Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D01639g8.829ON38138117880.0
SAKL0D01760g8.829ON38138114970.0
KLTH0C04114g8.829ON37837913660.0
YMR272C (SCS7)8.829ON38438113390.0
Smik_13.4858.829ON38438113360.0
ZYRO0G13948g8.829ON38438213280.0
Kwal_27.103328.829ON37837913250.0
Suva_13.4608.829ON38438113240.0
Skud_13.4448.829ON38438113240.0
TDEL0B006808.829ON38338013220.0
AAL183W8.829ON37737612651e-174
Ecym_27128.829ON38138012531e-172
NCAS0C004708.829ON42638312331e-168
CAGL0F03399g8.829ON38038312061e-165
NDAI0K004708.829ON38638411571e-157
KNAG0J003208.829ON37338011331e-154
Kpol_541.98.829ON37437911281e-153
KAFR0B038508.829ON37738211001e-149
TBLA0D031808.829ON40038310621e-143
TPHA0C047108.829ON3773809981e-134
Kpol_1069.48.829ON2772457671e-100
NDAI0F027302.166ON121751626e-13
Kpol_505.142.166ON123751601e-12
TDEL0F012102.166ON126711582e-12
Suva_14.2282.166ON120751502e-11
KAFR0B045502.166ON126701493e-11
Skud_14.2212.166ON120751484e-11
KNAG0I020402.166ON119751475e-11
TPHA0F017902.166ON182751516e-11
TBLA0B013102.166ON123711451e-10
CAGL0L03828g2.166ON121701441e-10
NCAS0G025702.166ON121701441e-10
Kwal_26.84612.166ON123751414e-10
KLTH0D09284g2.166ON123751405e-10
SAKL0E10626g2.166ON123751343e-09
KLLA0F27577gna 1ON172801373e-09
ZYRO0B09812g2.166ON183791383e-09
AFL223W2.166ON165751355e-09
Kwal_47.18167na 1ON227571386e-09
YNL111C (CYB5)2.166ON120751317e-09
Smik_14.2162.166ON120751301e-08
SAKL0F08316gna 1ON178571331e-08
KLTH0D06930g2.536ON204761323e-08
TDEL0H02180na 1ON203611305e-08
TDEL0D00190singletonON552781346e-08
KLTH0A04026gna 1ON233581299e-08
KLLA0F23672g2.166ON123751212e-07
KLTH0C11858gsingletonON555761266e-07
Ecym_54202.166ON145741188e-07
Kwal_23.2823na 2ON560711241e-06
ZYRO0B02090g2.536ON194911191e-06
KLLA0D02640g4.304ON589541231e-06
KNAG0E038604.304ON604531231e-06
ADL085Cna 1ON273781202e-06
TPHA0B018204.304ON576521222e-06
ZYRO0C18524gsingletonON554421222e-06
KLTH0C11770gsingletonON618491212e-06
Ecym_4346na 1ON209731172e-06
SAKL0G16852g4.304ON580481194e-06
NDAI0D047104.304ON616541194e-06
Kpol_1014.54.304ON596591195e-06
KLLA0B14795gna 2ON556701185e-06
SAKL0F16610gsingletonON564711161e-05
NDAI0D04700na 3ON625591151e-05
KAFR0A047406.106ON483721132e-05
ZYRO0D16654gna 1ON190591083e-05
NCAS0A02770na 3ON609511133e-05
ZYRO0B13728g4.304ON598541097e-05
YML054C (CYB2)4.304ON591611071e-04
Smik_13.924.304ON591611071e-04
NCAS0F008702.536ON189731021e-04
CAGL0K03069g2.536ON194721032e-04
Skud_13.924.304ON591611062e-04
Suva_13.1054.304ON591611062e-04
Kwal_26.80462.536ON198761022e-04
CAGL0K10736g4.304ON593541052e-04
NCAS0A027804.304ON602631052e-04
TDEL0D011404.304ON584481043e-04
KNAG0C057802.536ON18086976e-04
KAFR0I005204.304ON58661980.002
KNAG0F032506.106ON48972960.003
SAKL0A09570g2.536ON21149930.003
TBLA0I015302.536ON22160910.005
NDAI0H013702.536ON22446910.007
Kwal_14.807singletonON57848910.012
NDAI0I016206.106ON44175880.026
Kpol_348.122.536ON21758850.033
TDEL0A031102.536ON20072830.051
KAFR0A018902.536ON16149800.081
TPHA0G035502.536ON21851810.11
CAGL0I00418g6.106ON49072810.19
Kpol_478.176.106ON48474800.24
KLLA0E18459g2.536ON14881750.31
Ecym_30806.106ON47972780.35
TBLA0C06220singletonON49446780.40
NCAS0D032506.106ON49774760.64
SAKL0A07326g6.106ON48072741.1
AAR153C6.106ON47872731.4
SAKL0E08800g2.240ON33292712.5
Smik_13.2522.536ON20156693.2
Skud_7.2266.106ON50974713.2
TDEL0G036506.106ON48372694.3
Kwal_23.5693na 4ON51346695.2
AAL078Wna 4ON59246695.4
KLTH0H06798g6.106ON48872686.1
Suva_13.2502.536ON20143668.1
AFL079Wna 5ON53857678.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D01639g
         (381 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D01639g Chr4 complement(146344..147489) [1146 bp, 381 aa] {...   693   0.0  
SAKL0D01760g Chr4 (140050..141195) [1146 bp, 381 aa] {ON} simila...   581   0.0  
KLTH0C04114g Chr3 (357195..358331) [1137 bp, 378 aa] {ON} highly...   530   0.0  
YMR272C Chr13 complement(809623..810777) [1155 bp, 384 aa] {ON} ...   520   0.0  
Smik_13.485 Chr13 complement(792640..793794) [1155 bp, 384 aa] {...   519   0.0  
ZYRO0G13948g Chr7 complement(1109941..1111095) [1155 bp, 384 aa]...   516   0.0  
Kwal_27.10332 s27 (289484..290620) [1137 bp, 378 aa] {ON} YMR272...   514   0.0  
Suva_13.460 Chr13 complement(792221..793375) [1155 bp, 384 aa] {...   514   0.0  
Skud_13.444 Chr13 complement(783092..784246) [1155 bp, 384 aa] {...   514   0.0  
TDEL0B00680 Chr2 (128650..129801) [1152 bp, 383 aa] {ON} Anc_8.8...   513   0.0  
AAL183W Chr1 (13713..14846) [1134 bp, 377 aa] {ON} Syntenic homo...   491   e-174
Ecym_2712 Chr2 (1378070..1379215) [1146 bp, 381 aa] {ON} similar...   487   e-172
NCAS0C00470 Chr3 (78059..79339) [1281 bp, 426 aa] {ON} Anc_8.829      479   e-168
CAGL0F03399g Chr6 complement(333955..335097) [1143 bp, 380 aa] {...   469   e-165
NDAI0K00470 Chr11 (107509..108669) [1161 bp, 386 aa] {ON} Anc_8....   450   e-157
KNAG0J00320 Chr10 (50267..51388) [1122 bp, 373 aa] {ON} Anc_8.82...   441   e-154
Kpol_541.9 s541 complement(23399..24523) [1125 bp, 374 aa] {ON} ...   439   e-153
KAFR0B03850 Chr2 complement(796399..797532) [1134 bp, 377 aa] {O...   428   e-149
TBLA0D03180 Chr4 complement(774883..776085) [1203 bp, 400 aa] {O...   413   e-143
TPHA0C04710 Chr3 complement(1015392..1016525) [1134 bp, 377 aa] ...   389   e-134
Kpol_1069.4 s1069 (6163..6996) [834 bp, 277 aa] {ON} (6163..6996...   300   e-100
NDAI0F02730 Chr6 (669821..670186) [366 bp, 121 aa] {ON} Anc_2.166      67   6e-13
Kpol_505.14 s505 (37085..37456) [372 bp, 123 aa] {ON} (37085..37...    66   1e-12
TDEL0F01210 Chr6 complement(216322..216702) [381 bp, 126 aa] {ON...    65   2e-12
Suva_14.228 Chr14 complement(413753..414115) [363 bp, 120 aa] {O...    62   2e-11
KAFR0B04550 Chr2 (946561..946941) [381 bp, 126 aa] {ON} Anc_2.16...    62   3e-11
Skud_14.221 Chr14 complement(407119..407481) [363 bp, 120 aa] {O...    62   4e-11
KNAG0I02040 Chr9 (397527..397886) [360 bp, 119 aa] {ON} Anc_2.16...    61   5e-11
TPHA0F01790 Chr6 (412270..412818) [549 bp, 182 aa] {ON} Anc_2.16...    63   6e-11
TBLA0B01310 Chr2 (276173..276544) [372 bp, 123 aa] {ON} Anc_2.16...    60   1e-10
CAGL0L03828g Chr12 (442660..443025) [366 bp, 121 aa] {ON} simila...    60   1e-10
NCAS0G02570 Chr7 complement(460218..460583) [366 bp, 121 aa] {ON...    60   1e-10
Kwal_26.8461 s26 (794482..794853) [372 bp, 123 aa] {ON} YNL111C ...    59   4e-10
KLTH0D09284g Chr4 (770560..770931) [372 bp, 123 aa] {ON} similar...    59   5e-10
SAKL0E10626g Chr5 (885272..885643) [372 bp, 123 aa] {ON} similar...    56   3e-09
KLLA0F27577g Chr6 (2556662..2557180) [519 bp, 172 aa] {ON} some ...    57   3e-09
ZYRO0B09812g Chr2 (765874..766425) [552 bp, 183 aa] {ON} similar...    58   3e-09
AFL223W Chr6 (19601..20098) [498 bp, 165 aa] {ON} Syntenic homol...    57   5e-09
Kwal_47.18167 s47 complement(716570..717253) [684 bp, 227 aa] {O...    58   6e-09
YNL111C Chr14 complement(416940..417302) [363 bp, 120 aa] {ON}  ...    55   7e-09
Smik_14.216 Chr14 complement(396585..396947) [363 bp, 120 aa] {O...    55   1e-08
SAKL0F08316g Chr6 complement(634949..635485) [537 bp, 178 aa] {O...    56   1e-08
KLTH0D06930g Chr4 complement(604805..605419) [615 bp, 204 aa] {O...    55   3e-08
TDEL0H02180 Chr8 (369539..370150) [612 bp, 203 aa] {ON}                55   5e-08
TDEL0D00190 Chr4 (29971..31629) [1659 bp, 552 aa] {ON}                 56   6e-08
KLTH0A04026g Chr1 complement(337200..337901) [702 bp, 233 aa] {O...    54   9e-08
KLLA0F23672g Chr6 (2212223..2212594) [372 bp, 123 aa] {ON} simil...    51   2e-07
KLTH0C11858g Chr3 (979073..980740) [1668 bp, 555 aa] {ON} simila...    53   6e-07
Ecym_5420 Chr5 (865505..865942) [438 bp, 145 aa] {ON} similar to...    50   8e-07
Kwal_23.2823 s23 (29032..30714) [1683 bp, 560 aa] {ON} YML054C (...    52   1e-06
ZYRO0B02090g Chr2 complement(169589..170173) [585 bp, 194 aa] {O...    50   1e-06
KLLA0D02640g Chr4 complement(225482..227251) [1770 bp, 589 aa] {...    52   1e-06
KNAG0E03860 Chr5 (763388..765202) [1815 bp, 604 aa] {ON} Anc_4.3...    52   1e-06
ADL085C Chr4 complement(535293..536114) [822 bp, 273 aa] {ON} NO...    51   2e-06
TPHA0B01820 Chr2 complement(406416..408146) [1731 bp, 576 aa] {O...    52   2e-06
ZYRO0C18524g Chr3 (1450641..1452305) [1665 bp, 554 aa] {ON} simi...    52   2e-06
KLTH0C11770g Chr3 (970979..972835) [1857 bp, 618 aa] {ON} simila...    51   2e-06
Ecym_4346 Chr4 (739106..739735) [630 bp, 209 aa] {ON} similar to...    50   2e-06
SAKL0G16852g Chr7 (1452894..1454636) [1743 bp, 580 aa] {ON} simi...    50   4e-06
NDAI0D04710 Chr4 (1106280..1108130) [1851 bp, 616 aa] {ON} Anc_4...    50   4e-06
Kpol_1014.5 s1014 complement(3107..4897) [1791 bp, 596 aa] {ON} ...    50   5e-06
KLLA0B14795g Chr2 (1299429..1301099) [1671 bp, 556 aa] {ON} simi...    50   5e-06
SAKL0F16610g Chr6 (1373674..1375368) [1695 bp, 564 aa] {ON} simi...    49   1e-05
NDAI0D04700 Chr4 (1103670..1105547) [1878 bp, 625 aa] {ON}             49   1e-05
KAFR0A04740 Chr1 (942850..944301) [1452 bp, 483 aa] {ON} Anc_6.1...    48   2e-05
ZYRO0D16654g Chr4 complement(1380316..1380888) [573 bp, 190 aa] ...    46   3e-05
NCAS0A02770 Chr1 (528814..530643) [1830 bp, 609 aa] {ON}               48   3e-05
ZYRO0B13728g Chr2 (1110636..1112432) [1797 bp, 598 aa] {ON} simi...    47   7e-05
YML054C Chr13 complement(165533..167308) [1776 bp, 591 aa] {ON} ...    46   1e-04
Smik_13.92 Chr13 complement(163135..164910) [1776 bp, 591 aa] {O...    46   1e-04
NCAS0F00870 Chr6 (177678..178247) [570 bp, 189 aa] {ON} Anc_2.53...    44   1e-04
CAGL0K03069g Chr11 complement(285190..285774) [585 bp, 194 aa] {...    44   2e-04
Skud_13.92 Chr13 complement(163654..165429) [1776 bp, 591 aa] {O...    45   2e-04
Suva_13.105 Chr13 complement(168279..170054) [1776 bp, 591 aa] {...    45   2e-04
Kwal_26.8046 s26 complement(621715..622311) [597 bp, 198 aa] {ON...    44   2e-04
CAGL0K10736g Chr11 (1046127..1047908) [1782 bp, 593 aa] {ON} hig...    45   2e-04
NCAS0A02780 Chr1 (531072..532880) [1809 bp, 602 aa] {ON} Anc_4.304     45   2e-04
TDEL0D01140 Chr4 complement(214858..216612) [1755 bp, 584 aa] {O...    45   3e-04
KNAG0C05780 Chr3 (1124591..1125133) [543 bp, 180 aa] {ON} Anc_2....    42   6e-04
KAFR0I00520 Chr9 complement(107239..108999) [1761 bp, 586 aa] {O...    42   0.002
KNAG0F03250 Chr6 complement(607667..609136) [1470 bp, 489 aa] {O...    42   0.003
SAKL0A09570g Chr1 complement(838406..839041) [636 bp, 211 aa] {O...    40   0.003
TBLA0I01530 Chr9 (334102..334767) [666 bp, 221 aa] {ON} Anc_2.53...    40   0.005
NDAI0H01370 Chr8 (336807..337481) [675 bp, 224 aa] {ON} Anc_2.536      40   0.007
Kwal_14.807 s14 complement(57218..58954) [1737 bp, 578 aa] {ON} ...    40   0.012
NDAI0I01620 Chr9 complement(382761..384086) [1326 bp, 441 aa] {O...    39   0.026
Kpol_348.12 s348 complement(21978..22631) [654 bp, 217 aa] {ON} ...    37   0.033
TDEL0A03110 Chr1 complement(554890..555492) [603 bp, 200 aa] {ON...    37   0.051
KAFR0A01890 Chr1 complement(392001..392486) [486 bp, 161 aa] {ON...    35   0.081
TPHA0G03550 Chr7 complement(755688..756344) [657 bp, 218 aa] {ON...    36   0.11 
CAGL0I00418g Chr9 (30058..31530) [1473 bp, 490 aa] {ON} highly s...    36   0.19 
Kpol_478.17 s478 (61375..62829) [1455 bp, 484 aa] {ON} (61375..6...    35   0.24 
KLLA0E18459g Chr5 (1641507..1641953) [447 bp, 148 aa] {ON} simil...    33   0.31 
Ecym_3080 Chr3 (149461..150900) [1440 bp, 479 aa] {ON} similar t...    35   0.35 
TBLA0C06220 Chr3 (1507690..1509174) [1485 bp, 494 aa] {ON}             35   0.40 
NCAS0D03250 Chr4 (608476..609969) [1494 bp, 497 aa] {ON} Anc_6.106     34   0.64 
SAKL0A07326g Chr1 (648420..649862) [1443 bp, 480 aa] {ON} unipro...    33   1.1  
AAR153C Chr1 complement(619953..621389) [1437 bp, 478 aa] {ON} S...    33   1.4  
SAKL0E08800g Chr5 complement(720729..721727) [999 bp, 332 aa] {O...    32   2.5  
Smik_13.252 Chr13 complement(396365..396970) [606 bp, 201 aa] {O...    31   3.2  
Skud_7.226 Chr7 (402118..403647) [1530 bp, 509 aa] {ON} YGL055W ...    32   3.2  
TDEL0G03650 Chr7 (673347..674798) [1452 bp, 483 aa] {ON} Anc_6.1...    31   4.3  
Kwal_23.5693 s23 (1277807..1279348) [1542 bp, 513 aa] {ON} YGL05...    31   5.2  
AAL078W Chr1 (209600..211378) [1779 bp, 592 aa] {ON} Non-synteni...    31   5.4  
KLTH0H06798g Chr8 (596966..598432) [1467 bp, 488 aa] {ON} unipro...    31   6.1  
Suva_13.250 Chr13 complement(393510..394115) [606 bp, 201 aa] {O...    30   8.1  
AFL079W Chr6 (290134..291750) [1617 bp, 538 aa] {ON} NOHBY604; N...    30   8.7  

