Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D01661g8.830ON1121125765e-78
AAL184W8.830ON1121003632e-45
CAGL0J06666g8.830ON1121093526e-44
ZYRO0G13970g8.830ON1121023483e-43
TDEL0B006708.830ON1111093398e-42
SAKL0D01738g8.830ON1781013362e-40
Ecym_27118.830ON1151023293e-40
Suva_13.368.830ON1051043266e-40
Kwal_27.103288.830ON1271023252e-39
YML108W8.830ON1051033171e-38
KNAG0G033608.830ON1111053153e-38
TBLA0B031908.830ON1221213153e-38
NDAI0E003608.830ON1221213146e-38
Skud_13.338.830ON1051033127e-38
Kpol_1069.38.830ON1151103137e-38
Smik_13.268.830ON1051033102e-37
KLTH0C04070g8.830ON1131052981e-35
TPHA0I001908.830ON138742958e-35
NCAS0B011008.830ON1151172816e-33
KAFR0A027608.830ON1121112702e-31
KLLA0C02255g1.79ON116238690.45
Kwal_47.169054.339ON42051680.51
CAGL0C02805g8.712ON34765623.2
Smik_11.3585.702ON187860623.5
Smik_15.5577.1ON45445624.2
Suva_12.605.170ON114150614.8
Skud_15.5427.1ON45445606.0
NDAI0E016208.609ON48748598.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D01661g
         (112 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D01661g Chr4 complement(148193..148531) [339 bp, 112 aa] {O...   226   5e-78
AAL184W Chr1 (12906..13244) [339 bp, 112 aa] {ON} Syntenic homol...   144   2e-45
CAGL0J06666g Chr10 complement(639077..639415) [339 bp, 112 aa] {...   140   6e-44
ZYRO0G13970g Chr7 complement(1111500..1111838) [339 bp, 112 aa] ...   138   3e-43
TDEL0B00670 Chr2 (127614..127949) [336 bp, 111 aa] {ON} Anc_8.83...   135   8e-42
SAKL0D01738g Chr4 (138687..139223) [537 bp, 178 aa] {ON} similar...   134   2e-40
Ecym_2711 Chr2 (1376908..1377255) [348 bp, 115 aa] {ON} similar ...   131   3e-40
Suva_13.36 Chr13 (54612..54929) [318 bp, 105 aa] {ON} YML108W (R...   130   6e-40
Kwal_27.10328 s27 (287686..288069) [384 bp, 127 aa] {ON} YML108W...   129   2e-39
YML108W Chr13 (54793..55110) [318 bp, 105 aa] {ON} Putative prot...   126   1e-38
KNAG0G03360 Chr7 complement(723353..723688) [336 bp, 111 aa] {ON...   125   3e-38
TBLA0B03190 Chr2 complement(742438..742806) [369 bp, 122 aa] {ON...   125   3e-38
NDAI0E00360 Chr5 (57992..58360) [369 bp, 122 aa] {ON} Anc_8.830 ...   125   6e-38
Skud_13.33 Chr13 (54349..54666) [318 bp, 105 aa] {ON} YML108W (R...   124   7e-38
Kpol_1069.3 s1069 (4998..5345) [348 bp, 115 aa] {ON} (4998..5345...   125   7e-38
Smik_13.26 Chr13 (51023..51340) [318 bp, 105 aa] {ON} YML108W (R...   124   2e-37
KLTH0C04070g Chr3 (355923..356264) [342 bp, 113 aa] {ON} similar...   119   1e-35
TPHA0I00190 Chr9 complement(33784..34200) [417 bp, 138 aa] {ON} ...   118   8e-35
NCAS0B01100 Chr2 complement(181912..182259) [348 bp, 115 aa] {ON...   112   6e-33
KAFR0A02760 Chr1 complement(575048..575386) [339 bp, 112 aa] {ON...   108   2e-31
KLLA0C02255g Chr3 (189083..192571) [3489 bp, 1162 aa] {ON} simil...    31   0.45 
Kwal_47.16905 s47 complement(168136..169398) [1263 bp, 420 aa] {...    31   0.51 
CAGL0C02805g Chr3 (280107..281150) [1044 bp, 347 aa] {ON} highly...    28   3.2  
Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR09...    28   3.5  
Smik_15.557 Chr15 complement(987724..989088) [1365 bp, 454 aa] {...    28   4.2  
Suva_12.60 Chr12 complement(81323..84748) [3426 bp, 1141 aa] {ON...    28   4.8  
Skud_15.542 Chr15 complement(980857..982221) [1365 bp, 454 aa] {...    28   6.0  
NDAI0E01620 Chr5 (322737..324200) [1464 bp, 487 aa] {ON} Anc_8.6...    27   8.5  

