+T+P MIRQSMQ A  M
Sbjct: 179 QLQAMGPQARQMLQSPFFRQMLTNPAMIRQSMQFARMM 216

 Score =  117 bits (292), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 64/78 (82%), Gaps = 5/78 (6%)

Query: 295 QQPQFNQELLASMFGGNSNATGAAPA-VDNRPPEERYESQLRQLNDMGFFDFDRNVAALR 353
           QQP F+  LLAS+ GG       APA  DNRPPEERYE QLRQLNDMGFFDFDRNVAALR
Sbjct: 300 QQPAFDPTLLASLLGGQL----PAPAQEDNRPPEERYEQQLRQLNDMGFFDFDRNVAALR 355

Query: 354 RAGGSVQGALDALLNGDV 371
           R+GGSVQGALDALLNGDV
Sbjct: 356 RSGGSVQGALDALLNGDV 373

>NDAI0K00440 Chr11 complement(99224..100438) [1215 bp, 404 aa] {ON}
           Anc_8.837 YMR276W
          Length = 404

 Score =  267 bits (683), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 136/224 (60%), Positives = 158/224 (70%), Gaps = 6/224 (2%)

Query: 1   MSQISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVES 60
           MS IS+H+KSGQNNW V I++ A+I   K+ I+ VS +PA NQRLIYSGKILKD + V+ 
Sbjct: 1   MSTISIHIKSGQNNWQVSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDF 60

Query: 61  YKIQDGHSVHMVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGQTGGFNPLADLTG 120
           Y IQDGHSVH+V+                                 GQTGGFNPLADLT 
Sbjct: 61  YNIQDGHSVHLVRSGKKSTPTPATTNTTTNASNNTVPSNISA----GQTGGFNPLADLTS 116

Query: 121 ARYAGL-ANLPSADMFGPDGGLNSSNGANPESMLQMLENPIFQSQMNEMLSNPQMVDFLI 179
           ARYAG   NLPSAD FGPDGG+N S G NP+  L ML+NPI QSQMNEMLSNPQM+DF+I
Sbjct: 117 ARYAGYNLNLPSADAFGPDGGMNQS-GTNPDEFLSMLDNPIVQSQMNEMLSNPQMIDFMI 175

Query: 180 QQNPQLQALGPRARDMLQSPFFRQMMTDPQMIRQSMQMANSMGM 223
           Q NPQLQA+GP+AR M QSP FRQM+T+P MIRQSMQ+AN MGM
Sbjct: 176 QSNPQLQAMGPQARQMFQSPMFRQMLTNPDMIRQSMQLANMMGM 219

 Score =  106 bits (264), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 58/75 (77%)

Query: 297 PQFNQELLASMFGGNSNATGAAPAVDNRPPEERYESQLRQLNDMGFFDFDRNVAALRRAG 356
           P F+  + AS+FGG    +      D RPPEERYE+QLRQLNDMGFFDFDRN+AALRR G
Sbjct: 330 PPFDPSMFASLFGGAGAPSTTPQQQDTRPPEERYETQLRQLNDMGFFDFDRNIAALRRTG 389

Query: 357 GSVQGALDALLNGDV 371
           GSV+ A++ALLNGDV
Sbjct: 390 GSVEAAVNALLNGDV 404

>TBLA0D03230 Chr4 complement(796939..798066) [1128 bp, 375 aa] {ON}
           Anc_8.837 YMR276W
          Length = 375

 Score =  265 bits (677), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 132/218 (60%), Positives = 155/218 (71%), Gaps = 2/218 (0%)

Query: 4   ISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKI 63
           ISVH+KSGQN W VEIE+++TI+ FK+ I+ VS +PA NQRLIYSGKILKD +T+ESYKI
Sbjct: 3   ISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESYKI 62

Query: 64  QDGHSVHMVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGQTGGFNPLADLTGARY 123
           QDGHS+HMVK                                 G+  GFNPL+DLT ARY
Sbjct: 63  QDGHSIHMVKSGAHATASSTTNSMTTTNTTAPQNNNGSSGMSTGRGSGFNPLSDLTSARY 122

Query: 124 AGLANLPSADMFGPDGGLNSSNGANPESMLQMLENPIFQSQMNEMLSNPQMVDFLIQQNP 183
           AG  NLPSADMFGPDGG  +S     + ML MLENP+FQSQMNEMLSNP++VDFLI  NP
Sbjct: 123 AGYTNLPSADMFGPDGGSFASQSQ--DDMLHMLENPVFQSQMNEMLSNPEIVDFLINSNP 180

Query: 184 QLQALGPRARDMLQSPFFRQMMTDPQMIRQSMQMANSM 221
           QLQ+LGP+AR M QSP FRQM+T+P MIRQSM+MA  M
Sbjct: 181 QLQSLGPQARTMFQSPMFRQMLTNPDMIRQSMRMAQMM 218

 Score = 92.4 bits (228), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 46/47 (97%)

Query: 322 DNRPPEERYESQLRQLNDMGFFDFDRNVAALRRAGGSVQGALDALLN 368
           DNRPPEERYE QLRQLNDMGFFDFD+NVAALRR+GGSVQGA++ALL+
Sbjct: 327 DNRPPEERYEHQLRQLNDMGFFDFDKNVAALRRSGGSVQGAVNALLS 373

>TDEL0B00600 Chr2 complement(115615..116724) [1110 bp, 369 aa] {ON}
           Anc_8.837 YMR276W
          Length = 369

 Score =  262 bits (670), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 131/220 (59%), Positives = 154/220 (70%), Gaps = 4/220 (1%)

Query: 4   ISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKI 63
           I+V VK GQ+ W V +    T+  FK+ I+ VS +PA NQRLIYSGKILKD + VESYKI
Sbjct: 3   ITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESYKI 62

Query: 64  QDGHSVHMVKXXXXXXXXXXXXXXXXXXXXXXX--XXXXXXXXXXGQTGGFNPLADLTGA 121
           QDGH++H+VK                                   GQTGGFNPL+DLT A
Sbjct: 63  QDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIASGQTGGFNPLSDLTSA 122

Query: 122 RYAGLANLPSADMFGPDGGLNSSNGANPESMLQMLENPIFQSQMNEMLSNPQMVDFLIQQ 181
           RYAG  NLPSADMFGPDGGL  +N  N + ML MLENPIFQSQMNEMLSNPQMVDF+IQ 
Sbjct: 123 RYAGFTNLPSADMFGPDGGL--TNMPNQDDMLGMLENPIFQSQMNEMLSNPQMVDFMIQS 180

Query: 182 NPQLQALGPRARDMLQSPFFRQMMTDPQMIRQSMQMANSM 221
           NPQLQA+GP+AR +LQSPFFRQM+T+PQM+RQSMQ ++ M
Sbjct: 181 NPQLQAMGPQARQLLQSPFFRQMLTNPQMLRQSMQFSSMM 220

 Score =  106 bits (264), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 60/73 (82%), Gaps = 2/73 (2%)

Query: 299 FNQELLASMFGGNSNATGAAPAVDNRPPEERYESQLRQLNDMGFFDFDRNVAALRRAGGS 358
           F+  +LAS+ GG +    A    DNRPPEERYE QLRQLNDMGFFDF++NVAALRR+GGS
Sbjct: 299 FDPSMLASLLGGGAAQQRAE--QDNRPPEERYEQQLRQLNDMGFFDFEKNVAALRRSGGS 356

Query: 359 VQGALDALLNGDV 371
           VQGALD+LLNGDV
Sbjct: 357 VQGALDSLLNGDV 369

>Smik_13.489 Chr13 (801868..802986) [1119 bp, 372 aa] {ON} YMR276W
           (REAL)
          Length = 372

 Score =  261 bits (668), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 127/218 (58%), Positives = 153/218 (70%)

Query: 4   ISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKI 63
           +++H+KSGQ+ W V +   +T+  FKE IS  +GVP  NQRLIYSGKILKD +TVESY I
Sbjct: 3   LNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHI 62

Query: 64  QDGHSVHMVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGQTGGFNPLADLTGARY 123
           QDGHSVH+VK                                 GQ+ GFNPLADLT ARY
Sbjct: 63  QDGHSVHLVKSQPKPQPGAAAGTNNATATGAAAGTVATPNMSSGQSAGFNPLADLTSARY 122

Query: 124 AGLANLPSADMFGPDGGLNSSNGANPESMLQMLENPIFQSQMNEMLSNPQMVDFLIQQNP 183
           AG  N+PSADMFGPDGG  +++  N + +L+M+ENPIFQSQMNEMLSNPQM+DF+IQ NP
Sbjct: 123 AGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQSNP 182

Query: 184 QLQALGPRARDMLQSPFFRQMMTDPQMIRQSMQMANSM 221
           QLQA+GP+AR MLQSP FRQM+T+P MIRQSMQ A  M
Sbjct: 183 QLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMM 220

 Score =  112 bits (279), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 60/75 (80%)

Query: 297 PQFNQELLASMFGGNSNATGAAPAVDNRPPEERYESQLRQLNDMGFFDFDRNVAALRRAG 356
           P F+  LLASMF     +  A+   D RPPEERYE QLRQLNDMGFFDFDRNVAALRR+G
Sbjct: 298 PAFDPALLASMFQPQQASAQASQPEDTRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSG 357

Query: 357 GSVQGALDALLNGDV 371
           GSVQGALD+LLNGDV
Sbjct: 358 GSVQGALDSLLNGDV 372

>ABL129W Chr2 (153723..154760) [1038 bp, 345 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR276W (DSK2)
          Length = 345

 Score =  259 bits (662), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 127/219 (57%), Positives = 155/219 (70%), Gaps = 2/219 (0%)

Query: 4   ISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKI 63
           I + VKSGQN W V +E++ ++   K+ I+ VS +PA+NQRLIYSGKILKD +TVESYKI
Sbjct: 3   IKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESYKI 62

Query: 64  QDGHSVHMVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGQTGGFNPLADLTGARY 123
            DGH++H+VK                                 GQ+GGFNPLADLTGARY
Sbjct: 63  ADGHAIHLVKSGGAKAAPAASAAGGESTGAAAGAGAVPSSISAGQSGGFNPLADLTGARY 122

Query: 124 AGLANLPSADMFGPDGGLNSSNGANPESMLQMLENPIFQSQMNEMLSNPQMVDFLIQQNP 183
           AG  NLPS DMFGPDGGLNS+ G   E ++ MLENPIFQSQMNEML+NPQM+DFLIQQ+P
Sbjct: 123 AGYTNLPSTDMFGPDGGLNSAVGQ--EEIIGMLENPIFQSQMNEMLNNPQMIDFLIQQHP 180

Query: 184 QLQALGPRARDMLQSPFFRQMMTDPQMIRQSMQMANSMG 222
            LQA+GP AR+MLQSPFFRQM+T+P +IRQ  ++   MG
Sbjct: 181 HLQAMGPAAREMLQSPFFRQMLTNPDIIRQMSRLQMGMG 219