>KLLA0D01639g Chr4 complement(146344..147489) [1146 bp, 381 aa] {ON}
           similar to uniprot|Q03529 Saccharomyces cerevisiae
           YMR272C SCS7 Required for the hydroxylation of the very
           long chain fatty acid (VLCFA) located in the endoplasmic
           reticulum desaturase/hydroxylase enzyme
          Length = 381

 Score =  693 bits (1788), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/381 (89%), Positives = 342/381 (89%)

Query: 1   MSSSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITD 60
           MSSSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITD
Sbjct: 1   MSSSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITD 60

Query: 61  VMKDVLTHEHSESAYEIMDESYLVGYLAXXXXXXXXXXNKDHVVEVNLKGNNEFDSTVFV 120
           VMKDVLTHEHSESAYEIMDESYLVGYLA          NKDHVVEVNLKGNNEFDSTVFV
Sbjct: 61  VMKDVLTHEHSESAYEIMDESYLVGYLATEEEEKKLLTNKDHVVEVNLKGNNEFDSTVFV 120

Query: 121 KELPTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGKGSA 180
           KELPTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGKGSA
Sbjct: 121 KELPTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGKGSA 180

Query: 181 PLFGNFLEPLSKTXXXXXXXXXXXXXTYHIYTALMNMNQAFAIFLFAVGVFVWTLIEYGL 240
           PLFGNFLEPLSKT             TYHIYTALMNMNQAFAIFLFAVGVFVWTLIEYGL
Sbjct: 181 PLFGNFLEPLSKTPWWMVPVVWLPVVTYHIYTALMNMNQAFAIFLFAVGVFVWTLIEYGL 240

Query: 241 HRFLFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVFALL 300
           HRFLFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVFALL
Sbjct: 241 HRFLFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVFALL 300

Query: 301 PYYWACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRXXXXXXXXXXXXXXXXGFGVTSWF 360
           PYYWACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMR                GFGVTSWF
Sbjct: 301 PYYWACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRKLKKYHLEHHYKNYELGFGVTSWF 360

Query: 361 WDKVFGTYLGENAPLSNMKYD 381
           WDKVFGTYLGENAPLSNMKYD
Sbjct: 361 WDKVFGTYLGENAPLSNMKYD 381

>SAKL0D01760g Chr4 (140050..141195) [1146 bp, 381 aa] {ON} similar
           to uniprot|Q03529 Saccharomyces cerevisiae YMR272C SCS7
           Required for the hydroxylation of the very long chain
           fatty acid (VLCFA) located in the endoplasmic reticulum
           desaturase/hydroxylase enzyme
          Length = 381

 Score =  581 bits (1497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/381 (73%), Positives = 308/381 (80%)

Query: 1   MSSSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITD 60
           MS S+ LPL SKT L +HN K DCWVSLY RK+YNVT FL+EHPGG +YILD+AG DIT+
Sbjct: 1   MSESKTLPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITE 60

Query: 61  VMKDVLTHEHSESAYEIMDESYLVGYLAXXXXXXXXXXNKDHVVEVNLKGNNEFDSTVFV 120
           +MKD L HEHSESAYEIM++ YLVGYLA          N+DH VEV L  + +FDST FV
Sbjct: 61  IMKDKLVHEHSESAYEIMNDMYLVGYLANEEEEKKLLTNEDHTVEVKLNESTQFDSTTFV 120

Query: 121 KELPTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGKGSA 180
           KELPTEDKLSIATDY +DYKKHKFLDL+KPLLWQV+FG FTKDFYLDQVHRPRHYGKGSA
Sbjct: 121 KELPTEDKLSIATDYSSDYKKHKFLDLDKPLLWQVVFGNFTKDFYLDQVHRPRHYGKGSA 180