>KLLA0D01661g Chr4 complement(148193..148531) [339 bp, 112 aa] {ON}
           similar to uniprot|Q03759 Saccharomyces cerevisiae
           YML108W defines a new subfamily of the split beta-alpha-
           beta sandwiches.
          Length = 112

 Score =  226 bits (576), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%)

Query: 1   MSATENVYRMLILLEEPISESAGDTKKKQNATHEFVDELPLPIQVDEMDLLNSWFDKFDE 60
           MSATENVYRMLILLEEPISESAGDTKKKQNATHEFVDELPLPIQVDEMDLLNSWFDKFDE
Sbjct: 1   MSATENVYRMLILLEEPISESAGDTKKKQNATHEFVDELPLPIQVDEMDLLNSWFDKFDE 60

Query: 61  KICIPNEGHIKYEISSDGLIVLILDKSIEHIVQEVTSFVEQNVPESEKEQDE 112
           KICIPNEGHIKYEISSDGLIVLILDKSIEHIVQEVTSFVEQNVPESEKEQDE
Sbjct: 61  KICIPNEGHIKYEISSDGLIVLILDKSIEHIVQEVTSFVEQNVPESEKEQDE 112

>AAL184W Chr1 (12906..13244) [339 bp, 112 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YML108W
          Length = 112

 Score =  144 bits (363), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 83/100 (83%)

Query: 3   ATENVYRMLILLEEPISESAGDTKKKQNATHEFVDELPLPIQVDEMDLLNSWFDKFDEKI 62
           AT+N YRM+ILLEEP  + + D +K +NA+H+FVDEL LPIQVD++++LN+WFDKFDE+I
Sbjct: 2   ATDNFYRMMILLEEPHKQHSTDGRKIENASHDFVDELLLPIQVDDLEVLNTWFDKFDEEI 61

Query: 63  CIPNEGHIKYEISSDGLIVLILDKSIEHIVQEVTSFVEQN 102
           CIPNEGHIKYEISSDGLIVLILDK I  ++  V  FV  N
Sbjct: 62  CIPNEGHIKYEISSDGLIVLILDKEISEVIGLVRDFVAAN 101

>CAGL0J06666g Chr10 complement(639077..639415) [339 bp, 112 aa] {ON}
           similar to uniprot|Q03759 Saccharomyces cerevisiae
           YML108w
          Length = 112

 Score =  140 bits (352), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 88/109 (80%), Gaps = 3/109 (2%)

Query: 6   NVYRMLILLEEPISE--SAGDTKKKQNATHEFVDELPLPIQVDEMDLLNSWFDKFDEKIC 63
           N+YRM++LLEEP+ E  +  D+K+++   HEF+DEL LP Q+DE+DLLN WFDKFD++IC
Sbjct: 3   NLYRMMVLLEEPMEEDITISDSKEEKKVMHEFMDELTLPFQIDEIDLLNKWFDKFDDEIC 62

Query: 64  IPNEGHIKYEISSDGLIVLILDKSI-EHIVQEVTSFVEQNVPESEKEQD 111
           IPNEGHIKYEI+SDGLIVLILDK + E  V +V +FVEQN  E E E+D
Sbjct: 63  IPNEGHIKYEITSDGLIVLILDKELGEEFVGKVKTFVEQNNVEDEDEED 111