 Score =  105 bits (263), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 53/75 (70%), Positives = 58/75 (77%), Gaps = 3/75 (4%)

Query: 297 PQFNQELLASMFGGNSNATGAAPAVDNRPPEERYESQLRQLNDMGFFDFDRNVAALRRAG 356
           P  +  +L+S+F        +    DNRPPEERYE QLRQLNDMGFFDFDRNVAALRRAG
Sbjct: 274 PPLDPAMLSSLF---GAGAASPAPADNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRAG 330

Query: 357 GSVQGALDALLNGDV 371
           GSVQGALDALLNGDV
Sbjct: 331 GSVQGALDALLNGDV 345

>YMR276W Chr13 (818827..819948) [1122 bp, 373 aa] {ON}
           DSK2Nuclear-enriched ubiquitin-like
           polyubiquitin-binding protein, required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle, involved in proteolysis,
           interacts with the proteasome
          Length = 373

 Score =  258 bits (660), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 125/218 (57%), Positives = 153/218 (70%)

Query: 4   ISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKI 63
           +++H+KSGQ+ W V +   +T+  FKE I+  +G+P  NQRLIYSGKILKD +TVESY I
Sbjct: 3   LNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHI 62

Query: 64  QDGHSVHMVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGQTGGFNPLADLTGARY 123
           QDGHSVH+VK                                 GQ+ GFNPLADLT ARY
Sbjct: 63  QDGHSVHLVKSQPKPQTASAAGANNATATGAAAGTGATPNMSSGQSAGFNPLADLTSARY 122

Query: 124 AGLANLPSADMFGPDGGLNSSNGANPESMLQMLENPIFQSQMNEMLSNPQMVDFLIQQNP 183
           AG  N+PSADMFGPDGG  +++  N + +L+M+ENPIFQSQMNEMLSNPQM+DF+IQ NP
Sbjct: 123 AGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQSNP 182

Query: 184 QLQALGPRARDMLQSPFFRQMMTDPQMIRQSMQMANSM 221
           QLQA+GP+AR MLQSP FRQM+T+P MIRQSMQ A  M
Sbjct: 183 QLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMM 220

 Score =  109 bits (272), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 56/75 (74%), Positives = 60/75 (80%), Gaps = 3/75 (4%)

Query: 297 PQFNQELLASMFGGNSNATGAAPAVDNRPPEERYESQLRQLNDMGFFDFDRNVAALRRAG 356
           P F+  LLASMF        A+ A D RPPEERYE QLRQLNDMGFFDFDRNVAALRR+G
Sbjct: 302 PAFDPALLASMF---QPPVQASQAEDTRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSG 358

Query: 357 GSVQGALDALLNGDV 371
           GSVQGALD+LLNGDV
Sbjct: 359 GSVQGALDSLLNGDV 373

>KAFR0B03900 Chr2 (810391..811530) [1140 bp, 379 aa] {ON} Anc_8.837
           YMR276W
          Length = 379

 Score =  258 bits (659), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 153/221 (69%), Gaps = 5/221 (2%)

Query: 4   ISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKI 63
           I++H+KSGQN W V    + +I   KE IS +S +PA NQRLIYSGKILKD +TVESYKI
Sbjct: 3   ITIHIKSGQNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKI 62

Query: 64  QDGHSVHMVKX---XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGQTGGFNPLADLTG 120
           ++GHS+H+VK                                    GQTGGFNPL DLT 
Sbjct: 63  EEGHSIHLVKSGGNVARNSAATNTTPTATSNENTNSAPSVPSNIASGQTGGFNPLNDLTS 122

Query: 121 ARYAGLANLPSADMFGPDGGLNSSNGANPESMLQMLENPIFQSQMNEMLSNPQMVDFLIQ 180
           ARYAG  N+PSADMFGPDGGLNS  G + + ML+ML+NP+FQSQMNEMLSNPQM+DF+IQ
Sbjct: 123 ARYAGYLNMPSADMFGPDGGLNS--GPSQDDMLRMLDNPVFQSQMNEMLSNPQMIDFMIQ 180

Query: 181 QNPQLQALGPRARDMLQSPFFRQMMTDPQMIRQSMQMANSM 221
            NPQLQA+GP+AR MLQSP FRQM+ +P MIRQSMQ A  M
Sbjct: 181 SNPQLQAMGPQARQMLQSPMFRQMLINPDMIRQSMQFARMM 221

 Score =  114 bits (286), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 64/78 (82%), Gaps = 3/78 (3%)

Query: 295 QQPQFNQELLASMFG-GNSNATGAAPAVDNRPPEERYESQLRQLNDMGFFDFDRNVAALR 353
           QQP F+  LLASM G   S  T A    DNRPPEERYE+QLRQLNDMGFFDFDRNVAALR
Sbjct: 304 QQPAFDPALLASMLGMPQSQQTPAQ--QDNRPPEERYEAQLRQLNDMGFFDFDRNVAALR 361

Query: 354 RAGGSVQGALDALLNGDV 371
           R+GGSVQGALDALLNGDV
Sbjct: 362 RSGGSVQGALDALLNGDV 379

>Kpol_1068.11 s1068 complement(21199..22344) [1146 bp, 381 aa] {ON}
           complement(21199..22344) [1146 nt, 382 aa]
          Length = 381

 Score =  258 bits (659), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 130/223 (58%), Positives = 155/223 (69%), Gaps = 6/223 (2%)

Query: 4   ISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKI 63
           I +H+KSGQN W V ++ + T+   KE I+ VS +P +NQRLIYSGKILKD + +E YKI
Sbjct: 3   IKIHIKSGQNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKI 62

Query: 64  QDGHSVHMVKXXXXXXXXXXXXXXXXXXXXXXXXXXXX---XXXXXGQTGGFNPLADLTG 120
           QD HS+H+VK                                    GQ+GGFNPL+DLT 
Sbjct: 63  QDEHSIHLVKSGGASKTNTSASAAAASTSTATNSDSNAPLPSNIAAGQSGGFNPLSDLTS 122

Query: 121 ARYAGLA-NLPSADMFGPDGGLNSSNGANPESMLQMLENPIFQSQMNEMLSNPQMVDFLI 179
           ARYAG   NLPSADMFGPDGG+NS    N + ML+MLENP+FQSQMNEMLSNPQM+DF+I
Sbjct: 123 ARYAGYGLNLPSADMFGPDGGMNSM--PNQDDMLRMLENPVFQSQMNEMLSNPQMIDFMI 180

Query: 180 QQNPQLQALGPRARDMLQSPFFRQMMTDPQMIRQSMQMANSMG 222
           Q NPQLQA+GP AR M QSPFFRQM+T+P+MIRQSMQMAN MG
Sbjct: 181 QSNPQLQAMGPEARQMFQSPFFRQMLTNPEMIRQSMQMANMMG 223

 Score =  106 bits (265), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 57/75 (76%), Gaps = 3/75 (4%)

Query: 297 PQFNQELLASMFGGNSNATGAAPAVDNRPPEERYESQLRQLNDMGFFDFDRNVAALRRAG 356
           P F+  L ASMF             DNRPPEERYESQLRQLNDMGFFDFDRNVAALRR+G
Sbjct: 310 PAFDPSLFASMF---QPPQQQQQEQDNRPPEERYESQLRQLNDMGFFDFDRNVAALRRSG 366

Query: 357 GSVQGALDALLNGDV 371
           GSVQGALDALL+ DV
Sbjct: 367 GSVQGALDALLSNDV 381

>Skud_13.448 Chr13 (792186..793277) [1092 bp, 364 aa] {ON} YMR276W
           (REAL)
          Length = 364

 Score =  257 bits (656), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 123/218 (56%), Positives = 152/218 (69%)

Query: 4   ISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKI 63
           +++H+KSGQ+ W V +    T+  FKE IS  + +P  NQRLIYSGKILKD +TV+SY I
Sbjct: 3   LNIHIKSGQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHI 62

Query: 64  QDGHSVHMVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGQTGGFNPLADLTGARY 123
           QDGHSVH+VK                                 GQ+ GFNPLADLT ARY
Sbjct: 63  QDGHSVHLVKSQPKPDAGGATGANNATATSAAVGTSATPNMSSGQSAGFNPLADLTSARY 122

Query: 124 AGLANLPSADMFGPDGGLNSSNGANPESMLQMLENPIFQSQMNEMLSNPQMVDFLIQQNP 183
           AG  N+PSADMFGPDGG  +++  N + +L+M+ENPIFQSQMNEMLSNPQM+DF+IQ NP
Sbjct: 123 AGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQSNP 182

Query: 184 QLQALGPRARDMLQSPFFRQMMTDPQMIRQSMQMANSM 221
           QLQA+GP+AR MLQSP FRQM+T+P+M+RQSMQ A  M
Sbjct: 183 QLQAMGPQARQMLQSPMFRQMLTNPEMMRQSMQFARMM 220

 Score =  112 bits (279), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 61/75 (81%)

Query: 297 PQFNQELLASMFGGNSNATGAAPAVDNRPPEERYESQLRQLNDMGFFDFDRNVAALRRAG 356
           P F+  LLASMF     +  A+   D+RPPEERYE QLRQLNDMGFFDFDRNVAALRR+G
Sbjct: 290 PAFDPALLASMFQPQQASAQASQPEDSRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSG 349

Query: 357 GSVQGALDALLNGDV 371
           GSVQGALD+LLNGDV
Sbjct: 350 GSVQGALDSLLNGDV 364

>ZYRO0G14124g Chr7 (1125418..1126527) [1110 bp, 369 aa] {ON} similar
           to uniprot|P48510 Saccharomyces cerevisiae YMR276W DSK2
           Nuclear-enriched ubiquitin-like polyubiquitin- binding
           protein required for spindle pole body (SPB) duplication
           and for transit through the G2/M phase of the cell cycle
           involved in proteolysis interacts with the proteasome
          Length = 369

 Score =  257 bits (656), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 132/235 (56%), Positives = 156/235 (66%), Gaps = 16/235 (6%)

Query: 1   MSQISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVES 60
           MS I+V +KSGQN W V ++  +T+  FKE IS VS +PA +QRLIYSGKILKD +T++ 
Sbjct: 1   MSTITVQIKSGQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQF 60

Query: 61  YKIQDGHSVHMVKXXXX--------------XXXXXXXXXXXXXXXXXXXXXXXXXXXXX 106
           Y +QDGHSVH+VK                                               
Sbjct: 61  YNLQDGHSVHLVKSSKAPGNASGGSSSTAAATAGSGASAVPPSGNASTTPTTGAPSNLSA 120