Query: 181 PLFGNFLEPLSKTXXXXXXXXXXXXXTYHIYTALMNMNQAFAIFLFAVGVFVWTLIEYGL 240
           PLFGNFLEPLSKT              YH+Y AL NMN+ FA+FLF++GVFVWTLIEY L
Sbjct: 181 PLFGNFLEPLSKTPWYAIPIAWLPVVFYHLYVALTNMNKPFALFLFSLGVFVWTLIEYCL 240

Query: 241 HRFLFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVFALL 300
           HRFLFHLD  LPE+Q AF LHFLLHGVHHYLPMDR+RLVMPPTLFV+LCTPFYKLVF+LL
Sbjct: 241 HRFLFHLDQYLPERQLAFALHFLLHGVHHYLPMDRYRLVMPPTLFVLLCTPFYKLVFSLL 300

Query: 301 PYYWACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRXXXXXXXXXXXXXXXXGFGVTSWF 360
           PYYWACAGFAGGMLGY CYDLTHYFLHH++LPPYMR                GFGVTSWF
Sbjct: 301 PYYWACAGFAGGMLGYTCYDLTHYFLHHAKLPPYMRKLKKYHLEHHYKNYELGFGVTSWF 360

Query: 361 WDKVFGTYLGENAPLSNMKYD 381
           WDKVFGTYLG +APLS MKY+
Sbjct: 361 WDKVFGTYLGSDAPLSKMKYE 381

>KLTH0C04114g Chr3 (357195..358331) [1137 bp, 378 aa] {ON} highly
           similar to uniprot|Q03529 Saccharomyces cerevisiae
           YMR272C SCS7 Required for the hydroxylation of the very
           long chain fatty acid (VLCFA) located in the endoplasmic
           reticulum desaturase/hydroxylase enzyme
          Length = 378

 Score =  530 bits (1366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/379 (67%), Positives = 294/379 (77%), Gaps = 2/379 (0%)

Query: 3   SSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVM 62
            ++ LPLYS++ LE+HN ++DCWVSL+ RKIYNVT FLDEHPGGAE I +YAG D+T++M
Sbjct: 2   ETKTLPLYSQSQLEQHNTRDDCWVSLHHRKIYNVTSFLDEHPGGAELIEEYAGKDVTEIM 61

Query: 63  KDVLTHEHSESAYEIMDESYLVGYLAXXXXXXXXXXNKDHVVEVNLKGNNEFDSTVFVKE 122
           KD  THEHS  AYE++DE Y VGYLA          N +H VEV L+   ++DSTVFV E
Sbjct: 62  KDGPTHEHSYVAYEVLDEEYHVGYLATPEEEKKLLGNPEHPVEVKLE--EDYDSTVFVPE 119

Query: 123 LPTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGKGSAPL 182
           +P E+KLSI TDY  DY +HKFLDLN+PLL Q+L   F+K+FYLDQVHRPRHYG+GSAPL
Sbjct: 120 VPPEEKLSIVTDYTKDYGRHKFLDLNRPLLMQMLTSDFSKEFYLDQVHRPRHYGRGSAPL 179

Query: 183 FGNFLEPLSKTXXXXXXXXXXXXXTYHIYTALMNMNQAFAIFLFAVGVFVWTLIEYGLHR 242
           FGNFLEPLSKT              YH+YTAL NMN   A+FLF +GVFVWTLIEYGLHR
Sbjct: 180 FGNFLEPLSKTAWYVIPLVWFPVVVYHMYTALQNMNNVLAVFLFCLGVFVWTLIEYGLHR 239

Query: 243 FLFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVFALLPY 302
           FLFHLD  LP  Q A+T+HFLLHGVHHYLPMDR+RLVMPPTLFVVLCTPFYKLVFALLP 
Sbjct: 240 FLFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMPPTLFVVLCTPFYKLVFALLPK 299

Query: 303 YWACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRXXXXXXXXXXXXXXXXGFGVTSWFWD 362
           YWACAGFAGGM GY+CYDLTHYFLHH++LP YMR                GFGVTSWFWD
Sbjct: 300 YWACAGFAGGMFGYMCYDLTHYFLHHAKLPSYMRKLKKYHMEHHYKNYELGFGVTSWFWD 359

Query: 363 KVFGTYLGENAPLSNMKYD 381
           KVFGTYLG+NAPLS MK+D
Sbjct: 360 KVFGTYLGDNAPLSQMKFD 378

>YMR272C Chr13 complement(809623..810777) [1155 bp, 384 aa] {ON}
           SCS7Sphingolipid alpha-hydroxylase, functions in the
           alpha-hydroxylation of sphingolipid-associated very long
           chain fatty acids, has both cytochrome b5-like and
           hydroxylase/desaturase domains, not essential for growth
          Length = 384

 Score =  520 bits (1339), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/381 (66%), Positives = 287/381 (75%), Gaps = 1/381 (0%)

Query: 2   SSSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDV 61
           ++S+ L L+SK  +++HN  NDCWV+   RKIY+VT FL EHPGG E ILDYAG DIT++
Sbjct: 4   NTSKTLELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDITEI 63

Query: 62  MKDVLTHEHSESAYEIMDESYLVGYLAXXXXXXXXXXNKDHVVEVNLKGN-NEFDSTVFV 120
           MKD   HEHS+SAYEI+++ YL+GYLA          NK+H VEV L  +  EFDST FV
Sbjct: 64  MKDSDVHEHSDSAYEILEDEYLIGYLATDEEAARLLTNKNHKVEVQLSADGTEFDSTTFV 123

Query: 121 KELPTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGKGSA 180
           KELP E+KLSIATDY NDYKKHKFLDLN+PLL Q+L   F KDFY+DQ+HRPRHYGKGSA
Sbjct: 124 KELPAEEKLSIATDYSNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGKGSA 183

Query: 181 PLFGNFLEPLSKTXXXXXXXXXXXXXTYHIYTALMNMNQAFAIFLFAVGVFVWTLIEYGL 240
           PLFGNFLEPL+KT              YH+  AL NMNQ FA FLF VGVFVWTLIEYGL
Sbjct: 184 PLFGNFLEPLTKTAWWVVPVAWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLIEYGL 243

Query: 241 HRFLFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVFALL 300
           HRFLFH DD LPE   AF  HFLLHG HHYLPMD++RLVMPPTLFV+LC PFYKLVFALL
Sbjct: 244 HRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVFALL 303

Query: 301 PYYWACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRXXXXXXXXXXXXXXXXGFGVTSWF 360
           P YWA AGFAGG+ GYVCYD  H+FLHHS+LPP+MR                GFGVTSWF
Sbjct: 304 PLYWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVTSWF 363

Query: 361 WDKVFGTYLGENAPLSNMKYD 381
           WD+VFGTYLG +APLS MKY+
Sbjct: 364 WDEVFGTYLGPDAPLSKMKYE 384

>Smik_13.485 Chr13 complement(792640..793794) [1155 bp, 384 aa] {ON}
           YMR272C (REAL)
          Length = 384

 Score =  519 bits (1336), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/381 (66%), Positives = 287/381 (75%), Gaps = 1/381 (0%)

Query: 2   SSSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDV 61
           ++S+ L L+SK  +EKHN   DCWV+   RKIY+VT+FL EHPGG E ILDYAG DIT+V
Sbjct: 4   NTSKTLELFSKKTVEKHNTAKDCWVTYQNRKIYDVTKFLSEHPGGDESILDYAGKDITEV 63

Query: 62  MKDVLTHEHSESAYEIMDESYLVGYLAXXXXXXXXXXNKDHVVEVNLKGN-NEFDSTVFV 120
           MKD   HEHS+SAYEI+++ YL+GYLA          NK+H VEV L  +  EFDST FV
Sbjct: 64  MKDTDVHEHSDSAYEILEDEYLIGYLATDEEAARLLTNKNHKVEVQLSSDGTEFDSTTFV 123

Query: 121 KELPTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGKGSA 180
           K+LP E+KLSIATDY NDYKKHKFLDLN+PLL Q+L   F KDFY+DQ+HRPRHYGKGSA
Sbjct: 124 KDLPAEEKLSIATDYGNDYKKHKFLDLNRPLLMQILCSDFKKDFYVDQIHRPRHYGKGSA 183

Query: 181 PLFGNFLEPLSKTXXXXXXXXXXXXXTYHIYTALMNMNQAFAIFLFAVGVFVWTLIEYGL 240
           PLFGNFLEPL+KT              YH+  AL NMNQ FA FLF VGVFVWTLIEYGL
Sbjct: 184 PLFGNFLEPLTKTAWWVVPTAWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLIEYGL 243

Query: 241 HRFLFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVFALL 300
           HRFLFH DD LPE   AF  HFLLHG HHYLPMD++RLVMPPTLFV+LC PFYKLVFALL
Sbjct: 244 HRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVFALL 303

Query: 301 PYYWACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRXXXXXXXXXXXXXXXXGFGVTSWF 360
           P YWA AGFAGG+ GYVCYD  H+FLHHS+LPP+MR                GFGVTSWF
Sbjct: 304 PLYWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVTSWF 363

Query: 361 WDKVFGTYLGENAPLSNMKYD 381
           WD+VFGTYLG +APLS MKY+
Sbjct: 364 WDEVFGTYLGPDAPLSKMKYE 384

>ZYRO0G13948g Chr7 complement(1109941..1111095) [1155 bp, 384 aa]
           {ON} similar to uniprot|Q03529 Saccharomyces cerevisiae
           YMR272C SCS7 Required for the hydroxylation of the very
           long chain fatty acid (VLCFA) located in the endoplasmic
           reticulum desaturase/hydroxylase enzyme
          Length = 384

 Score =  516 bits (1328), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/382 (66%), Positives = 291/382 (76%), Gaps = 2/382 (0%)

Query: 2   SSSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDV 61
           + S  L L+S+  L KHN++ DCWVS+YQRKIYNVTEFLDEHPGGAEYIL YAG DIT+V
Sbjct: 3   TKSPTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEV 62

Query: 62  MKDVLTHEHSESAYEIMDESYLVGYLAXXXXXXXXXXNKDHVVEVNL--KGNNEFDSTVF 119
           +KD   HEHSESAYEI+D++YLVGYLA          NK H VEV+L  + N++FDST F
Sbjct: 63  LKDRDVHEHSESAYEILDDNYLVGYLATKEEATKLLTNKKHQVEVHLTDQNNSDFDSTTF 122