>ZYRO0G13970g Chr7 complement(1111500..1111838) [339 bp, 112 aa]
           {ON} highly similar to uniprot|Q03759 Saccharomyces
           cerevisiae YML108W defines a new subfamily of the split
           beta-alpha-beta sandwiches.
          Length = 112

 Score =  138 bits (348), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 69/102 (67%), Positives = 83/102 (81%), Gaps = 3/102 (2%)

Query: 1   MSATENVYRMLILLEEPISESAGDTKKKQNATHEFVDELPLPIQVDEMDLLNSWFDKFDE 60
           MS  EN YRML+LLEEP+S S  + +KK    HEF+DEL LP  VDE+D LNSWFDKFDE
Sbjct: 1   MSGPENSYRMLVLLEEPVSGSKPEDEKK---VHEFMDELVLPFNVDEIDQLNSWFDKFDE 57

Query: 61  KICIPNEGHIKYEISSDGLIVLILDKSIEHIVQEVTSFVEQN 102
           +ICIPNEGHIKYEI+SDG+IVLILDK +E +V +V SFVE++
Sbjct: 58  QICIPNEGHIKYEITSDGIIVLILDKEMEPLVSQVRSFVEKH 99

>TDEL0B00670 Chr2 (127614..127949) [336 bp, 111 aa] {ON} Anc_8.830
           YML108W
          Length = 111

 Score =  135 bits (339), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 64/109 (58%), Positives = 81/109 (74%), Gaps = 7/109 (6%)

Query: 1   MSATENVYRMLILLEEPI-------SESAGDTKKKQNATHEFVDELPLPIQVDEMDLLNS 53
           M   +N Y M+I LEE I       S   G+ K+   ++HEFVDEL LP QVDE+D LN 
Sbjct: 1   MGGNDNFYHMIIFLEESIENGQEGNSVDNGEDKQDVKSSHEFVDELVLPFQVDEIDALNE 60

Query: 54  WFDKFDEKICIPNEGHIKYEISSDGLIVLILDKSIEHIVQEVTSFVEQN 102
           WFDKFDEK+CIPNEGHIKYEI+SDG++VL+LDK +EH+V +V +FVE+N
Sbjct: 61  WFDKFDEKLCIPNEGHIKYEITSDGMMVLLLDKELEHLVNDVKTFVEEN 109

>SAKL0D01738g Chr4 (138687..139223) [537 bp, 178 aa] {ON} similar to
           uniprot|Q03759 Saccharomyces cerevisiae YML108W defines
           a new subfamily of the split beta-alpha- beta
           sandwiches.
          Length = 178

 Score =  134 bits (336), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 81/101 (80%), Gaps = 1/101 (0%)

Query: 3   ATENVYRMLILLEEPISESAGDTKKKQNAT-HEFVDELPLPIQVDEMDLLNSWFDKFDEK 61
           + +N YRML+LLEE I +S+ +  +    T HEFVDEL LPIQVDEMDLLN WFDKFDE+
Sbjct: 71  SGDNGYRMLMLLEEAIPDSSQENNENTTKTSHEFVDELVLPIQVDEMDLLNDWFDKFDEQ 130

Query: 62  ICIPNEGHIKYEISSDGLIVLILDKSIEHIVQEVTSFVEQN 102
           ICIPNEG+IKYEISSDGLIVLIL+K  E +V +V  FVE++
Sbjct: 131 ICIPNEGYIKYEISSDGLIVLILNKEREEVVDKVRRFVEEH 171

>Ecym_2711 Chr2 (1376908..1377255) [348 bp, 115 aa] {ON} similar to
           Ashbya gossypii AAL184W
          Length = 115

 Score =  131 bits (329), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 66/102 (64%), Positives = 82/102 (80%), Gaps = 2/102 (1%)

Query: 1   MSATENVYRMLILLEEPISESAGDTKKKQNATHEFVDELPLPIQVDEMDLLNSWFDKFDE 60
           MSA +N YRM+ILLEE I ES  D   K NATH+FVDE+ LP+QVDE+D+LN WFDKFDE
Sbjct: 4   MSA-DNFYRMMILLEEAIPESK-DENIKANATHDFVDEVVLPMQVDELDVLNKWFDKFDE 61

