Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D01837g8.836ON2562566195e-80
NOTE: 18 genes in the same pillar as KLLA0D01837g were not hit in these BLAST results
LIST: Kpol_541.14 ZYRO0G14102g Skud_13.28 Smik_13.21 YML113W NCAS0B00330 TBLA0B03230 KAFR0A02810 Suva_13.31 KLTH0C03960g Kwal_27.10286 TDEL0B00610 Ecym_4607 KNAG0G03400 TPHA0C04770 NDAI0E00310 CAGL0B02277g SAKL0D01562g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D01837g
         (256 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D01837g Chr4 complement(160236..161006) [771 bp, 256 aa] {O...   243   5e-80

>KLLA0D01837g Chr4 complement(160236..161006) [771 bp, 256 aa] {ON}
           similar to uniprot|P13483 Saccharomyces cerevisiae
           YML113W DAT1 DNA binding protein that recognizes
           oligo(dA). oligo(dT) tracts; Arg side chain in its N-
           terminal pentad Gly-Arg-Lys-Pro-Gly repeat is required
           for DNA-binding; not essential for viability
          Length = 256

 Score =  243 bits (619), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 138/256 (53%), Positives = 138/256 (53%)

Query: 1   MAKKLSDXXXXXXXXXXXXAKTLAEXXXXXXXXXXXXXNLGISNGAVNAXXXXXXXXXXX 60
           MAKKLSD            AKTLAE             NLGISNGAVNA           
Sbjct: 1   MAKKLSDGRKPGSGRKPGRAKTLAEGRKPGSGRKKGSKNLGISNGAVNATGSGTRRSRSS 60

Query: 61  XQHYGMDHXXXXXXXPTIAMATSXXXXXXXXFHNGQAHYAAPHRIMKRGTXXXXXXXXXX 120
            QHYGMDH       PTIAMATS        FHNGQAHYAAPHRIMKRGT          
Sbjct: 61  SQHYGMDHSSSSASSPTIAMATSLLLQQQQQFHNGQAHYAAPHRIMKRGTADSANSSSNS 120

Query: 121 XXXXXPVSKRDRELIDALNKLSRCKSPPQSPDPMQTAKLPMLSSFWGSVDVPLRXXXXXX 180
                PVSKRDRELIDALNKLSRCKSPPQSPDPMQTAKLPMLSSFWGSVDVPLR      
Sbjct: 121 SSNSDPVSKRDRELIDALNKLSRCKSPPQSPDPMQTAKLPMLSSFWGSVDVPLRQEHEQQ 180

Query: 181 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPGVMWPNTPPPQVAXXXXXL 240
                                                   PGVMWPNTPPPQVA     L
Sbjct: 181 LQHQLQLQLQLQHQLQLQHQHQQIHSQQNSLNSNNSHQQIPGVMWPNTPPPQVASSSSSL 240

Query: 241 HQNNPSAHPSDLNSSH 256
           HQNNPSAHPSDLNSSH
Sbjct: 241 HQNNPSAHPSDLNSSH 256

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.128    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 13,755,117
Number of extensions: 315136
Number of successful extensions: 430
Number of sequences better than 10.0: 1
Number of HSP's gapped: 434
Number of HSP's successfully gapped: 2
Length of query: 256
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 149
Effective length of database: 41,212,137
Effective search space: 6140608413
Effective search space used: 6140608413
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 64 (29.3 bits)