Query: 120 VKELPTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGKGS 179
           V ELP E+KL+IATDY  DYKKHKFLDLN+ LL QV+FG F+KDFYLDQVHRPRHYGKGS
Sbjct: 123 VPELPAEEKLNIATDYGRDYKKHKFLDLNRALLPQVMFGNFSKDFYLDQVHRPRHYGKGS 182

Query: 180 APLFGNFLEPLSKTXXXXXXXXXXXXXTYHIYTALMNMNQAFAIFLFAVGVFVWTLIEYG 239
           APLFGNFLEP+SKT             ++H Y    NMN+ F+ FLF +G+FVWTLIEY 
Sbjct: 183 APLFGNFLEPISKTPWWAIPIIWIPVVSFHFYVGFTNMNKLFSTFLFCLGIFVWTLIEYC 242

Query: 240 LHRFLFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVFAL 299
           LHRFLFHLD+ LP+   A TLHFLLHGVHHYLPMDR+RLVMPPTL +VL  P YK VF L
Sbjct: 243 LHRFLFHLDEWLPDNNAALTLHFLLHGVHHYLPMDRYRLVMPPTLGIVLMAPIYKTVFGL 302

Query: 300 LPYYWACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRXXXXXXXXXXXXXXXXGFGVTSW 359
           LP YWA +GFAGG+ GYVCYDLTHYFLHH++LP YMR                GFGVTSW
Sbjct: 303 LPTYWAYSGFAGGLFGYVCYDLTHYFLHHAKLPSYMRKLKKYHLEHHYKNYQLGFGVTSW 362

Query: 360 FWDKVFGTYLGENAPLSNMKYD 381
           FWD VFGTYLG +APL++MKYD
Sbjct: 363 FWDNVFGTYLGPDAPLAHMKYD 384

>Kwal_27.10332 s27 (289484..290620) [1137 bp, 378 aa] {ON} YMR272C
           (SCS7) - desaturase/hydroxylase enzyme [contig 36] FULL
          Length = 378

 Score =  514 bits (1325), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 247/379 (65%), Positives = 291/379 (76%), Gaps = 2/379 (0%)

Query: 3   SSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVM 62
            ++ LPLYS + +++HN  +DCWV+L  RKIY+VT+FL++HPGG + I++YAG DIT+VM
Sbjct: 2   ETKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVM 61

Query: 63  KDVLTHEHSESAYEIMDESYLVGYLAXXXXXXXXXXNKDHVVEVNLKGNNEFDSTVFVKE 122
           KD   H HS  AYE++DE Y VGYLA          N  H VEV L+  +E+DSTVFV E
Sbjct: 62  KDGPLHSHSFVAYEVLDEEYHVGYLATAEEEQKLLGNSKHKVEVKLE--DEYDSTVFVPE 119

Query: 123 LPTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGKGSAPL 182
           +P E+KLSI TDY  DY +HKFLDLN+PLL Q+L   FTK+FYLDQVHRPRHYG+GSAPL
Sbjct: 120 VPAEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRGSAPL 179

Query: 183 FGNFLEPLSKTXXXXXXXXXXXXXTYHIYTALMNMNQAFAIFLFAVGVFVWTLIEYGLHR 242
           FGNFLEPLSKT              YHI+TA+ NMN+ FA+FLF VG+FVWTLIEYG+HR
Sbjct: 180 FGNFLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEYGMHR 239

Query: 243 FLFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVFALLPY 302
           FLFHLD  LP  Q A+T+HFLLHGVHHYLPMDR+RLVMPPTLF++LCTPFYKLVFALLPY
Sbjct: 240 FLFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMPPTLFLLLCTPFYKLVFALLPY 299

Query: 303 YWACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRXXXXXXXXXXXXXXXXGFGVTSWFWD 362
           YWACAGFAGGMLGYVCYDLTHYFLHH++LP  ++                GFGVTSW WD
Sbjct: 300 YWACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTSWVWD 359

Query: 363 KVFGTYLGENAPLSNMKYD 381
           KVFGTYL ENAPLS MK+D
Sbjct: 360 KVFGTYLAENAPLSQMKFD 378

>Suva_13.460 Chr13 complement(792221..793375) [1155 bp, 384 aa] {ON}
           YMR272C (REAL)
          Length = 384

 Score =  514 bits (1324), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/381 (65%), Positives = 285/381 (74%), Gaps = 1/381 (0%)

Query: 2   SSSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDV 61
           ++S+ L L+SK  +E+HN   DCWV+   RKIY+VT+FL EHPGG E ILDYAG DIT+V
Sbjct: 4   NTSKTLELFSKKTVEEHNTAKDCWVTYQNRKIYDVTKFLSEHPGGEESILDYAGKDITEV 63

Query: 62  MKDVLTHEHSESAYEIMDESYLVGYLAXXXXXXXXXXNKDHVVEVNLKGN-NEFDSTVFV 120
           MKD   HEHSESAYEI+++ YLVGYLA          NK+H VEV L  +  EFDST FV
Sbjct: 64  MKDSDVHEHSESAYEILEDEYLVGYLATDEEATRLLTNKNHKVEVQLSADGTEFDSTTFV 123

Query: 121 KELPTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGKGSA 180
           K+LPTE+KLSIATDY +DYKKHKFLDLNKPLL Q+L   FT+DFY+DQ+HRPRHYGKGSA
Sbjct: 124 KDLPTEEKLSIATDYGSDYKKHKFLDLNKPLLMQILRSDFTRDFYVDQIHRPRHYGKGSA 183

Query: 181 PLFGNFLEPLSKTXXXXXXXXXXXXXTYHIYTALMNMNQAFAIFLFAVGVFVWTLIEYGL 240
           PLFGNFLEPL+KT              YH+  AL NMN  FA FLF VG+FVWTLIEY L
Sbjct: 184 PLFGNFLEPLTKTAWWVVPVAWVPVVVYHMGVALKNMNPLFACFLFGVGMFVWTLIEYSL 243

Query: 241 HRFLFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVFALL 300
           HRFLFH DD LPE   AF  HFLLHG HHYLPMD +RLVMPP+LFV+LC PFYKLVFALL
Sbjct: 244 HRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDGYRLVMPPSLFVILCAPFYKLVFALL 303

Query: 301 PYYWACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRXXXXXXXXXXXXXXXXGFGVTSWF 360
           P YWA AGFAGG+ GYVCYD  HYF+HHS+LPP+MR                GFGVTSWF
Sbjct: 304 PLYWAYAGFAGGLFGYVCYDECHYFIHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVTSWF 363

Query: 361 WDKVFGTYLGENAPLSNMKYD 381
           WD VFGTYLG +APLS MKY+
Sbjct: 364 WDDVFGTYLGPDAPLSKMKYE 384

>Skud_13.444 Chr13 complement(783092..784246) [1155 bp, 384 aa] {ON}
           YMR272C (REAL)
          Length = 384

 Score =  514 bits (1324), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/381 (65%), Positives = 286/381 (75%), Gaps = 1/381 (0%)

Query: 2   SSSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDV 61
           ++S+ L L+S+  +E+HN   DCWV+   RKIY+VT+FL EHPGG E ILDYAG D+T++
Sbjct: 4   NTSKTLELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEI 63

Query: 62  MKDVLTHEHSESAYEIMDESYLVGYLAXXXXXXXXXXNKDHVVEVNLKGN-NEFDSTVFV 120
           MKD   HEHS+SAYEI+++ YL+GYLA          NK H VEV L  +  EFDST FV
Sbjct: 64  MKDSDVHEHSDSAYEILEDEYLIGYLATDEEATRLLTNKSHKVEVQLSADGKEFDSTTFV 123

Query: 121 KELPTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGKGSA 180
           K LPTE+KLSIATDY NDYKKHKFLDLN+PLL Q+L   F KDFY+DQ+HRPRHYGKGSA
Sbjct: 124 KNLPTEEKLSIATDYGNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGKGSA 183

Query: 181 PLFGNFLEPLSKTXXXXXXXXXXXXXTYHIYTALMNMNQAFAIFLFAVGVFVWTLIEYGL 240
           PLFGNFLEPL+KT              YH+  AL NMNQ FA FLF VGVFVWTLIEYGL
Sbjct: 184 PLFGNFLEPLTKTAWWVVPLPWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLIEYGL 243

Query: 241 HRFLFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVFALL 300
           HRFLFH DD LPE   AF  HFLLHG HHYLPMD++RLVMPPTLFV+LC PFYKLVFALL
Sbjct: 244 HRFLFHFDDWLPESNVAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVFALL 303

Query: 301 PYYWACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRXXXXXXXXXXXXXXXXGFGVTSWF 360
           P YWA AGFAGG+ GYVCYD  H+FLHHS+LPP+MR                GFGVTSWF
Sbjct: 304 PLYWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVTSWF 363

Query: 361 WDKVFGTYLGENAPLSNMKYD 381
           WD+VFGTYLG +APLS MKY+
Sbjct: 364 WDEVFGTYLGPDAPLSKMKYE 384

>TDEL0B00680 Chr2 (128650..129801) [1152 bp, 383 aa] {ON} Anc_8.829
           YMR272C
          Length = 383

 Score =  513 bits (1322), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/380 (66%), Positives = 284/380 (74%), Gaps = 2/380 (0%)

Query: 3   SSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVM 62
            S+ L L+S+  + +HN+ NDCWV++  RKIY+VT+FLDEHPGG +YILDYAG DIT+V+
Sbjct: 5   QSKTLELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVL 64

Query: 63  KDVLTHEHSESAYEIM-DESYLVGYLAXXXXXXXXXXNKDHVVEVNLKGNNEFDSTVFVK 121
           KD   HEHSESAYEI+ D SYLVGY+A          N  H VEV L    +FDST FVK
Sbjct: 65  KDSTIHEHSESAYEILEDSSYLVGYMATELEEKELLTNSSHKVEVKL-ATLDFDSTTFVK 123

Query: 122 ELPTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGKGSAP 181
           +LPTE+KLSIATDY  DYK+H FLDL KPLL QV+FGKFTKDFY+DQ+HRPRHYGKGSAP
Sbjct: 124 DLPTEEKLSIATDYSRDYKRHHFLDLQKPLLPQVMFGKFTKDFYVDQIHRPRHYGKGSAP 183

Query: 182 LFGNFLEPLSKTXXXXXXXXXXXXXTYHIYTALMNMNQAFAIFLFAVGVFVWTLIEYGLH 241
           LFGNFLEPLSKT              YH+  A  NMN  F IF F +G FVWTLIEYGLH
Sbjct: 184 LFGNFLEPLSKTSWYVIPMVWLPVVLYHVGVAFKNMNPIFTIFFFCLGTFVWTLIEYGLH 243