Query: 61  KICIPNEGHIKYEISSDGLIVLILDKSIEHIVQEVTSFVEQN 102
           +IC+PNEG+IKYEISSDGLIVL++ +    IV +V +FV +N
Sbjct: 62  EICLPNEGYIKYEISSDGLIVLMVSQERSSIVNQVKNFVAKN 103

>Suva_13.36 Chr13 (54612..54929) [318 bp, 105 aa] {ON} YML108W
           (REAL)
          Length = 105

 Score =  130 bits (326), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 77/104 (74%), Gaps = 3/104 (2%)

Query: 3   ATENVYRMLILLEEPISESAGD---TKKKQNATHEFVDELPLPIQVDEMDLLNSWFDKFD 59
           A  N YRML+LLE+    +  D    K K    HEFVDEL LP QVDE+D LN WFDKFD
Sbjct: 2   AKNNTYRMLVLLEDDTKINKEDEKFLKGKPGKMHEFVDELMLPFQVDELDELNVWFDKFD 61

Query: 60  EKICIPNEGHIKYEISSDGLIVLILDKSIEHIVQEVTSFVEQNV 103
            +ICIPNEGHIKYEISSDGLIVL+LDK IE +V++V  FVE+N+
Sbjct: 62  AEICIPNEGHIKYEISSDGLIVLMLDKEIEDVVEKVKRFVEENI 105

>Kwal_27.10328 s27 (287686..288069) [384 bp, 127 aa] {ON} YML108W -
           Hypothetical ORF [contig 36] FULL
          Length = 127

 Score =  129 bits (325), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 63/102 (61%), Positives = 79/102 (77%), Gaps = 6/102 (5%)

Query: 5   ENVYRMLILLEEPI-SESAGDTKKKQN-----ATHEFVDELPLPIQVDEMDLLNSWFDKF 58
           E  YRML+L+E+P+ SE   D +K++N     ATHEFVDEL LP ++D+MD LN WFDKF
Sbjct: 18  ERAYRMLVLVEDPVKSEGTVDGEKEENTDAPKATHEFVDELILPFEIDDMDTLNEWFDKF 77

Query: 59  DEKICIPNEGHIKYEISSDGLIVLILDKSIEHIVQEVTSFVE 100
           D +ICIPNEG IKYEISSDGL+VL+LD+S E +V EV  FV+
Sbjct: 78  DAEICIPNEGFIKYEISSDGLVVLLLDRSREEVVAEVRKFVQ 119

>YML108W Chr13 (54793..55110) [318 bp, 105 aa] {ON} Putative protein
           of unknown function whose structure defines a new
           subfamily of the split beta-alpha-beta sandwiches; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; YML108W is not an essential
           gene
          Length = 105

 Score =  126 bits (317), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 76/103 (73%), Gaps = 3/103 (2%)

Query: 3   ATENVYRMLILLEEPISESAGD---TKKKQNATHEFVDELPLPIQVDEMDLLNSWFDKFD 59
           +  N YRML+LLE+    +  D    K K    HEFVDEL LP  VDE+D LN+WFDKFD
Sbjct: 2   SKSNTYRMLVLLEDDTKINKEDEKFLKGKPGKMHEFVDELILPFNVDELDELNTWFDKFD 61

Query: 60  EKICIPNEGHIKYEISSDGLIVLILDKSIEHIVQEVTSFVEQN 102
            +ICIPNEGHIKYEISSDGLIVL+LDK IE +V++V  FVE+N
Sbjct: 62  AEICIPNEGHIKYEISSDGLIVLMLDKEIEEVVEKVKKFVEEN 104

>KNAG0G03360 Chr7 complement(723353..723688) [336 bp, 111 aa] {ON}
           Anc_8.830 YML108W
          Length = 111

 Score =  125 bits (315), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 80/105 (76%), Gaps = 7/105 (6%)