Query: 107 GQTGGFNPLADLTGARYAGLANLPSADMFGPDGGLNSSNGANPESMLQMLENPIFQSQMN 166
           GQ+GGFNPLADLT ARYAG  +LPSADMFGPDGG  ++N  N E +L ML+NPIFQSQMN
Sbjct: 121 GQSGGFNPLADLTSARYAGFTSLPSADMFGPDGG--ATNMPNQEDLLNMLDNPIFQSQMN 178

Query: 167 EMLSNPQMVDFLIQQNPQLQALGPRARDMLQSPFFRQMMTDPQMIRQSMQMANSM 221
           EMLSNPQMVDF+IQ NPQLQA+GP+AR M QSPFFRQM+T+PQMIRQSMQ A  M
Sbjct: 179 EMLSNPQMVDFMIQSNPQLQAMGPQARQMFQSPFFRQMLTNPQMIRQSMQFARMM 233

 Score =  105 bits (263), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 53/70 (75%), Positives = 58/70 (82%), Gaps = 3/70 (4%)

Query: 302 ELLASMFGGNSNATGAAPAVDNRPPEERYESQLRQLNDMGFFDFDRNVAALRRAGGSVQG 361
           +LLASM G  S         DNRPPEERYE+QLRQLN+MGFFDFDRNVAALRR+GGSVQG
Sbjct: 303 QLLASMLGAPSQQQQPQ---DNRPPEERYETQLRQLNEMGFFDFDRNVAALRRSGGSVQG 359

Query: 362 ALDALLNGDV 371
           ALD+LLNGDV
Sbjct: 360 ALDSLLNGDV 369

>TPHA0I00220 Chr9 (39858..40991) [1134 bp, 377 aa] {ON} Anc_8.837
           YMR276W
          Length = 377

 Score =  257 bits (657), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 134/222 (60%), Positives = 153/222 (68%), Gaps = 6/222 (2%)

Query: 4   ISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKI 63
           ISV +KSGQN W V +E + TI  FKE IS  S +PA NQRLIYSGKILKD ETVESYKI
Sbjct: 3   ISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESYKI 62

Query: 64  QDGHSVHMVKX---XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGQTGGFNPLADLTG 120
           QDGHS+H+VK                                    GQT GFNPLADLT 
Sbjct: 63  QDGHSIHLVKSGDASANAAKSSTAAAATANAAAGSAESAVPTNITSGQTNGFNPLADLTS 122

Query: 121 ARYAGL-ANLPSADMFGPDGGLNSSNGANPESMLQMLENPIFQSQMNEMLSNPQMVDFLI 179
           ARYAG    +PSADMFGPDGG+  +N  N + ML MLENP+FQSQMNEMLSNPQMV+++I
Sbjct: 123 ARYAGYNLPMPSADMFGPDGGM--TNMPNQDDMLSMLENPVFQSQMNEMLSNPQMVEYMI 180

Query: 180 QQNPQLQALGPRARDMLQSPFFRQMMTDPQMIRQSMQMANSM 221
             NPQLQALGP+AR+M QSPFFRQM+T+P MIRQSM+MA  M
Sbjct: 181 NSNPQLQALGPQAREMFQSPFFRQMLTNPDMIRQSMEMARMM 222

 Score =  100 bits (250), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 58/78 (74%), Gaps = 6/78 (7%)

Query: 295 QQPQFNQELLASMFGGNSNATGAAPA-VDNRPPEERYESQLRQLNDMGFFDFDRNVAALR 353
           Q P FN  +LASM           PA  D RPPE RYESQLRQLNDMGFF+FDRN+AALR
Sbjct: 305 QYPGFNPSMLASML-----QQPRQPAQEDTRPPEVRYESQLRQLNDMGFFEFDRNIAALR 359

Query: 354 RAGGSVQGALDALLNGDV 371
           R+GGSVQGALDALLN DV
Sbjct: 360 RSGGSVQGALDALLNNDV 377

>Suva_13.464 Chr13 (801516..802616) [1101 bp, 366 aa] {ON} YMR276W
           (REAL)
          Length = 366

 Score =  254 bits (648), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 126/219 (57%), Positives = 153/219 (69%), Gaps = 1/219 (0%)

Query: 4   ISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKI 63
           ++V+VKSGQ+ W V +   +T+  FKE IS  +G+P  NQRLIYSGKILKD +TVESY I
Sbjct: 3   LNVYVKSGQDKWEVSVAPESTVLQFKEAISEANGIPVANQRLIYSGKILKDDQTVESYHI 62

Query: 64  QDGHSVHMVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXGQTGGFNPLADLTGAR 122
           QDGHSVH+VK                                  GQ+ GFNPLADLT AR
Sbjct: 63  QDGHSVHLVKSQPRPQAGAATGAGGDAGASATNASVSATPNMSSGQSAGFNPLADLTSAR 122

Query: 123 YAGLANLPSADMFGPDGGLNSSNGANPESMLQMLENPIFQSQMNEMLSNPQMVDFLIQQN 182
           YAG  N+PSADMFGPDGG  +++  N + +L+M++NPIFQSQMNEMLSNPQM+DF+IQ N
Sbjct: 123 YAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMDNPIFQSQMNEMLSNPQMLDFMIQSN 182

Query: 183 PQLQALGPRARDMLQSPFFRQMMTDPQMIRQSMQMANSM 221
           PQLQA+GP+AR MLQSP FRQM+T+P MIRQSMQ A  M
Sbjct: 183 PQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMM 221

 Score =  110 bits (276), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 56/75 (74%), Positives = 59/75 (78%)

Query: 297 PQFNQELLASMFGGNSNATGAAPAVDNRPPEERYESQLRQLNDMGFFDFDRNVAALRRAG 356
           P F+  LLASMF     A  A    D RPPEERYE QLRQLNDMGFFDFDRNVAALRR+G
Sbjct: 292 PAFDPALLASMFQPQQAAAQAPQPEDTRPPEERYEQQLRQLNDMGFFDFDRNVAALRRSG 351

Query: 357 GSVQGALDALLNGDV 371
           GSVQGALD+LLNGDV
Sbjct: 352 GSVQGALDSLLNGDV 366

>Kwal_27.10275 s27 complement(273277..274416) [1140 bp, 379 aa] {ON}
           YMR276W (DSK2) - ubiquitin-like protein [contig 37] FULL
          Length = 379

 Score =  253 bits (646), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 126/223 (56%), Positives = 155/223 (69%), Gaps = 6/223 (2%)

Query: 4   ISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKI 63
           I+VHVKSGQ+ W V +++ +T+  FK  I+  S +  +NQRLIYSGKILKD +T+ESYKI
Sbjct: 3   ITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESYKI 62

Query: 64  QDGHSVHMVKXXXXXXXXXX----XXXXXXXXXXXXXXXXXXXXXXXGQTGGFNPLADLT 119
            DGH+VH+VK                                     GQ GGFNPL+DLT
Sbjct: 63  LDGHAVHLVKSGTKSGSGAIGAPGSGSTAPTNTASSGAAAAPASLSSGQAGGFNPLSDLT 122

Query: 120 GARYAGLANLPSADMFGPDGGLNSSNGANPESMLQMLENPIFQSQMNEMLSNPQMVDFLI 179
            ARYAG  NLPSAD FGPDGG+ S+   N + ML+MLENP+ QSQMNEMLSNPQM+DFLI
Sbjct: 123 SARYAGYLNLPSADSFGPDGGMTSA--PNSDDMLRMLENPVMQSQMNEMLSNPQMIDFLI 180

Query: 180 QQNPQLQALGPRARDMLQSPFFRQMMTDPQMIRQSMQMANSMG 222
           QQ+PQLQ++GP+AR MLQSPFFRQMMT+P+MIRQSMQ +  +G
Sbjct: 181 QQSPQLQSMGPQARQMLQSPFFRQMMTNPEMIRQSMQFSGVLG 223

 Score =  109 bits (273), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 53/75 (70%), Positives = 60/75 (80%), Gaps = 1/75 (1%)

Query: 297 PQFNQELLASMFGGNSNATGAAPAVDNRPPEERYESQLRQLNDMGFFDFDRNVAALRRAG 356
           P F+  +L+++ GG  N     P  D RPPEERYE QLRQLNDMGFF+FDRNVAALRR+G
Sbjct: 306 PAFDPAMLSALLGGAGNNASQQPQ-DTRPPEERYEQQLRQLNDMGFFEFDRNVAALRRSG 364

Query: 357 GSVQGALDALLNGDV 371
           GSVQGALDALLNGDV
Sbjct: 365 GSVQGALDALLNGDV 379

>Ecym_4608 Chr4 (1185310..1186530) [1221 bp, 406 aa] {ON} similar to
           Ashbya gossypii ABL129W
          Length = 406

 Score =  254 bits (649), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 130/230 (56%), Positives = 155/230 (67%), Gaps = 13/230 (5%)

Query: 4   ISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKI 63
           IS+HVKSGQN W V  + +++I   K+ I+ VS +PA+NQRLIYSGKILKD +TVESYKI
Sbjct: 3   ISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKI 62

Query: 64  QDGHSVHMVK-----------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGQTGGF 112
            DGHS+H+V+                                            GQ GGF
Sbjct: 63  ADGHSIHLVRSGGGKVSGSSGATGGASGSVEAVGSGGRNSTAGSGSTVPNNITAGQMGGF 122

Query: 113 NPLADLTGARYAGLANLPSADMFGPDGGLNSSNGANPESMLQMLENPIFQSQMNEMLSNP 172
           NPLADLTGARYAG ANLPS DMFGPDGGLNS+ G   E +L ML+NPIFQSQ+NEML+NP
Sbjct: 123 NPLADLTGARYAGYANLPSTDMFGPDGGLNSAIGQ--EEILGMLDNPIFQSQVNEMLANP 180

Query: 173 QMVDFLIQQNPQLQALGPRARDMLQSPFFRQMMTDPQMIRQSMQMANSMG 222
           QM+DFLIQQ+P LQA+GP AR+MLQSPFFRQMMT+P +IRQ  +    MG
Sbjct: 181 QMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMMTNPDVIRQVSRFQMDMG 230

 Score =  102 bits (255), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 58/75 (77%)

Query: 297 PQFNQELLASMFGGNSNATGAAPAVDNRPPEERYESQLRQLNDMGFFDFDRNVAALRRAG 356
           P  +  +L+++  G   ATG     DNRPPEERY+ QL QLN+MGF DFDRNVAALRR+G
Sbjct: 332 PPLDPAMLSALLSGGFTATGRQQTEDNRPPEERYQQQLEQLNEMGFVDFDRNVAALRRSG 391

Query: 357 GSVQGALDALLNGDV 371
           GSVQGAL+ALLNGDV
Sbjct: 392 GSVQGALNALLNGDV 406

>KLTH0C03938g Chr3 complement(344354..345484) [1131 bp, 376 aa] {ON}
           some similarities with uniprot|P48510 Saccharomyces
           cerevisiae YMR276W DSK2 Nuclear-enriched ubiquitin-like
           polyubiquitin-binding protein required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle involved in proteolysis
           interacts with the proteasome
          Length = 376