Query: 242 RFLFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVFALLP 301
           RFLFH DD LPE    FTLHFLLHGVHHYLPMD++RLVMPPTLFV+LCTPFYKLVF LLP
Sbjct: 244 RFLFHFDDWLPESNVCFTLHFLLHGVHHYLPMDKYRLVMPPTLFVILCTPFYKLVFGLLP 303

Query: 302 YYWACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRXXXXXXXXXXXXXXXXGFGVTSWFW 361
            Y A AGFAGG+ GYVCYDLTHYFLHHS+LP +MR                GFGVTSWFW
Sbjct: 304 LYVAYAGFAGGLFGYVCYDLTHYFLHHSKLPSFMRKLKKYHLEHHYKNYQLGFGVTSWFW 363

Query: 362 DKVFGTYLGENAPLSNMKYD 381
           DKVFGTYL   +P+S MKYD
Sbjct: 364 DKVFGTYLSPTSPISQMKYD 383

>AAL183W Chr1 (13713..14846) [1134 bp, 377 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YMR272C (SCS7)
          Length = 377

 Score =  491 bits (1265), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 237/376 (63%), Positives = 275/376 (73%), Gaps = 3/376 (0%)

Query: 4   SRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMK 63
           S+ LPLYSK  L+KH D+  CWVS+  RKIY+V++FLDEHPGG +YILDYAG DIT V+K
Sbjct: 3   SKTLPLYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAVLK 62

Query: 64  DVLTHEHSESAYEIMDESYLVGYLAXXXXXXXXXXNKDHVVEVNLKGNNEFDSTVFVKEL 123
           D L HEH+E+AYEI+DESYLVGYLA          N+ HV+EV        D+T FVKEL
Sbjct: 63  DKLIHEHTEAAYEILDESYLVGYLATEEEEIKLLTNEKHVMEVT---PENLDTTTFVKEL 119

Query: 124 PTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGKGSAPLF 183
           P E+ LS+ATD+  DY KH FLDLNKPLL QVL G FT+DFY+DQ+HRPRHYGKGSAPLF
Sbjct: 120 PAEEVLSVATDFGTDYTKHHFLDLNKPLLMQVLRGNFTRDFYIDQIHRPRHYGKGSAPLF 179

Query: 184 GNFLEPLSKTXXXXXXXXXXXXXTYHIYTALMNMNQAFAIFLFAVGVFVWTLIEYGLHRF 243
           GNFLEPLSKT              Y++  AL NM    A+  FA GVFVWTLIEY LHRF
Sbjct: 180 GNFLEPLSKTVWWVVPMVWYPVVLYYLTRALQNMPAHLALTCFAAGVFVWTLIEYSLHRF 239

Query: 244 LFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVFALLPYY 303
           LFH DD +PE   AFT+HFLLHGVHHYLPMD++RLVMPP LFVVLC PFY+LVF++ P Y
Sbjct: 240 LFHFDDNMPESNIAFTVHFLLHGVHHYLPMDKYRLVMPPALFVVLCAPFYRLVFSIFPEY 299

Query: 304 WACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRXXXXXXXXXXXXXXXXGFGVTSWFWDK 363
            AC  FAGG+ GYVCYD+THYFLHH +LPP+MR                GFGVTSW+WDK
Sbjct: 300 CACGCFAGGLFGYVCYDVTHYFLHHHKLPPFMRKLKKYHLEHHYKNYELGFGVTSWYWDK 359

Query: 364 VFGTYLGENAPLSNMK 379
           VFGTYL  N+P+S  K
Sbjct: 360 VFGTYLASNSPVSRPK 375

>Ecym_2712 Chr2 (1378070..1379215) [1146 bp, 381 aa] {ON} similar to
           Ashbya gossypii AAL183W
          Length = 381

 Score =  487 bits (1253), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 234/380 (61%), Positives = 284/380 (74%), Gaps = 1/380 (0%)

Query: 2   SSSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDV 61
           SS + LPLYSK++ EKH   N CWVS+ QRKIYNV++FLDE+P G +Y+LD+AG D+T +
Sbjct: 3   SSCKTLPLYSKSEFEKHVKPNQCWVSIDQRKIYNVSKFLDENPEGYQYVLDHAGQDVTQL 62

Query: 62  MKDVLTHEHSESAYEIMDESYLVGYLAXXXXXXXXXXNKDHVVEVNLKGNNEFDSTVFVK 121
           +KD+ T E ++ A++++ ++YL+GYLA          N +HVVEV     N  DS  FVK
Sbjct: 63  LKDMQTDEPTDLAHQLLSDAYLIGYLATSEEERKLLTNANHVVEVKPANGNRVDSG-FVK 121

Query: 122 ELPTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGKGSAP 181
           +LPTE+KL+IATD++ DY+KH FLDL+KPL  QVLFG FTK+FY+DQVHRPRHYGK SAP
Sbjct: 122 KLPTEEKLAIATDFKTDYEKHHFLDLDKPLFMQVLFGNFTKEFYIDQVHRPRHYGKESAP 181

Query: 182 LFGNFLEPLSKTXXXXXXXXXXXXXTYHIYTALMNMNQAFAIFLFAVGVFVWTLIEYGLH 241
           LFGNFLEPLSKT              Y+I TAL+N++   A+FLF VGVFVWTLIEYGLH
Sbjct: 182 LFGNFLEPLSKTSWWVIPIVWYPCVIYYIRTALLNISTPLALFLFGVGVFVWTLIEYGLH 241

Query: 242 RFLFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVFALLP 301
           RFLFH DDR+PE    FTLHFLLHG+HHYLPMD++RLVMPP LF+ LC PFYKLVF++LP
Sbjct: 242 RFLFHFDDRMPESNIVFTLHFLLHGIHHYLPMDKYRLVMPPALFLALCYPFYKLVFSILP 301

Query: 302 YYWACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRXXXXXXXXXXXXXXXXGFGVTSWFW 361
           YY ACAGFAGG+ GYV YD+THYFLHH +LPP+MR                GFGVTSW+W
Sbjct: 302 YYCACAGFAGGLFGYVGYDVTHYFLHHRKLPPFMRKLKKYHLEHHYKNYELGFGVTSWYW 361

Query: 362 DKVFGTYLGENAPLSNMKYD 381
           DKVF TYL   APLS  KYD
Sbjct: 362 DKVFNTYLSPTAPLSRAKYD 381

>NCAS0C00470 Chr3 (78059..79339) [1281 bp, 426 aa] {ON} Anc_8.829
          Length = 426

 Score =  479 bits (1233), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 231/383 (60%), Positives = 279/383 (72%), Gaps = 7/383 (1%)

Query: 1   MSS--SRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDI 58
           MSS  S+ L L+SK  + KHN + DCWV++Y RKIY+V++FL +HP G + IL +AG DI
Sbjct: 47  MSSNVSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDI 106

Query: 59  TDVMKDVLTHEHSESAYEIMDESYLVGYLAXXXXXXXXXXNKDHVVEVNL-KGNNEFDST 117
           T+++KD    E  +   +++D+ YL+GY+A          NKDH VEV L +  N FDST
Sbjct: 107 TELLKD----EKIDQQTDLLDDQYLIGYMATDAEEEKLLTNKDHKVEVKLNESTNTFDST 162

Query: 118 VFVKELPTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGK 177
            FVK+LPTEDKLSIATDY+ D KKH FLDLNKPLL Q+LFG FTKDFYLDQ+HRPRHYG+
Sbjct: 163 TFVKDLPTEDKLSIATDYEKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGQ 222

Query: 178 GSAPLFGNFLEPLSKTXXXXXXXXXXXXXTYHIYTALMNMNQAFAIFLFAVGVFVWTLIE 237
            SAPLFGNFLEP +KT              YHI  A  N+N  FAI LF +GV+VWT IE
Sbjct: 223 ESAPLFGNFLEPFTKTAWYLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTFIE 282

Query: 238 YGLHRFLFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVF 297
           Y +HRFLFH D+RLPE  +A+ +HFLLHG HHYLPMD++RLV+PP LF+ LC PFYKLVF
Sbjct: 283 YCMHRFLFHFDERLPEHNFAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYKLVF 342

Query: 298 ALLPYYWACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRXXXXXXXXXXXXXXXXGFGVT 357
           ALLPYYWACAGFAGGM GY+CYDL HYFLHHS+LPP+MR                G+GVT
Sbjct: 343 ALLPYYWACAGFAGGMFGYICYDLCHYFLHHSKLPPFMRKLKKYHLEHHYKNYQLGYGVT 402

Query: 358 SWFWDKVFGTYLGENAPLSNMKY 380
           SW+WDK FGTYL  ++PLS MKY
Sbjct: 403 SWYWDKKFGTYLSPDSPLSKMKY 425

>CAGL0F03399g Chr6 complement(333955..335097) [1143 bp, 380 aa] {ON}
           highly similar to uniprot|Q03529 Saccharomyces
           cerevisiae YMR272c SCS7 required for hydroxylation of
           ceramide
          Length = 380

 Score =  469 bits (1206), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 235/383 (61%), Positives = 273/383 (71%), Gaps = 13/383 (3%)

Query: 3   SSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYI---LDYA-GTDI 58
           SS+ L L+ ++ L KHN K+DCWVS ++RKIY+V+++L +HP  A+ +   LD   GTDI
Sbjct: 7   SSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGTDI 66

Query: 59  TDVMKDVLTHEHSESAYEIMDESYLVGYLAXXXXXXXXXXNKDHVVEVNLKGNNEFDSTV 118
           + +    L         + + + YLVGYLA          NK H VEV L  +N FDST 
Sbjct: 67  SQMELTTL---------KFVTDDYLVGYLATSDEEKKLLTNKSHKVEVKLNADNTFDSTT 117

Query: 119 FVKELPTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGKG 178
           FVK+LPTEDKLSI TDY+ DYKKHKFLDLNKPLL Q+LFG FTKDFYLDQ+HRPRHYGKG
Sbjct: 118 FVKDLPTEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGKG 177

Query: 179 SAPLFGNFLEPLSKTXXXXXXXXXXXXXTYHIYTALMNMNQAFAIFLFAVGVFVWTLIEY 238
           SAPLFGNFLE  +KT              Y I TALMNMN   A+FLF +G+FVWTLIEY
Sbjct: 178 SAPLFGNFLEAFTKTAWWVVPTVWGPVVLYFITTALMNMNNPLALFLFGLGIFVWTLIEY 237

Query: 239 GLHRFLFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVFA 298
            LHRFLFH D+ LPE    F +HFLLHG HHYLPMD +RLV+PP LFVVLC P YKLVFA
Sbjct: 238 CLHRFLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKLVFA 297

Query: 299 LLPYYWACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRXXXXXXXXXXXXXXXXGFGVTS 358
            LPYYWACAGFAGGMLGY+CYDL HYFLHHS++PP+MR                GFGVTS
Sbjct: 298 ALPYYWACAGFAGGMLGYICYDLCHYFLHHSKMPPFMRKLKKYHLEHHYKNYQLGFGVTS 357