Query: 5   ENVYRMLILLEEPISE-------SAGDTKKKQNATHEFVDELPLPIQVDEMDLLNSWFDK 57
           ++ YRMLIL+EEP+ +       ++ D  +   +THE++DEL LP  +DE+D LN WFDK
Sbjct: 6   DDTYRMLILVEEPLEDDVPTTEVTSEDGSQPIKSTHEYIDELHLPFGLDELDALNEWFDK 65

Query: 58  FDEKICIPNEGHIKYEISSDGLIVLILDKSIEHIVQEVTSFVEQN 102
           FDE+ICIPNEGHIKYEISSDGLIVL+L K IEH+ +++ SF+E +
Sbjct: 66  FDEEICIPNEGHIKYEISSDGLIVLMLGKEIEHVYEQIKSFIETH 110

>TBLA0B03190 Chr2 complement(742438..742806) [369 bp, 122 aa] {ON}
           Anc_8.830 YML108W
          Length = 122

 Score =  125 bits (315), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 65/121 (53%), Positives = 82/121 (67%), Gaps = 19/121 (15%)

Query: 1   MSATENVYRMLILLEE---PISE--------SAGDTKKKQNAT--------HEFVDELPL 41
           MS+    YRM++LLEE   PI +        S+ D  +K   T        HEF+DEL L
Sbjct: 1   MSSNSVAYRMMVLLEEDMEPIEDDINLKSESSSNDNTEKVTTTKNTEPKKSHEFIDELIL 60

Query: 42  PIQVDEMDLLNSWFDKFDEKICIPNEGHIKYEISSDGLIVLILDKSIEHIVQEVTSFVEQ 101
           P  VDE+D+LN WFDKFDE+ICIPNEGHIKYEI+SDGLI+LILD  I+H+V++V  FV+ 
Sbjct: 61  PFHVDELDILNEWFDKFDEQICIPNEGHIKYEITSDGLIILILDNDIKHVVEQVKDFVQN 120

Query: 102 N 102
           N
Sbjct: 121 N 121

>NDAI0E00360 Chr5 (57992..58360) [369 bp, 122 aa] {ON} Anc_8.830
           YML108W
          Length = 122

 Score =  125 bits (314), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 64/121 (52%), Positives = 79/121 (65%), Gaps = 19/121 (15%)

Query: 1   MSATENVYRMLILLEEPISE-------------------SAGDTKKKQNATHEFVDELPL 41
           MS+T N+YR++ILLEE I E                      D +K     HEF++EL L
Sbjct: 1   MSSTNNMYRLMILLEEEIGEPDLKDGSIDEATETETKDVHNSDEEKNVKKMHEFIEELIL 60

Query: 42  PIQVDEMDLLNSWFDKFDEKICIPNEGHIKYEISSDGLIVLILDKSIEHIVQEVTSFVEQ 101
           P   +E+DLLN WFDKFDE+ICIPNEGHIKYEI+SDGLIVL+LDK IE +V E+  F+E 
Sbjct: 61  PFGTEELDLLNEWFDKFDEEICIPNEGHIKYEITSDGLIVLLLDKEIEDVVGEIKKFIET 120

Query: 102 N 102
           N
Sbjct: 121 N 121

>Skud_13.33 Chr13 (54349..54666) [318 bp, 105 aa] {ON} YML108W
           (REAL)
          Length = 105

 Score =  124 bits (312), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 76/103 (73%), Gaps = 3/103 (2%)

Query: 3   ATENVYRMLILLEEPISESAGD---TKKKQNATHEFVDELPLPIQVDEMDLLNSWFDKFD 59
           +  N YRML+LLE+    S  D    K K    HEFVDEL LP ++DE+D LN WFDKFD
Sbjct: 2   SKSNAYRMLVLLEDDTKISKEDEKFLKGKPGKMHEFVDELILPFEIDELDELNIWFDKFD 61