 Score =  247 bits (630), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 125/226 (55%), Positives = 151/226 (66%), Gaps = 12/226 (5%)

Query: 4   ISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKI 63
           I+VH+KSGQN W V I+ ++TI  FK  I+  S +  +NQRLIYSGKILKD +TVESYKI
Sbjct: 3   ITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESYKI 62

Query: 64  QDGHSVHMVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX----------XXGQTGGFN 113
            D HSVH+VK                                           GQ  GFN
Sbjct: 63  LDDHSVHLVKSGGSKKATSPGATAAASGDATATGATSTPAAQPQQSAPANLSTGQGNGFN 122

Query: 114 PLADLTGARYAGLANLPSADMFGPDGGLNSSNGANPESMLQMLENPIFQSQMNEMLSNPQ 173
           PL+DLT ARYAG  NLPSAD FGPDGG+ S+   N + +L+MLENP+ QSQMNEMLSNPQ
Sbjct: 123 PLSDLTSARYAGFLNLPSADSFGPDGGMTSA--PNSDDVLRMLENPVMQSQMNEMLSNPQ 180

Query: 174 MVDFLIQQNPQLQALGPRARDMLQSPFFRQMMTDPQMIRQSMQMAN 219
           M+DFLIQQ+PQLQ++GP+AR +LQSPFFRQMMT+P MIRQSMQ ++
Sbjct: 181 MIDFLIQQSPQLQSMGPQARTLLQSPFFRQMMTNPDMIRQSMQFSS 226

 Score =  104 bits (259), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 53/75 (70%), Positives = 60/75 (80%), Gaps = 2/75 (2%)

Query: 297 PQFNQELLASMFGGNSNATGAAPAVDNRPPEERYESQLRQLNDMGFFDFDRNVAALRRAG 356
           P  +  +L+S+ GG + A    P  D RPPEERYE QLRQLNDMGFF+FDRNVAALRR+G
Sbjct: 304 PALDPMVLSSILGG-AGAANQQPQ-DTRPPEERYEHQLRQLNDMGFFEFDRNVAALRRSG 361

Query: 357 GSVQGALDALLNGDV 371
           GSVQGALDALLNGDV
Sbjct: 362 GSVQGALDALLNGDV 376

>KNAG0J00290 Chr10 complement(44234..45337) [1104 bp, 367 aa] {ON}
           Anc_8.837 YMR276W
          Length = 367

 Score =  226 bits (577), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 129/228 (56%), Positives = 149/228 (65%), Gaps = 10/228 (4%)

Query: 4   ISVHVKSGQNNWTVEIESA---ATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVES 60
           I+V VK GQN W V + S     T+  FKE ++GV+GVP +NQRLIYSGKILKD +T+E 
Sbjct: 3   ITVGVKQGQNRWDVAVASEPGETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEE 62

Query: 61  YKIQDGHSVHMVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--GQTGGFNPLADL 118
           YKI DGH+VH+VK                                   GQ  GFNPLADL
Sbjct: 63  YKITDGHTVHLVKSGGAKSAGSSSSSSEATTAAGTAGTAPAAGASMAAGQQPGFNPLADL 122

Query: 119 TGARYAGL-ANLPSADMFGPDGGLNSSNGANP----ESMLQMLENPIFQSQMNEMLSNPQ 173
           T ARYAG    +PSADMFGPDGGL S  G       E +L MLENPIFQSQMNEM SNPQ
Sbjct: 123 TSARYAGYNLPMPSADMFGPDGGLTSGGGPGGPQSQEEILSMLENPIFQSQMNEMFSNPQ 182

Query: 174 MVDFLIQQNPQLQALGPRARDMLQSPFFRQMMTDPQMIRQSMQMANSM 221
           MVDFLIQ NPQLQA+GP+AR+MLQSP FRQM+T+P M+RQSMQ +  M
Sbjct: 183 MVDFLIQSNPQLQAMGPQAREMLQSPMFRQMLTNPDMVRQSMQFSQMM 230

 Score =  100 bits (249), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 51/69 (73%), Positives = 55/69 (79%), Gaps = 1/69 (1%)

Query: 303 LLASMFGGNSNATGAAPAVDNRPPEERYESQLRQLNDMGFFDFDRNVAALRRAGGSVQGA 362
            + +M    + A  AAP  D RPPEERYE QLRQLNDMGF DFDRNVAALRRAGGS+QGA
Sbjct: 300 FMQAMSRNGATAPAAAPQ-DTRPPEERYEQQLRQLNDMGFSDFDRNVAALRRAGGSLQGA 358

Query: 363 LDALLNGDV 371
           LDALLNGDV
Sbjct: 359 LDALLNGDV 367

>TBLA0B03240 Chr2 (756434..757288) [855 bp, 284 aa] {ON} Anc_8.837
           YMR276W
          Length = 284

 Score = 64.7 bits (156), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 59/220 (26%), Positives = 94/220 (42%), Gaps = 20/220 (9%)

Query: 4   ISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKI 63
           ISV++K  +  +T+E E    I      I     +P +NQRLIYSG+IL   +T++ Y  
Sbjct: 2   ISVNIKFKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNF 61

Query: 64  QDGHSVHMVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGQTGGFNPLADLTGARY 123
           +DGH + ++                                    T    P         
Sbjct: 62  KDGHCIIVIIHKEEKNNLHPPPNNTTNLNPNNSVYPASNTPINSPT----PF-------- 109

Query: 124 AGLANLPSADMFGPDG-GLNSSNGANPE---SMLQMLENPIFQSQMNEMLSNPQ-MVDFL 178
            G  N+ +     PD  G+ S+   +PE    +LQ+L++P    Q NEML N Q ++ FL
Sbjct: 110 -GEGNIITITTTSPDPYGVRSNEVHDPEVERELLQVLDHP-RSFQENEMLLNNQNLLRFL 167

Query: 179 IQQNPQLQALGPR-ARDMLQSPFFRQMMTDPQMIRQSMQM 217
           IQ NP L+ +    AR +L+ P  ++   D   + Q + +
Sbjct: 168 IQTNPHLRHMDINGARQVLRDPRLQRAFMDVNFLNQQISL 207

>TDEL0G01750 Chr7 (343412..343645) [234 bp, 77 aa] {ON} Anc_4.16
          YLL039C
          Length = 77

 Score = 54.3 bits (129), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>Kwal_YGOB_Anc_5.701 s55 (88799..88806,89169..89547) [387 bp, 128
          aa] {ON} ANNOTATED BY YGOB -
          Length = 128

 Score = 55.5 bits (132), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>KLTH0E01078g Chr5 (105372..105379,105743..106121) [387 bp, 128
          aa] {ON} highly similar to uniprot|P61864 Saccharomyces
          cerevisiae YKR094c RPL40B and highly similar to
          uniprot|P61864 Saccharomyces cerevisiae YIL148w RPL40A
          Length = 128

 Score = 55.5 bits (132), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>ZYRO0G06622g Chr7 (527968..527975,528043..528421) [387 bp, 128
          aa] {ON} highly similar to uniprot|P14796 Saccharomyces
          cerevisiae YKR094C RPL40B
          Length = 128

 Score = 55.5 bits (132), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>KAFR0D02230 Chr4 (449707..449714,450088..450466) [387 bp, 128 aa]
          {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 55.5 bits (132), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>KAFR0H00220 Chr8 (32171..32178,32513..32891) [387 bp, 128 aa]
          {ON} 
          Length = 128

 Score = 55.5 bits (132), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>Suva_11.330 Chr11 complement(602690..603068,603446..603453) [387
          bp, 128 aa] {ON} YKR094C (REAL)
          Length = 128

 Score = 55.5 bits (132), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>Skud_11.333 Chr11 complement(599496..599874,600245..600252) [387
          bp, 128 aa] {ON} YKR094C (REAL)
          Length = 128

 Score = 55.5 bits (132), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>YIL148W Chr9 (68708..68715,69150..69528) [387 bp, 128 aa] {ON}
          RPL40AFusion protein, identical to Rpl40Bp, that is
          cleaved to yield ubiquitin and a ribosomal protein of
          the large (60S) ribosomal subunit with similarity to
          rat L40; ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes
          Length = 128

 Score = 55.5 bits (132), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>YKR094C Chr11 complement(617996..618374,618743..618750) [387 bp,
          128 aa] {ON}  RPL40BFusion protein, identical to
          Rpl40Ap, that is cleaved to yield ubiquitin and a
          ribosomal protein of the large (60S) ribosomal subunit
          with similarity to rat L40; ubiquitin may facilitate
          assembly of the ribosomal protein into ribosomes
          Length = 128

 Score = 55.5 bits (132), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>SAKL0E14894g Chr5 complement(1235488..1235866,1236205..1236212)
          [387 bp, 128 aa] {ON} highly similar to uniprot|P61864
          Saccharomyces cerevisiae YLR167W RPS31 and highly
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YIL148W and highly similar to uniprot|P04838
          Saccharomyces cerevisiae YKR094C and highly similar to
          uniprot|P04838 Saccharomyces cerevisiae YLL039C Fusion
          proteins that are cleaved to yield a ribosomal protein
          of the small (40S) subunit and ubiquitin
          Length = 128

 Score = 55.1 bits (131), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>Kpol_1043.69 s1043 complement(145335..145721) [387 bp, 128 aa]
          {ON} complement(145335..145721) [387 nt, 129 aa]
          Length = 128

 Score = 55.1 bits (131), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>KLLA0A00616g Chr1 (59180..59187,59727..60105) [387 bp, 128 aa]
          {ON} highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YKR094C RPL40B Fusion protein, identical to
          Rpl40Ap, that is cleaved to yield ubiquitin and a
          ribosomal protein of the large (60S) ribosomal subunit
          with similarity to rat L40; ubiquitin may facilitate
          assembly of the ribosomal protein into ribosomes
          Length = 128

 Score = 55.1 bits (131), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>TPHA0E00240 Chr5 (33468..33475,34104..34482) [387 bp, 128 aa]
          {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 55.1 bits (131), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>TPHA0D04600 Chr4 complement(1005511..1005889,1006076..1006083)
          [387 bp, 128 aa] {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 55.1 bits (131), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>TBLA0E02110 Chr5 complement(516651..517029,517297..517304) [387
          bp, 128 aa] {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 55.1 bits (131), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>CAGL0G02475g Chr7 complement(220990..221368,222103..222110) [387
          bp, 128 aa] {ON} highly similar to uniprot|P04838
          Saccharomyces cerevisiae YKR094c UBI2 ubiquitin and
          highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YIL148w UBI1 ubiquitin
          Length = 128

 Score = 55.1 bits (131), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>NDAI0H00270 Chr8 complement(45883..46116) [234 bp, 77 aa] {ON}
          Anc_4.16
          Length = 77