Query: 359 WFWDKVFGTYLGENAPLSNMKYD 381
           WFWDKVFGTYLG +APLS MKY+
Sbjct: 358 WFWDKVFGTYLGPDAPLSKMKYE 380

>NDAI0K00470 Chr11 (107509..108669) [1161 bp, 386 aa] {ON} Anc_8.829
          Length = 386

 Score =  450 bits (1157), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 219/384 (57%), Positives = 274/384 (71%), Gaps = 3/384 (0%)

Query: 1   MSSSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGA--EYILDYAGTDI 58
           +++S+ L L+SK  +  HN  +DCW++   RKIY+VT+FL+++P  A  + +L++AG DI
Sbjct: 3   INTSKTLELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDI 62

Query: 59  TDVMKDVLTHEHSESAYEIMDESYLVGYLAXXXXXXXXXXNKDHVVEVNL-KGNNEFDST 117
           TD +KD +    + S   +  + YL+GYLA          NKDH VEV L +  N FDST
Sbjct: 63  TDELKDKIDSIKNPSFPILQTDQYLIGYLATDHEEKTLLTNKDHKVEVQLNEATNGFDST 122

Query: 118 VFVKELPTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGK 177
            FVK+LPTEDKLSIATD + D +KHKFLDL+KPLL Q+LFG FTKDFYLDQ+HRPRHYG 
Sbjct: 123 TFVKDLPTEDKLSIATDTKKDLEKHKFLDLDKPLLKQILFGNFTKDFYLDQIHRPRHYGD 182

Query: 178 GSAPLFGNFLEPLSKTXXXXXXXXXXXXXTYHIYTALMNMNQAFAIFLFAVGVFVWTLIE 237
            SAPLFGN LEPL+KT              YHI  AL NMN  FAI LFA+G++VWTLIE
Sbjct: 183 KSAPLFGNILEPLTKTSWYLVPIFWLPVVFYHIAVALTNMNPIFAIVLFAIGIYVWTLIE 242

Query: 238 YGLHRFLFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVF 297
           Y +HRFLFH D+RLPE    + +HFLLHG HHYLPMD++RLV+PPTLF+ LC PFYK+VF
Sbjct: 243 YCMHRFLFHFDERLPEHNIFYVIHFLLHGCHHYLPMDKYRLVVPPTLFIFLCFPFYKVVF 302

Query: 298 ALLPYYWACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRXXXXXXXXXXXXXXXXGFGVT 357
            LLP YWA AGFAGG+ GYVCYDL HYFLHHS++PP +R                G+GVT
Sbjct: 303 KLLPLYWAYAGFAGGLFGYVCYDLCHYFLHHSKMPPPLRKLKKYHLEHHYKNYQLGYGVT 362

Query: 358 SWFWDKVFGTYLGENAPLSNMKYD 381
           SW+WDK+FGTYL  ++P+S MKY+
Sbjct: 363 SWYWDKIFGTYLSPDSPMSKMKYE 386

>KNAG0J00320 Chr10 (50267..51388) [1122 bp, 373 aa] {ON} Anc_8.829
           YMR272C
          Length = 373

 Score =  441 bits (1133), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 221/380 (58%), Positives = 263/380 (69%), Gaps = 9/380 (2%)

Query: 2   SSSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDV 61
           S+SR L L SK  +  HN KND WV +  RK+ +++ ++ E P   E +L  AG DITD 
Sbjct: 3   SNSRTLELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDITD- 61

Query: 62  MKDVLTHEHSESAYEIMDESYLVGYLAXXXXXXXXXXNKDHVVEVNLKGNNEFDSTVFVK 121
                    S     +  + +LVGYLA          NKDH VEV L+G   FDS+ FVK
Sbjct: 62  --------RSHEFPGLNADDHLVGYLATDLEEKELLSNKDHKVEVKLEGGETFDSSTFVK 113

Query: 122 ELPTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGKGSAP 181
           +LPTEDKLSIATD + DY+KH FLDL KPL+ QVLFG FTKDFY+DQ+HRPRHYGKGSAP
Sbjct: 114 DLPTEDKLSIATDTKRDYQKHHFLDLEKPLIPQVLFGSFTKDFYVDQIHRPRHYGKGSAP 173

Query: 182 LFGNFLEPLSKTXXXXXXXXXXXXXTYHIYTALMNMNQAFAIFLFAVGVFVWTLIEYGLH 241
           LFGNFLEP+SKT              Y +  +L  ++  FA+ LFA+G FVWTLIEY +H
Sbjct: 174 LFGNFLEPISKTAWYVVPIVWGPVVLYFLGRSLKGIHPIFALMLFALGGFVWTLIEYCMH 233

Query: 242 RFLFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVFALLP 301
           RFLFH DD LPE   AFT+HFLLHGVHHYLPMD +RLV+PP LFVVLCTPFYKLVF LLP
Sbjct: 234 RFLFHFDDWLPENNVAFTIHFLLHGVHHYLPMDGYRLVVPPALFVVLCTPFYKLVFKLLP 293

Query: 302 YYWACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRXXXXXXXXXXXXXXXXGFGVTSWFW 361
           +Y ACAGFAGGM GY+CYDL HYFLHHS++P +MR                GFGV++WFW
Sbjct: 294 HYVACAGFAGGMFGYICYDLIHYFLHHSKMPKFMRKLKQYHLEHHYKNYQLGFGVSNWFW 353

Query: 362 DKVFGTYLGENAPLSNMKYD 381
           DKVF TYLG++AP+S MKYD
Sbjct: 354 DKVFDTYLGKDAPISPMKYD 373

>Kpol_541.9 s541 complement(23399..24523) [1125 bp, 374 aa] {ON}
           complement(23399..24523) [1125 nt, 375 aa]
          Length = 374

 Score =  439 bits (1128), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 215/379 (56%), Positives = 268/379 (70%), Gaps = 9/379 (2%)

Query: 2   SSSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDV 61
             S+ L L++K+  E+HN + DCWVS+ +R IY+V+ +L ++      IL++AG DIT +
Sbjct: 4   KDSKTLELFAKSRFEEHNTEADCWVSVKERLIYDVSSYLKDNADADSSILEHAGKDITKL 63

Query: 62  MKDVLTHEHSESAYEIMDESYLVGYLAXXXXXXXXXXNKDHVVEVNLKGNNEFDSTVFVK 121
            K           ++ + + YLVGYLA          NKDH VEVNL+ +  +DSTVFVK
Sbjct: 64  TK--------TREFKFISDEYLVGYLATEEEEVRLLTNKDHKVEVNLQ-DGTYDSTVFVK 114

Query: 122 ELPTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGKGSAP 181
           ELP E+K ++ATD   D++ H FLDLNKP+LWQVLFG FT+DFY+DQVHRPRHYGKGSAP
Sbjct: 115 ELPAEEKFTVATDLGKDFQDHHFLDLNKPMLWQVLFGNFTRDFYIDQVHRPRHYGKGSAP 174

Query: 182 LFGNFLEPLSKTXXXXXXXXXXXXXTYHIYTALMNMNQAFAIFLFAVGVFVWTLIEYGLH 241
           LFGNFLEP+S T              YH+  AL NMN  FA FLF +G+FVWTLIEY LH
Sbjct: 175 LFGNFLEPISLTPWWLIPIIWGPVVVYHLSVALNNMNNIFAGFLFCLGIFVWTLIEYCLH 234

Query: 242 RFLFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVFALLP 301
           RFLFHLDD +P+    +TLHFLLHGVHHYLPMD++RLV+PP LF+VLCTP YKLVF LLP
Sbjct: 235 RFLFHLDDWVPQHNIFYTLHFLLHGVHHYLPMDQYRLVVPPALFLVLCTPIYKLVFGLLP 294

Query: 302 YYWACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRXXXXXXXXXXXXXXXXGFGVTSWFW 361
            YWA AGFAGG+LGY+CYDLTHYF+HH +LP +MR                GFGV+++FW
Sbjct: 295 LYWAYAGFAGGLLGYICYDLTHYFIHHVKLPKFMRKVKKHHLEHHYKNYQLGFGVSNYFW 354

Query: 362 DKVFGTYLGENAPLSNMKY 380
           DKVFGTYLG ++P S M+Y
Sbjct: 355 DKVFGTYLGPDSPASIMRY 373

>KAFR0B03850 Chr2 complement(796399..797532) [1134 bp, 377 aa] {ON}
           Anc_8.829 YMR272C
          Length = 377

 Score =  428 bits (1100), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 213/382 (55%), Positives = 267/382 (69%), Gaps = 6/382 (1%)

Query: 1   MSSSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITD 60
           M++++ L L+SK ++  H  + DCWV+++ RKIY+VT+FLDE+      +LDYAGTDITD
Sbjct: 1   MTTAKTLELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITD 60

Query: 61  VMKDVLTHEHSESAYEIMDESYLVGYLAXXXXXXXXXXNKDHVVEVNLKGNNEFDSTVFV 120
              +++  +  E    + +++YLVGY+A          NKDH VEV L+   +FD    V
Sbjct: 61  ---ELVNGKLDEKYKALDNDNYLVGYVATADEEQKLLTNKDHKVEVTLE--QDFDLATLV 115

Query: 121 KELPTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGKGSA 180
            ELP E+KL+IAT+Y  D+KKHKFLDLNKPLL Q+L GKFT++FY+DQ++RPRHYG+ SA
Sbjct: 116 VELPPEEKLTIATNYDRDFKKHKFLDLNKPLLPQILKGKFTREFYVDQINRPRHYGQKSA 175

Query: 181 PLFGN-FLEPLSKTXXXXXXXXXXXXXTYHIYTALMNMNQAFAIFLFAVGVFVWTLIEYG 239
           PLFGN FLEP SKT              +    AL NMN   A+FLF VGVFVWTL+EY 
Sbjct: 176 PLFGNAFLEPFSKTAWWVVPTFWLPVVFHFFRVALKNMNNPLALFLFCVGVFVWTLLEYC 235

Query: 240 LHRFLFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVFAL 299
           LHRFLFH D+ LPE   AF LHFLLHG HHYLPMD +RLV+PP LF++LC P YK VF L
Sbjct: 236 LHRFLFHFDNYLPENNIAFALHFLLHGFHHYLPMDPYRLVVPPALFIILCAPIYKTVFLL 295

Query: 300 LPYYWACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRXXXXXXXXXXXXXXXXGFGVTSW 359
           LPYYWACAGFAGG+ GYV YD+ HY LHHS+LPP+MR                G+G+TSW
Sbjct: 296 LPYYWACAGFAGGLFGYVYYDMCHYALHHSKLPPFMRRLKQYHLEHHYKNYELGYGITSW 355