Query: 60  EKICIPNEGHIKYEISSDGLIVLILDKSIEHIVQEVTSFVEQN 102
            +ICIPNEGHIKYEISSDGLIVL+LDK I+ +V++V +FVE N
Sbjct: 62  AEICIPNEGHIKYEISSDGLIVLMLDKEIQEVVEKVKNFVEDN 104

>Kpol_1069.3 s1069 (4998..5345) [348 bp, 115 aa] {ON} (4998..5345)
           [348 nt, 116 aa]
          Length = 115

 Score =  125 bits (313), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 81/110 (73%), Gaps = 10/110 (9%)

Query: 2   SATENVYRMLILLEEPISESAGDTKKKQNAT---------HEFVDELPLPIQVDEMDLLN 52
              E+ YRMLILLEE + E+  + + +Q+ T         HEFVDEL LP QVDE+D LN
Sbjct: 3   GGAESNYRMLILLEEGM-ENLDEEQTQQDRTEEPKESKKMHEFVDELVLPFQVDEIDSLN 61

Query: 53  SWFDKFDEKICIPNEGHIKYEISSDGLIVLILDKSIEHIVQEVTSFVEQN 102
            WFDKFDE+ICIPNEGHIKYEI+SDG+IVLILDK IE+++ +V  FV+ N
Sbjct: 62  DWFDKFDEEICIPNEGHIKYEITSDGIIVLILDKEIENVLDKVKEFVQSN 111

>Smik_13.26 Chr13 (51023..51340) [318 bp, 105 aa] {ON} YML108W
           (REAL)
          Length = 105

 Score =  124 bits (310), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 74/103 (71%), Gaps = 3/103 (2%)

Query: 3   ATENVYRMLILLEEPISESAGD---TKKKQNATHEFVDELPLPIQVDEMDLLNSWFDKFD 59
           +  N YRML+LLE+    +  D    K K    HEFVDEL LP  VDE+D LN WFDKFD
Sbjct: 2   SRNNTYRMLVLLEDDAKVNKEDEKFLKGKPGKMHEFVDELILPFDVDELDELNIWFDKFD 61

Query: 60  EKICIPNEGHIKYEISSDGLIVLILDKSIEHIVQEVTSFVEQN 102
            +ICIPNEGHIKYEISSDGLIVL+LDK IE ++++V  FVE N
Sbjct: 62  AEICIPNEGHIKYEISSDGLIVLMLDKEIEEVIEKVKQFVEDN 104

>KLTH0C04070g Chr3 (355923..356264) [342 bp, 113 aa] {ON} similar to
           uniprot|Q03759 Saccharomyces cerevisiae YML108W defines
           a new subfamily of the split beta-alpha- beta
           sandwiches.
          Length = 113

 Score =  119 bits (298), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 77/105 (73%), Gaps = 8/105 (7%)

Query: 3   ATENVYRMLILLEEPISESAGDTKKKQN-------ATHEFVDELPLPIQVDEMDLLNSWF 55
           + E  YRML+L+E+ + E AG+  +++        ATHEFVDEL LP ++D+MD LN WF
Sbjct: 2   SDERNYRMLVLVED-VLEQAGEKNEQETKGEGAPKATHEFVDELILPFEIDDMDKLNEWF 60

Query: 56  DKFDEKICIPNEGHIKYEISSDGLIVLILDKSIEHIVQEVTSFVE 100
           DKFD  ICIPNEG IKYEISSDGL+VL+LD+S E +V +V  FVE
Sbjct: 61  DKFDADICIPNEGFIKYEISSDGLVVLLLDRSKEDVVAQVRKFVE 105

>TPHA0I00190 Chr9 complement(33784..34200) [417 bp, 138 aa] {ON}
           Anc_8.830 YML108W
          Length = 138

 Score =  118 bits (295), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 63/74 (85%)

Query: 29  QNATHEFVDELPLPIQVDEMDLLNSWFDKFDEKICIPNEGHIKYEISSDGLIVLILDKSI 88
           Q+ +HEFVDEL LP  VDE+D+LN WFDKFD+++CIPNEGHIKYEI+SDGLIVL+LDK I
Sbjct: 45  QSKSHEFVDELILPFNVDELDMLNEWFDKFDDEVCIPNEGHIKYEITSDGLIVLMLDKEI 104