 Score = 53.5 bits (127), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>NDAI0E05030 Chr5 complement(1148916..1149294,1149627..1149634)
          [387 bp, 128 aa] {ON} Anc_5.701
          Length = 128

 Score = 55.1 bits (131), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>NCAS0A03210 Chr1 (633779..633786,634077..634455) [387 bp, 128 aa]
          {ON} Anc_5.701
          Length = 128

 Score = 55.1 bits (131), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>NCAS0G00240 Chr7 (39394..39401,39701..40079) [387 bp, 128 aa]
          {ON} Anc_5.701
          Length = 128

 Score = 55.1 bits (131), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>Ecym_4019 Chr4 (48709..48716,49112..49490) [387 bp, 128 aa] {ON}
          similar to Ashbya gossypii AFR285C 1-intron
          Length = 128

 Score = 55.1 bits (131), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>TDEL0B02200 Chr2 (395520..395527,395598..395976) [387 bp, 128 aa]
          {ON} 
          Length = 128

 Score = 55.1 bits (131), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>AFR285C Chr6 complement(950588..950966,951128..951135) [387 bp,
          128 aa] {ON} Syntenic homolog of Saccharomyces
          cerevisiae YKR094C (RPL40B) and YIL148W (RPL40A);
          1-intron
          Length = 128

 Score = 55.1 bits (131), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>KNAG0L02120 Chr12 complement(379968..380346,380662..380669) [387
          bp, 128 aa] {ON} 
          Length = 128

 Score = 55.1 bits (131), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>KNAG0J02880 Chr10 (550889..551350) [462 bp, 153 aa] {ON} Anc_4.16
          YLL039C
          Length = 153

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 78  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 137 IQKESTLHLV 146

>TPHA0K02250 Chr11 (482029..482490) [462 bp, 153 aa] {ON} Anc_4.16
          YLL039C
          Length = 153

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 78  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 137 IQKESTLHLV 146

>Ecym_8408 Chr8 (845058..845519) [462 bp, 153 aa] {ON} similar to
          Ashbya gossypii ACL062C
          Length = 153

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 78  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 137 IQKESTLHLV 146

>Skud_9.20 Chr9 (46249..46623) [375 bp, 125 aa] {ON} YKR094C
          (REAL)
          Length = 125

 Score = 53.5 bits (127), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 36/57 (63%)

Query: 16 TVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKIQDGHSVHMV 72
          T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y IQ   ++H+V
Sbjct: 11 TLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 67

>Smik_11.357 Chr11 complement(608082..608456) [375 bp, 125 aa]
          {ON} YKR094C (REAL)
          Length = 125

 Score = 53.5 bits (127), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 36/57 (63%)

Query: 16 TVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKIQDGHSVHMV 72
          T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y IQ   ++H+V
Sbjct: 11 TLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 67

>Smik_9.21 Chr9 (46848..47219) [372 bp, 124 aa] {ON} YKR094C
          (REAL)
          Length = 124

 Score = 53.5 bits (127), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 36/57 (63%)

Query: 16 TVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKIQDGHSVHMV 72
          T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y IQ   ++H+V
Sbjct: 10 TLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 66

>Suva_10.34 Chr10 complement(69167..69622) [456 bp, 151 aa] {ON}
          YALI0E18986g (REAL)
          Length = 151

 Score = 53.9 bits (128), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

 Score = 53.9 bits (128), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 78  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 137 IQKESTLHLV 146

>KNAG0C06580 Chr3 complement(1275504..1275945,1276297..1276304)
          [450 bp, 149 aa] {ON} 
          Length = 149

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>Ecym_4181 Chr4 complement(379972..380430) [459 bp, 152 aa] {ON}
          similar to Ashbya gossypii AGL128W
          Length = 152

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>ZYRO0C04026g Chr3 (318229..318687) [459 bp, 152 aa] {ON} similar
          to uniprot|P05759 Saccharomyces cerevisiae YLR167W
          RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes interacts genetically
          with translation factor eIF2B
          Length = 152

 Score = 53.5 bits (127), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>KLTH0F08734g Chr6 complement(754886..755338) [453 bp, 150 aa]
          {ON} similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167W RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 150

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>SAKL0H13926g Chr8 complement(1189515..1189979) [465 bp, 154 aa]
          {ON} similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167W RPS31 and similar to uniprot|P04838
          Saccharomyces cerevisiae YIL148W and similar to
          uniprot|P04838 Saccharomyces cerevisiae YKR094C and
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLL039C Fusion proteins that are cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 154

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>TPHA0C02390 Chr3 complement(536137..536589) [453 bp, 150 aa] {ON}
          Anc_8.386 YLR167W
          Length = 150

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>AGL128W Chr7 (470174..470632) [459 bp, 152 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YLR167W (RPS31)
          Length = 152

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>Kwal_23.3311 s23 complement(238458..238910) [453 bp, 150 aa] {ON}
          YLR167W (RPS31) - Ribosomal protein S31 (S37) (YS24)
          [contig 251] FULL
          Length = 150

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>KLLA0D18304g Chr4 (1545371..1545823) [453 bp, 150 aa] {ON}
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLR167W RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin; ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes; interacts genetically
          with translation factor eIF2B
          Length = 150

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>Suva_9.40 Chr9 (63806..64240) [435 bp, 144 aa] {ON} YIL148W
          (REAL)
          Length = 144

 Score = 53.1 bits (126), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 36/57 (63%)

Query: 16 TVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKIQDGHSVHMV 72
          T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y IQ   ++H+V
Sbjct: 30 TLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 86

>TBLA0G00670 Chr7 (142636..143325) [690 bp, 229 aa] {ON} Anc_4.16
          YLL039C
          Length = 229

 Score = 54.7 bits (130), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

 Score = 54.7 bits (130), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 78  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 137 IQKESTLHLV 146

 Score = 54.7 bits (130), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 154 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 213 IQKESTLHLV 222

>NDAI0D04930 Chr4 (1172741..1173430) [690 bp, 229 aa] {ON} 
          Length = 229

 Score = 54.7 bits (130), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

 Score = 54.7 bits (130), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 78  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 137 IQKESTLHLV 146

 Score = 54.7 bits (130), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 154 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 213 IQKESTLHLV 222

>KAFR0I01470 Chr9 (306964..307653) [690 bp, 229 aa] {ON} Anc_5.701
          YIL148W
          Length = 229

 Score = 54.7 bits (130), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

 Score = 54.7 bits (130), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 78  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 137 IQKESTLHLV 146

 Score = 54.7 bits (130), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 154 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 213 IQKESTLHLV 222

>Kwal_55.20607 s55 complement(488683..489378) [696 bp, 231 aa]
          {ON} YLL039C (UBI4) - 1:1 [contig 144] FULL
          Length = 231

 Score = 54.7 bits (130), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

 Score = 54.7 bits (130), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 78  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 137 IQKESTLHLV 146

 Score = 54.7 bits (130), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 154 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 213 IQKESTLHLV 222

>YLR167W Chr12 (498947..499405) [459 bp, 152 aa] {ON}  RPS31Fusion
          protein that is cleaved to yield a ribosomal protein of
          the small (40S) subunit and ubiquitin; ubiquitin may
          facilitate assembly of the ribosomal protein into
          ribosomes; interacts genetically with translation
          factor eIF2B
          Length = 152

 Score = 53.1 bits (126), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>KAFR0H02000 Chr8 complement(369778..370236) [459 bp, 152 aa] {ON}
          Anc_8.386 YLR167W
          Length = 152

 Score = 53.1 bits (126), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>NCAS0C02940 Chr3 complement(552015..552473) [459 bp, 152 aa] {ON}
          Anc_8.386
          Length = 152

 Score = 53.1 bits (126), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>NDAI0G02280 Chr7 complement(511522..511980) [459 bp, 152 aa] {ON}
          Anc_8.386
          Length = 152

 Score = 53.1 bits (126), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>KNAG0A02730 Chr1 complement(296966..297418) [453 bp, 150 aa] {ON}
          Anc_8.386 YLR167W
          Length = 150

 Score = 53.1 bits (126), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>TDEL0F05100 Chr6 (959574..960026) [453 bp, 150 aa] {ON} Anc_8.386
          YLR167W
          Length = 150

 Score = 52.8 bits (125), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>Suva_10.33 Chr10 complement(68388..69152) [765 bp, 254 aa] {ON}
          YLL039C (REAL)
          Length = 254

 Score = 54.7 bits (130), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

 Score = 54.7 bits (130), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 78  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 137 IQKESTLHLV 146

 Score = 54.7 bits (130), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 154 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 213 IQKESTLHLV 222

>Kpol_1030.5 s1030 complement(10263..10721) [459 bp, 152 aa] {ON}
          complement(10263..10721) [459 nt, 153 aa]
          Length = 152

 Score = 52.8 bits (125), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>Kpol_1024.16 s1024 complement(58683..59141) [459 bp, 152 aa] {ON}
          complement(58683..59141) [459 nt, 153 aa]
          Length = 152

 Score = 52.8 bits (125), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>CAGL0G08173g Chr7 (776549..777007) [459 bp, 152 aa] {ON} highly
          similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167w UBI3 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 152

 Score = 52.8 bits (125), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>SAKL0H25784g Chr8 (2259314..2260231) [918 bp, 305 aa] {ON} highly
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLL039c UBI4 ubiquitin
          Length = 305

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 78  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 137 IQKESTLHLV 146

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 154 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 213 IQKESTLHLV 222

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 230 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 289 IQKESTLHLV 298

>Suva_10.266 Chr10 (471118..471576) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>Skud_12.234 Chr12 (445677..446135) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>Smik_12.229 Chr12 (446071..446529) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>KLTH0E05852g Chr5 complement(528861..530090) [1230 bp, 409 aa] {ON}
           highly similar to uniprot|P04838 Saccharomyces
           cerevisiae YLL039c UBI4 ubiquitin
          Length = 409

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 106 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 164

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 165 IQKESTLHLV 174

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 182 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 240

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 241 IQKESTLHLV 250

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 258 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 316

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 317 IQKESTLHLV 326

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 334 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 392

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 393 IQKESTLHLV 402

>Suva_10.30 Chr10
          complement(67747..67841,68061..68288,68558..69013,
          69256..69622) [1146 bp, 381 aa] {ON} YLL039C (REAL)
          Length = 381

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 78  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 137 IQKESTLHLV 146

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 154 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 213 IQKESTLHLV 222

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 230 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 289 IQKESTLHLV 298

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 41/70 (58%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++ K L+D  T+  Y 
Sbjct: 306 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAEKQLEDGRTLSDYN 364

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 365 IQKESTLHLV 374

>Skud_12.29 Chr12 complement(55051..55829,56058..56424) [1146 bp,
          381 aa] {ON} YLL039C (REAL)
          Length = 381

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 78  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 137 IQKESTLHLV 146