Query: 360 FWDKVFGTYLGENAPLSNMKYD 381
           FWDKVFGTYL ++AP S MK+D
Sbjct: 356 FWDKVFGTYLSKDAPASVMKFD 377

>TBLA0D03180 Chr4 complement(774883..776085) [1203 bp, 400 aa] {ON}
           Anc_8.829 YMR272C
          Length = 400

 Score =  413 bits (1062), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 204/383 (53%), Positives = 256/383 (66%), Gaps = 3/383 (0%)

Query: 2   SSSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDV 61
           SS     L+S   ++KHN K DCWV    RKIY+V+++L ++P G   I+D+AG DIT  
Sbjct: 18  SSPLTKELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSS 77

Query: 62  MKDVLTHEHSESAYEIM--DESYLVGYLAXXXXXXXXXXNKDHVVEVNLKGN-NEFDSTV 118
            K+   + H    Y+ M  ++ YLVGYLA          N  H VEV L    + +DST 
Sbjct: 78  FKNQERYNHDPETYDFMSHNDKYLVGYLANEEEAYKLLSNPSHKVEVKLTEQPSTYDSTT 137

Query: 119 FVKELPTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGKG 178
           FVKELP+ED   IATDY+ D+ +H FLDL KPL+ Q+   KF + FY+DQ+HRPRH+G  
Sbjct: 138 FVKELPSEDHFVIATDYKKDFNEHHFLDLEKPLIPQLWRAKFNRAFYIDQIHRPRHFGNK 197

Query: 179 SAPLFGNFLEPLSKTXXXXXXXXXXXXXTYHIYTALMNMNQAFAIFLFAVGVFVWTLIEY 238
           SAPLFGNFLEPL+KT              YH+  A  NMN  FA FLF VGVFVWTLIEY
Sbjct: 198 SAPLFGNFLEPLTKTAWWVIPVVWLPVVFYHLKVAFHNMNNIFATFLFCVGVFVWTLIEY 257

Query: 239 GLHRFLFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVFA 298
            LHRFLFH+D+R+P+    + LHF +HG HHYLPMD +RLVMPPTLF++LCTPFYKLVF+
Sbjct: 258 SLHRFLFHMDNRIPDHPMFYVLHFTIHGCHHYLPMDPYRLVMPPTLFLILCTPFYKLVFS 317

Query: 299 LLPYYWACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRXXXXXXXXXXXXXXXXGFGVTS 358
           +LP YWA AGFAGG+ GYVCYD  HY+LHHS++P +MR                 FGV++
Sbjct: 318 VLPLYWAYAGFAGGLFGYVCYDEVHYWLHHSRVPKFMRLLKKLHLEHHYKNYQLAFGVSN 377

Query: 359 WFWDKVFGTYLGENAPLSNMKYD 381
           +FWDKVFGTYL  ++PLS MKY+
Sbjct: 378 YFWDKVFGTYLYPDSPLSPMKYE 400

>TPHA0C04710 Chr3 complement(1015392..1016525) [1134 bp, 377 aa]
           {ON} Anc_8.829 YMR272C
          Length = 377

 Score =  389 bits (998), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 195/380 (51%), Positives = 257/380 (67%), Gaps = 11/380 (2%)

Query: 2   SSSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGG--AEYILDYAGTDIT 59
           + S+ L L+S    + HN ++DCWVS+  R IY+V++F+ E+      + +L  AG DI+
Sbjct: 5   NPSKTLELFSSEKFQSHNTEDDCWVSVKDRLIYDVSKFVQENKDVPVEDAVLKRAGKDIS 64

Query: 60  DVMKDVLTHEHSESAYEIMDESYLVGYLAXXXXXXXXXXNKDHVVEVNLKGNNEFDSTVF 119
           D+++          +++ +D+ YLVGYLA          NKDH VEVNLK +  +DSTVF
Sbjct: 65  DLLE--------TKSFKFVDDKYLVGYLANSTEEARLLTNKDHKVEVNLK-DGTYDSTVF 115

Query: 120 VKELPTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGKGS 179
           VKELP+E+  +I+TDY+ D+  H FLDL KPLL Q+L G FT++FY+DQ+HRPRHYGKGS
Sbjct: 116 VKELPSEEHFTISTDYKKDFVDHHFLDLEKPLLMQMLTGNFTREFYIDQIHRPRHYGKGS 175

Query: 180 APLFGNFLEPLSKTXXXXXXXXXXXXXTYHIYTALMNMNQAFAIFLFAVGVFVWTLIEYG 239
           A LFGN+LEP+S T              YH Y    +M+   A+F + +G+FVWT IEY 
Sbjct: 176 AKLFGNWLEPISLTPWWLIPIIWGPVVVYHFYVGAQHMHPLSAVFFYFLGIFVWTFIEYC 235

Query: 240 LHRFLFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVFAL 299
           LHRFLFHLDD +P+  + +T+HFLLHGVHHYLPMD++RLV+PP LFVVLCTPFYK VFAL
Sbjct: 236 LHRFLFHLDDWVPQHNFFYTIHFLLHGVHHYLPMDQYRLVVPPALFVVLCTPFYKAVFAL 295

Query: 300 LPYYWACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRXXXXXXXXXXXXXXXXGFGVTSW 359
           LP Y A  GFAGG+ GY+ YDLTHYF+HH +LP   R                GFGV+++
Sbjct: 296 LPLYVAYVGFAGGLTGYIIYDLTHYFIHHVKLPRVFRKIKKHHLEHHYKNYQLGFGVSNY 355

Query: 360 FWDKVFGTYLGENAPLSNMK 379
           FWD VFGTYLG ++P S M+
Sbjct: 356 FWDLVFGTYLGPDSPASIMR 375

>Kpol_1069.4 s1069 (6163..6996) [834 bp, 277 aa] {ON} (6163..6996)
           [834 nt, 278 aa]
          Length = 277

 Score =  300 bits (767), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 140/245 (57%), Positives = 174/245 (71%)

Query: 125 TEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGKGSAPLFG 184
           TE+KL + TDY  D+ ++ FL L++PL WQ+L   FT+DFY+DQVH+PRHYG  SAP+FG
Sbjct: 19  TEEKLKVTTDYNKDFNENGFLKLDEPLFWQLLSSNFTRDFYIDQVHKPRHYGIESAPIFG 78

Query: 185 NFLEPLSKTXXXXXXXXXXXXXTYHIYTALMNMNQAFAIFLFAVGVFVWTLIEYGLHRFL 244
           NFLEP +KT              Y+   +L  ++   AI LF++GVFVWTLIEY +HR+L
Sbjct: 79  NFLEPFTKTHWFMVPLIWGPVVLYNFIVSLREISIILAITLFSIGVFVWTLIEYCMHRYL 138

Query: 245 FHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVFALLPYYW 304
           FHLDD +PE +  F LHFLLHG+HHYLPMD++RLVMPP LF +LC PFY L FA+ P YW
Sbjct: 139 FHLDDSVPETRLFFVLHFLLHGIHHYLPMDKYRLVMPPALFSILCYPFYLLTFAIFPRYW 198

Query: 305 ACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRXXXXXXXXXXXXXXXXGFGVTSWFWDKV 364
           A AGFAGG+ GYVCYD+THYFLHH ++P +MR                GFGVTS FWD+V
Sbjct: 199 AHAGFAGGLFGYVCYDVTHYFLHHKKMPSFMRKVKKYHLEHHYKNFQLGFGVTSSFWDRV 258

Query: 365 FGTYL 369
           FGTYL
Sbjct: 259 FGTYL 263

>NDAI0F02730 Chr6 (669821..670186) [366 bp, 121 aa] {ON} Anc_2.166
          Length = 121

 Score = 67.0 bits (162), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 51/75 (68%), Gaps = 4/75 (5%)

Query: 9  LYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLTH 68
          +Y+  ++ KHN  +D W+ + + K+Y+V++FLDEHPGG E I + AGTD T+  +D+   
Sbjct: 4  IYTYEEIAKHNSPDDTWIVI-EGKVYDVSKFLDEHPGGEEIIFELAGTDATENFEDI--- 59

Query: 69 EHSESAYEIMDESYL 83
           HS+ A +I+ + Y+
Sbjct: 60 GHSDDALKILKKMYI 74

>Kpol_505.14 s505 (37085..37456) [372 bp, 123 aa] {ON}
          (37085..37456) [372 nt, 124 aa]
          Length = 123

 Score = 66.2 bits (160), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 48/75 (64%), Gaps = 4/75 (5%)

Query: 9  LYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLTH 68
          +Y+  ++ +HN    CW+ +   K+Y+ T+FLDEHPGG E ILD AG D T+  +D+   
Sbjct: 4  VYTYQEIAEHNTTESCWIVI-DGKVYDTTKFLDEHPGGDEIILDLAGQDATESFEDI--- 59

Query: 69 EHSESAYEIMDESYL 83
           HS+ A +I+ + Y+
Sbjct: 60 GHSDEALKILKKLYI 74

>TDEL0F01210 Chr6 complement(216322..216702) [381 bp, 126 aa] {ON}
          Anc_2.166 YNL111C
          Length = 126

 Score = 65.5 bits (158), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 30/71 (42%), Positives = 46/71 (64%), Gaps = 4/71 (5%)

Query: 9  LYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLTH 68
          +YS   + +HN   D W+ +   K+Y+VT+F+DEHPGG E ILD AG D ++  +D+   
Sbjct: 4  VYSYQQIAEHNSAEDIWI-VVDGKVYDVTKFMDEHPGGDEIILDLAGQDASEPFRDI--- 59

Query: 69 EHSESAYEIMD 79
           HSE A +I++
Sbjct: 60 GHSEEALKILN 70

>Suva_14.228 Chr14 complement(413753..414115) [363 bp, 120 aa]
          {ON} YNL111C (REAL)
          Length = 120

 Score = 62.4 bits (150), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 46/75 (61%), Gaps = 4/75 (5%)

Query: 9  LYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLTH 68
          +YS  ++ +HN   +CW+ +   K+Y+V++F DEHPGG E I+D  G D TD   D+   
Sbjct: 4  VYSYQEVAEHNGPENCWI-IIDDKVYDVSQFKDEHPGGDEIIMDLGGQDATDSFVDI--- 59

Query: 69 EHSESAYEIMDESYL 83
           HS+ A +++   Y+
Sbjct: 60 GHSDEALKLLKTLYI 74

>KAFR0B04550 Chr2 (946561..946941) [381 bp, 126 aa] {ON} Anc_2.166
          YNL111C
          Length = 126

 Score = 62.0 bits (149), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 47/70 (67%), Gaps = 4/70 (5%)