Query: 89  EHIVQEVTSFVEQN 102
           EH+V +V  FV  N
Sbjct: 105 EHVVSKVKEFVSAN 118

>NCAS0B01100 Chr2 complement(181912..182259) [348 bp, 115 aa] {ON}
           Anc_8.830 YML108W
          Length = 115

 Score =  112 bits (281), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 80/117 (68%), Gaps = 13/117 (11%)

Query: 3   ATENVYRMLIL----------LEEPISESAGDTKKKQNATHEFVDELPLPIQVDEMDLLN 52
           + +N+YRML+L           +   ++S     KK   THEF++EL LP +V E+D LN
Sbjct: 2   SKDNMYRMLVLLEEEMEEPELFDNDTTDSKATEPKK---THEFIEELLLPFEVSELDALN 58

Query: 53  SWFDKFDEKICIPNEGHIKYEISSDGLIVLILDKSIEHIVQEVTSFVEQNVPESEKE 109
            WFDKFDE+ICIPNEGHIKYEISSDGLIVL+LDK IE+++ EV  F++ N   +E E
Sbjct: 59  KWFDKFDEEICIPNEGHIKYEISSDGLIVLLLDKEIENVISEVKKFIDDNQDLNESE 115

>KAFR0A02760 Chr1 complement(575048..575386) [339 bp, 112 aa] {ON}
           Anc_8.830 YML108W
          Length = 112

 Score =  108 bits (270), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 80/111 (72%), Gaps = 9/111 (8%)

Query: 1   MSATENVYRMLILLEEPI---------SESAGDTKKKQNATHEFVDELPLPIQVDEMDLL 51
           M+ ++N YRML+LLEE           +++    K++   +HEF++EL LP +  E+D L
Sbjct: 1   MAGSDNRYRMLVLLEEESEEVIEKFEDNDNGEQPKQESTKSHEFIEELILPFETSELDTL 60

Query: 52  NSWFDKFDEKICIPNEGHIKYEISSDGLIVLILDKSIEHIVQEVTSFVEQN 102
           N WFDKFDE+ICIPNEG+IKYEISSDGL+VL++DK IE++V++V  FV  N
Sbjct: 61  NEWFDKFDEEICIPNEGNIKYEISSDGLVVLLIDKQIENVVEKVKEFVNNN 111

>KLLA0C02255g Chr3 (189083..192571) [3489 bp, 1162 aa] {ON} similar
           to uniprot|P53840 Saccharomyces cerevisiae YNL273W TOF1
           Protein that interacts with topoisomerase I
          Length = 1162

 Score = 31.2 bits (69), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 19/38 (50%), Gaps = 2/38 (5%)

Query: 29  QNATHEFVDELP--LPIQVDEMDLLNSWFDKFDEKICI 64
           QNAT  F  E+   LP+   E  L  SWF KF    CI
Sbjct: 462 QNATDSFTSEIQDQLPLHKIEYMLFISWFVKFQRSRCI 499

>Kwal_47.16905 s47 complement(168136..169398) [1263 bp, 420 aa] {ON}
           YML071C (DOR1) - Hypothetical ORF [contig 219] FULL
          Length = 420

 Score = 30.8 bits (68), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 29/51 (56%)

Query: 48  MDLLNSWFDKFDEKICIPNEGHIKYEISSDGLIVLILDKSIEHIVQEVTSF 98
           + +L S FD   +KI IP  G  K  +S++ L +L +    + ++QE+T +
Sbjct: 310 LAILPSTFDVPTQKIAIPLLGVPKKPLSTNPLTLLFIKNCCDLLIQELTPY 360

>CAGL0C02805g Chr3 (280107..281150) [1044 bp, 347 aa] {ON} highly
           similar to uniprot|Q08726 Saccharomyces cerevisiae
           YOR262w
          Length = 347