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 154 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 213 IQKESTLHLV 222

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 230 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 289 IQKESTLHLV 298

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 306 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 364

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 365 IQKESTLHLV 374

>YLL039C Chr12 complement(64062..65207) [1146 bp, 381 aa] {ON}
          UBI4Ubiquitin, becomes conjugated to proteins, marking
          them for selective degradation via the ubiquitin-26S
          proteasome system; essential for the cellular stress
          response; encoded as a polyubiquitin precursor
          comprised of 5 head-to-tail repeats
          Length = 381

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 78  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 137 IQKESTLHLV 146

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 154 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 213 IQKESTLHLV 222

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 230 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 289 IQKESTLHLV 298

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 306 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 364

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 365 IQKESTLHLV 374

>ACL062C Chr3 complement(255353..256501) [1149 bp, 382 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YLL039C
          (UBI4)
          Length = 382

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 78  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 137 IQKESTLHLV 146

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 154 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 213 IQKESTLHLV 222

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 230 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 289 IQKESTLHLV 298

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 306 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 364

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 365 IQKESTLHLV 374

>TBLA0H03180 Chr8 (775282..775740) [459 bp, 152 aa] {ON} Anc_8.386
          YLR167W
          Length = 152

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

>KLLA0E00749g Chr5 complement(74948..76093) [1146 bp, 381 aa] {ON}
          highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YLL039c UBI4 ubiquitin
          Length = 381

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 78  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 137 IQKESTLHLV 146

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 154 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 213 IQKESTLHLV 222

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 230 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 289 IQKESTLHLV 298

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 306 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 364

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 365 IQKESTLHLV 374

>ZYRO0G07854g Chr7 complement(634289..635671) [1383 bp, 460 aa]
          {ON} highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YLL039c UBI4 ubiquitin
          Length = 460

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 78  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 137 IQKESTLHLV 146

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 154 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 213 IQKESTLHLV 222

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 230 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 289 IQKESTLHLV 298

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 306 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 364

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 365 IQKESTLHLV 374

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 382 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 440

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 441 IQKESTLHLV 450

>NCAS0C05850 Chr3 (1203331..1204497) [1167 bp, 388 aa] {ON} 
          Length = 388

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 78  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 137 IQKESTLHLV 146

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 154 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 213 IQKESTLHLV 222

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 230 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 289 IQKESTLHLV 298

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 306 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 364

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 365 IQKESTLHLV 374

>NDAI0F00300 Chr6 (66116..66679) [564 bp, 187 aa] {ON} Anc_5.701
          Length = 187

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 44/76 (57%), Gaps = 8/76 (10%)

Query: 4   ISVHVK-------SGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTE 56
           + +H+K       +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  
Sbjct: 55  LHIHIKYSFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGR 113

Query: 57  TVESYKIQDGHSVHMV 72
           T+  Y IQ   ++H+V
Sbjct: 114 TLSDYNIQKESTLHLV 129

>Smik_12.18 Chr12
          complement(49088..49552,49091..49552,49091..49546)
          [1383 bp, 460 aa] {ON} YLL039C (REAL)
          Length = 460

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 78  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 137 IQKESTLHLV 146

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 156 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 214

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 215 IQKESTLHLV 224

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 232 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 290

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 291 IQKESTLHLV 300

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 310 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 368

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 369 IQKESTLHLV 378

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 386 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 444

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 445 IQKESTLHLV 454

>Kpol_1070.6 s1070 complement(16980..18581) [1602 bp, 533 aa] {ON}
          complement(16980..18581) [1602 nt, 534 aa]
          Length = 533

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 78  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 137 IQKESTLHLV 146

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 154 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 213 IQKESTLHLV 222

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 230 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 289 IQKESTLHLV 298

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 306 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 364

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 365 IQKESTLHLV 374

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 382 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 440

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 441 IQKESTLHLV 450

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 458 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 516

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 517 IQKESTLHLV 526

>CAGL0D05082g Chr4 (488733..490334) [1602 bp, 533 aa] {ON} similar
          to uniprot|P04838 Saccharomyces cerevisiae YLL039c UBI4
          ubiquitin
          Length = 533

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 63 IQDGHSVHMV 72
          IQ   ++H+V
Sbjct: 61 IQKESTLHLV 70

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 78  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 137 IQKESTLHLV 146

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 154 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 213 IQKESTLHLV 222

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 230 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 289 IQKESTLHLV 298

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 306 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 364

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 365 IQKESTLHLV 374

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 382 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 440

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 441 IQKESTLHLV 450

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 458 QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 516

Query: 63  IQDGHSVHMV 72
           IQ   ++H+V
Sbjct: 517 IQKESTLHLV 526

>Kpol_1036.62 s1036 complement(173662..173746,173844..173992) [234
          bp, 77 aa] {ON}
          complement(173662..173746,173844..173992) [234 nt, 78
          aa]
          Length = 77

 Score = 49.7 bits (117), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 35/57 (61%)

Query: 16 TVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKIQDGHSVHMV 72
          +VEI+ +  +   KE +    G+P   QRLI+ GK + D +TV+S K+ DG  +H+V
Sbjct: 14 SVEIQGSDKVYHIKELLEEKEGIPPSQQRLIFQGKQIDDEQTVDSAKLTDGMQLHLV 70

>Suva_10.32 Chr10 complement(68200..68385) [186 bp, 62 aa] {ON}
          YLL039C (REAL)
          Length = 62

 Score = 48.5 bits (114), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 34/56 (60%)

Query: 17 VEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKIQDGHSVHMV 72
          +E+E + TI   K  I    G+P D QRLI++GK L+D  T+  Y IQ   ++H+V
Sbjct: 1  LEVEYSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 56

>TDEL0F04380 Chr6 complement(823866..823950,824011..824159) [234
          bp, 77 aa] {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 47.8 bits (112), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 35/56 (62%)

Query: 17 VEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKIQDGHSVHMV 72
          VE++S A I   K+ +    G+P   QRLI+ GK + D +T+E+ K+ DG  +H+V
Sbjct: 15 VELKSDAPIYRIKQLLEEKEGIPPSQQRLIFQGKQIDDRQTLEAAKLVDGMVLHLV 70

>KLLA0F17974g Chr6 (1644903..1645051,1645153..1645237) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 47.0 bits (110), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 23/70 (32%), Positives = 41/70 (58%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          Q+ V   +G+   +V+++S+ T+   KE +    G+P   Q+LI+ GK + D  T+ S  
Sbjct: 2  QLKVKTLTGKE-ISVDVQSSETVYHIKELLEEKEGIPPSQQKLIFQGKQIDDNATIGSAD 60

Query: 63 IQDGHSVHMV 72
          +QDG  +H+V
Sbjct: 61 LQDGSLLHLV 70

>ZYRO0D05962g Chr4 (506710..506858,506936..507020) [234 bp, 77 aa]
          {ON} similar to uniprot|Q03919 Saccharomyces cerevisiae
          YDR139C RUB1 Ubiquitin-like protein with similarity to
          mammalian NEDD8
          Length = 77

 Score = 44.3 bits (103), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 31/56 (55%)

Query: 17 VEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKIQDGHSVHMV 72
          VE+     I   KE +    G+P   QRLI+ GK + D +TV S K+ DG  +H+V
Sbjct: 15 VELNGEDPIYRIKELLEEKEGIPPSQQRLIFQGKQIDDQQTVSSAKLVDGMQLHLV 70

>CAGL0B01589g Chr2 (145132..145280,145404..145488) [234 bp, 77 aa]
          {ON} highly similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139c RUB1
          Length = 77

 Score = 44.3 bits (103), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 32/56 (57%)

Query: 17 VEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKIQDGHSVHMV 72
          VE+     +   KE +    G+PA  QRLI+ GK + + +T+ + K+ DG  +H+V
Sbjct: 15 VEVSGEDKVYHIKELLEEKEGIPASQQRLIFHGKQINNDDTISTAKLSDGMQLHLV 70

>TPHA0C00890 Chr3 (187882..188030,188103..188187) [234 bp, 77 aa]
          {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 44.3 bits (103), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 23/70 (32%), Positives = 39/70 (55%), Gaps = 1/70 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          QI V   +G+    +E++ +  +   K+ +    G+P   QRLI+ GK + D +TVES  
Sbjct: 2  QIKVKTLTGKE-IAIEVQGSDKVFHIKDLLEEKEGIPPSQQRLIFQGKQIDDEQTVESAN 60

Query: 63 IQDGHSVHMV 72
          + DG  +H+V
Sbjct: 61 LIDGMQLHLV 70

>SAKL0H15818g Chr8 (1379077..1379225,1379297..1379381) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 43.1 bits (100), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 32/56 (57%)

Query: 17 VEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKIQDGHSVHMV 72
          + +ES   +   KE +    G+P   QRLI+ GK ++D +TV+S  +  G  +H+V
Sbjct: 15 ISLESHEKVYRIKELLEEKEGIPPSQQRLIFQGKQIEDDQTVDSANLSSGMQLHLV 70

>KAFR0E00530 Chr5 complement(113019..114158) [1140 bp, 379 aa]
          {ON} Anc_1.480 YEL037C
          Length = 379

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 35/56 (62%)

Query: 17 VEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKIQDGHSVHMV 72
          VE+ES++TI   K  ++ +     D  +LI+SGK+LKD +TV S  ++D   V M+
Sbjct: 15 VELESSSTILDAKNKLASIKSCDIDQIKLIFSGKVLKDDQTVSSCGLKDNDQVIMM 70

>NCAS0B03520 Chr2 complement(621285..621369,621473..621621) [234
          bp, 77 aa] {ON}
          Length = 77

 Score = 42.4 bits (98), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 31/56 (55%)

Query: 17 VEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKIQDGHSVHMV 72
          V+I+    +   KE +    G+P   QRLI+ GK + D +TV S  + DG  +H+V
Sbjct: 15 VDIQGTDPVYRIKEMLEEKEGIPPSQQRLIFQGKQIDDEQTVSSANLIDGMQLHLV 70

>CAGL0L01309g Chr12 complement(148931..150109) [1179 bp, 392 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037c RAD23 nucleotide excision repair protein
          Length = 392

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 41/67 (61%), Gaps = 1/67 (1%)

Query: 4  ISVHVKS-GQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          +SV  K+  +  + +++ES+ +I A KE +S          +LI+SGK+LKD ++VES  
Sbjct: 2  VSVTFKNFKKEKYPLDLESSQSIVAVKEALSEKLSCDPSQIKLIFSGKVLKDGDSVESCN 61

Query: 63 IQDGHSV 69
           +DG+ V
Sbjct: 62 FKDGNEV 68

>NDAI0J01070 Chr10 (247102..247250,247366..247450) [234 bp, 77 aa]
          {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 42.0 bits (97), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 30/56 (53%)