 Score = 28.5 bits (62), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 33/65 (50%), Gaps = 9/65 (13%)

Query: 37  DELPLPIQVDEMDLLNSWFDKFDEKICIPNEGHIKYEISSDGLIVLILDKSIEHIVQEVT 96
           D+LP P  VD  D + +  +   E+   PN G + Y I S       LDKSI+  + ++ 
Sbjct: 43  DKLPYPCAVDIRDFI-TLEEIMSEQQLGPN-GGLMYAIES-------LDKSIDMFILQIK 93

Query: 97  SFVEQ 101
           S VEQ
Sbjct: 94  SLVEQ 98

>Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR095W
           (REAL)
          Length = 1878

 Score = 28.5 bits (62), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 15/60 (25%), Positives = 32/60 (53%)

Query: 24  DTKKKQNATHEFVDELPLPIQVDEMDLLNSWFDKFDEKICIPNEGHIKYEISSDGLIVLI 83
           +TK++   T +      L  +  E+++L S  D  ++++C  NE ++ Y   +D +I+ I
Sbjct: 180 ETKQQDLITSDLNSRAELERKAQELNILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEI 239

>Smik_15.557 Chr15 complement(987724..989088) [1365 bp, 454 aa] {ON}
           YOR375C (REAL)
          Length = 454

 Score = 28.5 bits (62), Expect = 4.2,   Method: Composition-based stats.
 Identities = 17/45 (37%), Positives = 23/45 (51%)

Query: 59  DEKICIPNEGHIKYEISSDGLIVLILDKSIEHIVQEVTSFVEQNV 103
           D K CI +E  I  E  +D     +  KS+E IV E ++F E  V
Sbjct: 248 DSKGCIISETGITSEQIADIATAKVNFKSLEQIVNEYSTFTENKV 292

>Suva_12.60 Chr12 complement(81323..84748) [3426 bp, 1141 aa] {ON}
            YJL020C (REAL)
          Length = 1141

 Score = 28.1 bits (61), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 22/50 (44%)

Query: 35   FVDELPLPIQVDEMDLLNSWFDKFDEKICIPNEGHIKYEISSDGLIVLIL 84
            F + LP P +     LL+ +  KF+ KI   +   I   I +   +  IL
Sbjct: 966  FQEHLPAPAEAQSAQLLDGYAQKFNAKILEKSHSLINSHIGAKNFVPQIL 1015

>Skud_15.542 Chr15 complement(980857..982221) [1365 bp, 454 aa] {ON}
           YAL062W (REAL)
          Length = 454

 Score = 27.7 bits (60), Expect = 6.0,   Method: Composition-based stats.
 Identities = 17/45 (37%), Positives = 23/45 (51%)

Query: 59  DEKICIPNEGHIKYEISSDGLIVLILDKSIEHIVQEVTSFVEQNV 103
           D K CI +E  I  E  +D     +  KS+E IV E ++F E  V
Sbjct: 248 DSKGCIISETGITSEQVADISSAKVSFKSLEQIVSEYSTFTENKV 292

>NDAI0E01620 Chr5 (322737..324200) [1464 bp, 487 aa] {ON}
          Anc_8.609 YOR198C
          Length = 487

 Score = 27.3 bits (59), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 24/48 (50%)

Query: 28 KQNATHEFVDELPLPIQVDEMDLLNSWFDKFDEKICIPNEGHIKYEIS 75
          K N+ H FV    + ++  ++D LN    K D +I +  +    Y+IS
Sbjct: 13 KTNSNHRFVKRPDVSVRDKKLDTLNVQLKKIDNEIALLRKQIDHYQIS 60

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.132    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 12,983,487
Number of extensions: 570328
Number of successful extensions: 1468
Number of sequences better than 10.0: 46
Number of HSP's gapped: 1450
Number of HSP's successfully gapped: 46
Length of query: 112
Length of database: 53,481,399
Length adjustment: 82
Effective length of query: 30
Effective length of database: 44,078,787
Effective search space: 1322363610
Effective search space used: 1322363610
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 59 (27.3 bits)