Query: 17 VEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKIQDGHSVHMV 72
          VEI     +   KE +    G+P   QRLI+ GK + D ++V S  + DG  +H+V
Sbjct: 15 VEISGNEPVYRIKELLEEKEGIPPSQQRLIFQGKQIDDEQSVSSANLVDGMQLHLV 70

>YDR139C Chr4 complement(733618..733702,733776..733924) [234 bp,
          77 aa] {ON}  RUB1Ubiquitin-like protein with similarity
          to mammalian NEDD8; conjugation (neddylation)
          substrates include the cullins Cdc53p, Rtt101p, and
          Cul3p; activated by Ula1p and Uba3p (E1 enzyme pair);
          conjugation mediated by Ubc12p (E2 enzyme)
          Length = 77

 Score = 39.7 bits (91), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 31/57 (54%)

Query: 16 TVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKIQDGHSVHMV 72
          +VE++ +  +   KE +    G+P   QRLI+ GK + D  TV    + +G  +H+V
Sbjct: 14 SVELKESDLVYHIKELLEEKEGIPPSQQRLIFQGKQIDDKLTVTDAHLVEGMQLHLV 70

>KLTH0C03410g Chr3 complement(295299..296474) [1176 bp, 391 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037C RAD23
          Length = 391

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 31/55 (56%)

Query: 15 WTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKIQDGHSV 69
            +E++S +TI   K+ ++          +LIYSGKIL+D  T+  YK+ DG  V
Sbjct: 14 LALELDSGSTISEAKQRLAENKDCDESQIKLIYSGKILQDDRTIADYKLNDGDQV 68

>Suva_10.31 Chr10 complement(68008..68199) [192 bp, 64 aa] {ON}
          YLR167W (REAL)
          Length = 64

 Score = 38.9 bits (89), Expect = 0.001,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVES 60
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L   E  ++
Sbjct: 2  QIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLGMEELCQT 58

>KAFR0C03000 Chr3 (597127..598320) [1194 bp, 397 aa] {ON} Anc_8.142
           YGL181W
          Length = 397

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 32/44 (72%), Gaps = 4/44 (9%)

Query: 327 EERYES----QLRQLNDMGFFDFDRNVAALRRAGGSVQGALDAL 366
           ++RYES    Q+RQL +MGF D ++N+ AL+++ G++  A+D L
Sbjct: 183 DDRYESDYRRQVRQLKEMGFSDSEKNLKALKKSNGNMNRAIDVL 226

>Kwal_27.10152 s27 complement(216695..217840) [1146 bp, 381 aa]
          {ON} YEL037C (RAD23) - ubiquitin-like protein [contig
          41] FULL
          Length = 381

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 32/55 (58%)

Query: 15 WTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKIQDGHSV 69
            +E+E ++T+   K+ ++          +LIYSGKIL+D  T+  YK++DG  V
Sbjct: 14 LALELELSSTVNEAKQKLAENKECDDSQIKLIYSGKILQDDRTIGDYKLKDGDQV 68

>SAKL0D11814g Chr4 (981832..983034) [1203 bp, 400 aa] {ON} similar
          to uniprot|P32628 Saccharomyces cerevisiae YEL037C
          RAD23
          Length = 400

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 39/67 (58%), Gaps = 1/67 (1%)

Query: 4  ISVHVKS-GQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          I+++ K   +    +E++  +T+   K+ ++       D  +LI+SGK+L+D +T+E  K
Sbjct: 2  ITINFKDFKKEKLPLELDPTSTVLQAKQQLASTKSCDEDQIKLIFSGKVLQDGKTLEECK 61

Query: 63 IQDGHSV 69
          ++DG  V
Sbjct: 62 LKDGDQV 68

>NDAI0B01850 Chr2 complement(440321..441532) [1212 bp, 403 aa] {ON} 
          Length = 403

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 27/44 (61%), Gaps = 2/44 (4%)

Query: 329 RYESQLRQLNDMGFFDFDRNVAALRRAGGSVQGALDALL--NGD 370
           +Y  +LR+L +MGF D D N  AL  A G + GA+D L   NGD
Sbjct: 166 KYSRELRRLQNMGFRDIDINTEALVLARGDLNGAIDILTQDNGD 209

>TDEL0B04690 Chr2 (832571..833899) [1329 bp, 442 aa] {ON} Anc_8.142
           YGL181W
          Length = 442

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 314 ATGAAPAVDNRPPEE----RYESQLRQLNDMGFFDFDRNVAALRRAGGSVQGALDAL 366
           ++G  P++ NR   +    RY  +LR L +MG+ D D N  AL  A G +  A+D L
Sbjct: 174 SSGDVPSLGNRQARDYELSRYSRELRTLKEMGYDDIDHNAEALSHAHGDLNRAIDIL 230

>SAKL0H24772g Chr8 complement(2155837..2157081) [1245 bp, 414 aa]
           {ON} weakly similar to uniprot|P40956 Saccharomyces
           cerevisiae YGL181W GTS1 Contains a zinc-finger in the N-
           terminus and a long Gln-rich region in the C-terminus
           regulates ultradian rhythm cell size cell cycle lifespan
           sporulation heat tolerance and multidrug transport
          Length = 414

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 34/61 (55%), Gaps = 5/61 (8%)

Query: 315 TGAAPAVDNRPPEE----RYESQLRQLNDMGFFDFDRNVAALRRAGGSVQGALDALLNGD 370
           +G  P + +R  E+    R+  QLR L ++G+ D D NV AL  A G +  ALD +L  D
Sbjct: 166 SGKVPQLTHRTVEDYEIGRHSHQLRNLKELGYLDTDSNVEALVLARGDINLALD-ILEAD 224

Query: 371 V 371
           V
Sbjct: 225 V 225

>KLTH0G12540g Chr7 (1065801..1065949,1066013..1066097) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 36.6 bits (83), Expect = 0.009,   Method: Composition-based stats.
 Identities = 16/44 (36%), Positives = 25/44 (56%)

Query: 29 KETISGVSGVPADNQRLIYSGKILKDTETVESYKIQDGHSVHMV 72
          KE +    G+P   QRLI+ GK + D ++V S  +  G  +H+V
Sbjct: 27 KEYLEEKEGIPPTQQRLIFQGKQIDDDKSVSSANLSSGMQLHLV 70

>NCAS0B04590 Chr2 complement(835478..836821) [1344 bp, 447 aa] {ON}
           Anc_8.142 YGL181W
          Length = 447

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 24/42 (57%)

Query: 329 RYESQLRQLNDMGFFDFDRNVAALRRAGGSVQGALDALLNGD 370
           +Y  QLR L DMGF D D NV AL    G++   ++ L + +
Sbjct: 155 KYSRQLRSLKDMGFNDVDNNVEALNICNGNINKTINILTSNE 196

>KLLA0E22133g Chr5 complement(1974635..1975786) [1152 bp, 383 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037C RAD23
          Length = 383

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%)

Query: 17 VEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKIQDGHSV 69
          +E+   ATI   KE I+      A   +LIY+GKIL+D +TV    +++G  V
Sbjct: 15 IELADDATISHAKELIAEQKQCDASQIKLIYAGKILQDPKTVSGCNLKEGDQV 67

>AFR358W Chr6 (1087725..1088966) [1242 bp, 413 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YEL037C (RAD23)
          Length = 413

 Score = 38.5 bits (88), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 4  ISVHVKS-GQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62
          I++H K   +    +++  +ATI   K+ ++          ++I+SGK+L+D  T+E  K
Sbjct: 3  ITIHFKDFKKERLPLQLSPSATIAEAKQMLARAKQCDESQLKMIFSGKVLQDGNTLEGCK 62

Query: 63 IQDGHSV 69
          ++DG  V
Sbjct: 63 LKDGDQV 69

>TBLA0D02210 Chr4 (555236..556927) [1692 bp, 563 aa] {ON} Anc_8.142
           YGL181W
          Length = 563

 Score = 38.5 bits (88), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 24/38 (63%)

Query: 329 RYESQLRQLNDMGFFDFDRNVAALRRAGGSVQGALDAL 366
           +Y  QL++LNDMGF + D N  AL  + G +  ALD L
Sbjct: 219 KYSRQLKELNDMGFTNTDNNAEALSISRGDINRALDLL 256

>Smik_7.91 Chr7 (152642..153637,153905..154108) [1200 bp, 399 aa]
           {ON} YGL181W (REAL)
          Length = 399

 Score = 37.7 bits (86), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 25/38 (65%)

Query: 329 RYESQLRQLNDMGFFDFDRNVAALRRAGGSVQGALDAL 366
           RY  QL +L DMGF D ++N+ AL  A G++  A+D L
Sbjct: 196 RYSRQLLELRDMGFSDANKNLDALSSAHGNINRAIDYL 233

>YGL181W Chr7 (157906..159096) [1191 bp, 396 aa] {ON}  GTS1Protein
           involved in Arf3p regulation and in transcription
           regulation; localizes to the nucleus and to endocytic
           patches; contains an N-terminal Zn-finger and ArfGAP
           homology domain, a C-terminal glutamine-rich region, and
           a UBA (ubiquitin associated) domain; gts1 mutations
           affect budding, cell size, heat tolerance, sporulation,
           life span, ultradian rhythms, endocytosis; expression
           oscillates in a pattern similar to metabolic
           oscillations
          Length = 396

 Score = 37.7 bits (86), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 25/38 (65%)

Query: 329 RYESQLRQLNDMGFFDFDRNVAALRRAGGSVQGALDAL 366
           RY  QL +L DMGF D ++N+ AL  A G++  A+D L
Sbjct: 194 RYSRQLAELKDMGFGDTNKNLDALSSAHGNINRAIDYL 231

>CAGL0L06028g Chr12 complement(677581..679098) [1518 bp, 505 aa]
           {ON} weakly similar to uniprot|P40956 Saccharomyces
           cerevisiae YGL181w GTS1
          Length = 505

 Score = 37.4 bits (85), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 25/38 (65%)

Query: 329 RYESQLRQLNDMGFFDFDRNVAALRRAGGSVQGALDAL 366
           +Y  +LRQL ++GF +  +N+ A+  + G V GALD L
Sbjct: 211 KYGRELRQLRELGFTNEQKNIDAITYSHGDVNGALDYL 248

>Suva_5.32 Chr5 complement(56798..58027) [1230 bp, 409 aa] {ON}
          YEL037C (REAL)
          Length = 409

 Score = 37.0 bits (84), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 31/53 (58%)

Query: 17 VEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKIQDGHSV 69
          +++E + TI   K  ++  S       +LIYSGK+L+D++TV    ++DG  V
Sbjct: 16 LDLEPSNTIFEAKTKLAQSSSCEESQIKLIYSGKVLQDSKTVSECGLKDGDQV 68

>TBLA0B02160 Chr2 complement(496901..498115) [1215 bp, 404 aa]
          {ON} Anc_1.480 YEL037C
          Length = 404

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 17 VEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKIQDG-HSVHMV 72
          +E+++ +TI + K  I+       D  +LIYSGKILK+  T+ +  ++D  H + M+
Sbjct: 16 LELDADSTIESAKGQIASEKNCDIDQIKLIYSGKILKNDATILNSGLKDNDHIIFMI 72

>Suva_7.81 Chr7 (153418..154434,154933..155121) [1206 bp, 401 aa]
           {ON} YGL181W (REAL)
          Length = 401

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 25/38 (65%)

Query: 329 RYESQLRQLNDMGFFDFDRNVAALRRAGGSVQGALDAL 366
           RY  QL +L DMGF D ++N+ AL  A G++  A+D L
Sbjct: 194 RYSRQLAELRDMGFNDKNKNLDALSSAHGNLSRAIDYL 231

>Skud_5.53 Chr5 complement(79502..80695) [1194 bp, 397 aa] {ON}
          YEL037C (REAL)
          Length = 397

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 31/53 (58%)

Query: 17 VEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKIQDGHSV 69
          +++E + TI   K  ++  +       +LIYSGK+L+D++TV    ++DG  V
Sbjct: 16 LDLEPSNTIFEAKTKLAQSTSCEESQIKLIYSGKVLQDSKTVSECGLKDGDQV 68

>ZYRO0D08140g Chr4 (705216..705437) [222 bp, 73 aa] {ON} similar
          to uniprot|Q6Q546 Saccharomyces cerevisiae YNR032C-A
          HUB1
          Length = 73

 Score = 32.7 bits (73), Expect = 0.20,   Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 28 FKETISGVSGVPADNQRLIYSGKILKDTETVESYKIQD 65
          FK+ +S   G PA   +L+  G ILKD  +++ Y+I D
Sbjct: 27 FKKILSVQIGTPASKIQLVKGGSILKDHISLDDYEIHD 64

>NDAI0G00330 Chr7 complement(54805..56088) [1284 bp, 427 aa] {ON}
          Anc_1.480 YEL037C
          Length = 427

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 31/53 (58%)

Query: 17 VEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKIQDGHSV 69
          +++E + TI   K  ++          ++IYSGK+L+D +TVE  ++++G  +
Sbjct: 16 LDLEPSNTILDVKSQLAQAKACEESQIKIIYSGKVLQDGQTVEECQLKEGDQI 68

>Smik_5.56 Chr5 complement(83505..84698) [1194 bp, 397 aa] {ON}
          YEL037C (REAL)
          Length = 397

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 30/53 (56%)

Query: 17 VEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKIQDGHSV 69
          +++E + TI   K  ++          +LIYSGK+L+D++TV    ++DG  V
Sbjct: 16 LDLEPSNTIFEVKSKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQV 68

>NCAS0G04120 Chr7 (768760..769938) [1179 bp, 392 aa] {ON}
          Anc_1.480 YEL037C
          Length = 392

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%)

Query: 19 IESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKIQDGHSV 69
          +ES  T+   K  ++          +LIYSGK+L+D +T+E   ++DG  V
Sbjct: 18 LESTNTVLDAKTQLAQNKSCEESQIKLIYSGKVLQDAKTLEDCGLKDGDQV 68

>YEL037C Chr5 complement(81407..82603) [1197 bp, 398 aa] {ON}
          RAD23Protein with ubiquitin-like N terminus, subunit of
          Nuclear Excision Repair Factor 2 (NEF2) with Rad4p that
          binds damaged DNA; enhances protein deglycosylation
          activity of Png1p; also involved, with Rad4p, in
          ubiquitylated protein turnover
          Length = 398

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 30/53 (56%)

Query: 17 VEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKIQDGHSV 69
          +++E + TI   K  ++          +LIYSGK+L+D++TV    ++DG  V
Sbjct: 16 LDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQV 68

>Ecym_3572 Chr3 complement(1083184..1084515) [1332 bp, 443 aa]
          {ON} similar to Ashbya gossypii AFR358W
          Length = 443

 Score = 34.7 bits (78), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 37/68 (54%), Gaps = 1/68 (1%)

Query: 3  QISVHVKS-GQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESY 61
           I+++ K   +    +++   ATI   K+ ++          ++I+SGK+L+D  T+++ 
Sbjct: 2  HITINFKDFKKEKLPLQLSPTATIAEAKQLLAKEKQCDESQLKMIFSGKVLQDGHTLDAC 61

Query: 62 KIQDGHSV 69
          K++DG  V
Sbjct: 62 KLKDGDQV 69

>Ecym_3176 Chr3 (337312..337325,337385..337997) [627 bp, 208 aa]
          {ON} similar to Ashbya gossypii AAL082W
          Length = 208

 Score = 33.9 bits (76), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 36/70 (51%), Gaps = 13/70 (18%)

Query: 4  ISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKIL-KDTETVESYK 62
          +S HV S Q  W+ E+      + F+   S V  +P+D+ R++YS  +  +D +TV   K
Sbjct: 24 LSTHVISVQEKWSFEL------KTFR---SSVKNIPSDDTRVMYSLTLTHRDNQTVTIKK 74

Query: 63 ---IQDGHSV 69
             I  GH V
Sbjct: 75 HSAIVTGHHV 84

>Skud_12.99 Chr12 (196796..200311) [3516 bp, 1171 aa] {ON} YLR032W
           (REAL)
          Length = 1171

 Score = 34.7 bits (78), Expect = 0.44,   Method: Composition-based stats.
 Identities = 24/70 (34%), Positives = 33/70 (47%)

Query: 299 FNQELLASMFGGNSNATGAAPAVDNRPPEERYESQLRQLNDMGFFDFDRNVAALRRAGGS 358
           F  E   S    NSN  G A +V   P EE +ES L+   ++G  D D+ +  LRR    
Sbjct: 26  FKSENKESFLFSNSNNDGDAVSVSETPEEEGHESVLQLAEEIGEGDQDQFIEELRRIIPE 85

Query: 359 VQGALDALLN 368
           +  +L   LN
Sbjct: 86  IPMSLAVELN 95

>AGR326C Chr7 complement(1338531..1339139) [609 bp, 202 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR011C
          Length = 202

 Score = 33.5 bits (75), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 36/59 (61%), Gaps = 4/59 (6%)

Query: 141 LNSSNGANPESMLQMLENPIFQSQMNEMLSNPQMVDFL-IQQNPQLQALGPRARDMLQS 198
           +N+   A+ + ++Q LE    +SQ +E+L++PQ VD   +   P LQ LG R +D +Q+
Sbjct: 46  VNAVTSADRDQLVQWLEA--VKSQFHELLADPQSVDCRGVIDRPMLQGLG-RIKDKMQA 101

>Suva_2.300 Chr2 complement(528809..528920,529056..529204) [261
          bp, 86 aa] {ON} YDR139C (REAL)
          Length = 86

 Score = 31.2 bits (69), Expect = 0.84,   Method: Composition-based stats.
 Identities = 13/41 (31%), Positives = 23/41 (56%)

Query: 16 TVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTE 56
          +VE++ +  +   KE +    G+P   QRLI+ GK + D +
Sbjct: 14 SVELKESDLVYHIKELLEEKEGIPPSQQRLIFQGKQIVDAK 54

>TPHA0O00440 Chr15 (78697..79806) [1110 bp, 369 aa] {ON} Anc_1.480
          YEL037C
          Length = 369

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 20/26 (76%)

Query: 44 RLIYSGKILKDTETVESYKIQDGHSV 69
          +LIYSGK+L+D+ ++E   ++DG  V
Sbjct: 43 KLIYSGKVLQDSNSIEGCGLKDGDQV 68

>Skud_7.90 Chr7 (163529..164719) [1191 bp, 396 aa] {ON} YGL181W
           (REAL)
          Length = 396

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%)

Query: 329 RYESQLRQLNDMGFFDFDRNVAALRRAGGSVQGALDAL 366
           RY  QL +L DMG+ D  +N+ AL  A G++  ++D L
Sbjct: 194 RYSRQLIELRDMGYNDTAKNLDALSFAHGNINRSIDYL 231

>ZYRO0F05192g Chr6 (434982..436136) [1155 bp, 384 aa] {ON} similar
          to uniprot|P32628 Saccharomyces cerevisiae YEL037C
          RAD23
          Length = 384

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 13/58 (22%), Positives = 33/58 (56%)

Query: 12 QNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKIQDGHSV 69
          +   ++E++ +++++  K  ++          +LIYSGK+L+D + ++   ++DG  V
Sbjct: 11 KEKISLELDPSSSVKDAKVRLATEKSCEESQIKLIYSGKVLQDAKNLQESGLKDGDQV 68

>TPHA0H00400 Chr8 (77122..78522) [1401 bp, 466 aa] {ON} Anc_8.142
           YGL181W
          Length = 466

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 20/38 (52%)

Query: 329 RYESQLRQLNDMGFFDFDRNVAALRRAGGSVQGALDAL 366
           +Y   ++ L  MG+ D D N  AL  A G +  A+D L
Sbjct: 227 KYSRHIKNLEQMGYTDIDNNAEALSIAHGDINQAIDIL 264

>Kpol_541.50 s541 complement(162130..163665) [1536 bp, 511 aa] {ON}
           complement(162130..163665) [1536 nt, 512 aa]
          Length = 511

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 21/38 (55%)

Query: 329 RYESQLRQLNDMGFFDFDRNVAALRRAGGSVQGALDAL 366
           RY  +L +L +MGF D D N  A+  A G +  A+  L
Sbjct: 233 RYSRELNRLREMGFNDIDNNAEAMSLANGDISRAITIL 270

>TDEL0C02590 Chr3 complement(448900..450006) [1107 bp, 368 aa]
          {ON} Anc_1.480 YEL037C
          Length = 368

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 21/26 (80%)

Query: 44 RLIYSGKILKDTETVESYKIQDGHSV 69
          +LIYSGK+L+D+++++   ++DG  V
Sbjct: 43 KLIYSGKVLQDSKSLQESGLKDGDQV 68

>Kpol_370.6 s370 (10094..11308) [1215 bp, 404 aa] {ON}
          (10094..11308) [1215 nt, 405 aa]
          Length = 404

 Score = 30.8 bits (68), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 29/53 (54%)

Query: 17 VEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKIQDGHSV 69
          +++E + T+   K+ I+          +LIYSGK+L++  T+    ++DG  V
Sbjct: 16 LDLEGSVTVLDAKKQIAVKKDCEDSQIKLIYSGKVLQNDSTIGDCGLKDGDQV 68

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 27,274,401
Number of extensions: 960793
Number of successful extensions: 2995
Number of sequences better than 10.0: 156
Number of HSP's gapped: 3019
Number of HSP's successfully gapped: 255
Length of query: 371
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 260
Effective length of database: 40,753,473
Effective search space: 10595902980
Effective search space used: 10595902980
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)