Query: 9  LYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLTH 68
          +Y+  D+ +H   +DCW+++   K+YNV++FLDEHPGG E I + AG+D T+   D+   
Sbjct: 4  VYTYADVAEHVLPDDCWIAI-DGKVYNVSKFLDEHPGGDEIIYELAGSDATEYFLDI--- 59

Query: 69 EHSESAYEIM 78
           HS+ A +I+
Sbjct: 60 GHSDDALKIL 69

>Skud_14.221 Chr14 complement(407119..407481) [363 bp, 120 aa]
          {ON} YNL111C (REAL)
          Length = 120

 Score = 61.6 bits (148), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 46/75 (61%), Gaps = 4/75 (5%)

Query: 9  LYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLTH 68
          +YS  ++ +HN   +CW+ +   K+Y+V++F DEHPGG E I+D  G D T+   D+   
Sbjct: 4  VYSYQEVAEHNGPENCWI-IIDDKVYDVSQFKDEHPGGDEIIMDLGGQDATESFVDI--- 59

Query: 69 EHSESAYEIMDESYL 83
           HS+ A  ++ + Y+
Sbjct: 60 GHSDEALRLLKDLYI 74

>KNAG0I02040 Chr9 (397527..397886) [360 bp, 119 aa] {ON} Anc_2.166
          YNL111C
          Length = 119

 Score = 61.2 bits (147), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 45/75 (60%), Gaps = 4/75 (5%)

Query: 9  LYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLTH 68
          +Y+  D+ +H+   D W+ +  R +Y VT+FLDEHPGG E +L+ AG D T    D+   
Sbjct: 4  IYTYEDVAQHSTSEDAWIVIDNR-VYEVTKFLDEHPGGEEILLEMAGADATTNFLDI--- 59

Query: 69 EHSESAYEIMDESYL 83
           HS+ A +I+   Y+
Sbjct: 60 GHSDDAMKILKTRYI 74

>TPHA0F01790 Chr6 (412270..412818) [549 bp, 182 aa] {ON} Anc_2.166
           YNL111C
          Length = 182

 Score = 62.8 bits (151), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 48/75 (64%), Gaps = 4/75 (5%)

Query: 9   LYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLTH 68
           +Y+  ++ +HN     W+ + + K+YNVT+FLDEHPGG E I D AGTD T+  +D+   
Sbjct: 62  IYTYEEIAEHNTTESSWIVI-EGKVYNVTKFLDEHPGGDEIIFDLAGTDATENFEDI--- 117

Query: 69  EHSESAYEIMDESYL 83
            HS+ A +++   Y+
Sbjct: 118 GHSDQALKVLKTLYI 132

>TBLA0B01310 Chr2 (276173..276544) [372 bp, 123 aa] {ON} Anc_2.166
          YNL111C
          Length = 123

 Score = 60.5 bits (145), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 30/71 (42%), Positives = 42/71 (59%), Gaps = 4/71 (5%)

Query: 9  LYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLTH 68
          LYS  ++  HN     W+ + + K+Y+VT+FLD HPGG E IL+ AG D T   +D+   
Sbjct: 4  LYSYEEIAAHNTTESAWI-IIKDKVYDVTKFLDSHPGGDEIILELAGQDATQDFEDI--- 59

Query: 69 EHSESAYEIMD 79
           HS  A E +D
Sbjct: 60 GHSNDALEFLD 70

>CAGL0L03828g Chr12 (442660..443025) [366 bp, 121 aa] {ON} similar
          to uniprot|P40312 Saccharomyces cerevisiae YNL111c CYB5
          Length = 121

 Score = 60.1 bits (144), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 27/70 (38%), Positives = 44/70 (62%), Gaps = 4/70 (5%)

Query: 9  LYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLTH 68
          +Y+   + +HN + DCW+ +    +Y+V++FLDEHPGG E I ++ GTD T    D+   
Sbjct: 4  VYTYKQVSEHNKEGDCWI-IIDGSVYDVSKFLDEHPGGDEIIFEHRGTDATGDFVDI--- 59

Query: 69 EHSESAYEIM 78
           HS+ A +I+
Sbjct: 60 GHSDDALKIL 69

>NCAS0G02570 Chr7 complement(460218..460583) [366 bp, 121 aa] {ON}
          Anc_2.536 YMR073C
          Length = 121

 Score = 60.1 bits (144), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 28/70 (40%), Positives = 45/70 (64%), Gaps = 4/70 (5%)

Query: 9  LYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLTH 68
          +YS   + +HN  +D W+ + + K+Y+V++FLDEHPGG E I + AG D T+   D+   
Sbjct: 4  VYSYQQIAEHNKPDDAWI-IIEGKVYDVSKFLDEHPGGDEIIFELAGQDATEHFLDI--- 59

Query: 69 EHSESAYEIM 78
           HS+ A +I+
Sbjct: 60 GHSDDALQIL 69

>Kwal_26.8461 s26 (794482..794853) [372 bp, 123 aa] {ON} YNL111C
          (CYB5) - 1:1 [contig 61] FULL
          Length = 123

 Score = 58.9 bits (141), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 46/75 (61%), Gaps = 4/75 (5%)

Query: 9  LYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLTH 68
          LYS  ++ +HN + D W+ +   K+Y+ T+F+DEHPGG E ++D  G D T    D+   
Sbjct: 4  LYSYKEIAEHNTEKDLWM-IIDGKVYDCTKFMDEHPGGEEVLVDLGGQDATGPFADI--- 59

Query: 69 EHSESAYEIMDESYL 83
           HS+ A +++ + Y+
Sbjct: 60 GHSDDAVKMLADLYV 74

>KLTH0D09284g Chr4 (770560..770931) [372 bp, 123 aa] {ON} similar
          to uniprot|P40312 Saccharomyces cerevisiae YNL111C CYB5
          Cytochrome b5 involved in the sterol and lipid
          biosynthesis pathways required for sterol C5-6 and
          fatty acid desaturation
          Length = 123

 Score = 58.5 bits (140), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 48/75 (64%), Gaps = 4/75 (5%)

Query: 9  LYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLTH 68
          LYS  ++ +HN +ND W+ +   K+Y+ T+F+DEHPGG E +LD  G D T    D+   
Sbjct: 4  LYSYKEIAEHNTENDLWM-IIDGKVYDCTKFMDEHPGGEEVLLDLGGQDATGPFADI--- 59

Query: 69 EHSESAYEIMDESYL 83
           HS+ A +++++ Y+
Sbjct: 60 GHSDDAVKMLEDLYV 74

>SAKL0E10626g Chr5 (885272..885643) [372 bp, 123 aa] {ON} similar
          to uniprot|P40312 Saccharomyces cerevisiae YNL111C CYB5
          Cytochrome b5 involved in the sterol and lipid
          biosynthesis pathways required for sterol C5-6 and
          fatty acid desaturation
          Length = 123

 Score = 56.2 bits (134), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 25/75 (33%), Positives = 46/75 (61%), Gaps = 4/75 (5%)

Query: 9  LYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLTH 68
          L++  ++ +HN + D W+ +   K+Y+ T+F+DEHPGG E ++D  G D T    D+   
Sbjct: 4  LFTYQEIAEHNTEGDLWM-IIDGKVYDCTKFIDEHPGGEEVLVDLGGQDATGPFADI--- 59

Query: 69 EHSESAYEIMDESYL 83
           HS+ A ++++  Y+
Sbjct: 60 GHSDDAIKLLEPLYI 74

>KLLA0F27577g Chr6 (2556662..2557180) [519 bp, 172 aa] {ON} some
          similarities with uniprot|P40312 Saccharomyces
          cerevisiae YNL111C CYB5 Cytochrome b5
          Length = 172

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 49/80 (61%), Gaps = 3/80 (3%)

Query: 8  PLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLT 67
          PL +  ++ +H+ ++DCW  ++  K+Y++T FL +HPGGA+ +L YAG D T +  D + 
Sbjct: 4  PLITMDEVARHSSRSDCWTVIHG-KVYDITSFLHKHPGGAQVLLKYAGKDST-LQFDDIG 61

Query: 68 HEHSESAYEIMDESYLVGYL 87
          H     AY+ +D   L G L
Sbjct: 62 HSMESLAYD-LDPGALKGTL 80

>ZYRO0B09812g Chr2 (765874..766425) [552 bp, 183 aa] {ON} similar to
           uniprot|P40312 Saccharomyces cerevisiae YNL111C CYB5
           Cytochrome b5 involved in the sterol and lipid
           biosynthesis pathways required for sterol C5-6 and fatty
           acid desaturation
          Length = 183

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 49/79 (62%), Gaps = 5/79 (6%)

Query: 9   LYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLTH 68
           +Y+   + +HN   D W+ +   K+Y+VT+F+++HPGG E ILD AG D T+   D+   
Sbjct: 60  VYTFEQVAEHNTPEDAWL-IVDGKVYDVTKFVEDHPGGDEIILDLAGQDGTEAFNDI--- 115

Query: 69  EHSESAYEIMDESYLVGYL 87
            HSE A  ++ + ++VG L
Sbjct: 116 GHSEDAVNMLKD-FIVGSL 133

>AFL223W Chr6 (19601..20098) [498 bp, 165 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YNL111C (CYB5)
          Length = 165

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 48/75 (64%), Gaps = 4/75 (5%)

Query: 9   LYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLTH 68
           LY+  ++ +HN +ND W+ +   K+Y+ T+F +EHPGG E ++D AG D T+   D+   
Sbjct: 43  LYTYQEIAEHNSENDLWL-IINGKVYDCTKFAEEHPGGDEVLIDLAGQDATEPFADI--- 98

Query: 69  EHSESAYEIMDESYL 83
            HS+ A ++++  Y+
Sbjct: 99  GHSDDAVKMLEGLYV 113

>Kwal_47.18167 s47 complement(716570..717253) [684 bp, 227 aa]
          {ON} YNL111C (CYB5) - cytochrome b5 [contig 197] FULL
          Length = 227

 Score = 57.8 bits (138), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 38/57 (66%), Gaps = 1/57 (1%)

Query: 3  SSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDIT 59
          +S  LP  S  ++  H D +DCW+S++  K+Y+V+ +L +HPGGA+ +L  AG D T
Sbjct: 27 TSSQLPFISSDEVATHTDADDCWISIHG-KVYDVSSYLPQHPGGAQVMLKLAGKDAT 82

>YNL111C Chr14 complement(416940..417302) [363 bp, 120 aa] {ON}
          CYB5Cytochrome b5, involved in the sterol and lipid
          biosynthesis pathways; acts as an electron donor to
          support sterol C5-6 desaturation
          Length = 120

 Score = 55.1 bits (131), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 26/75 (34%), Positives = 44/75 (58%), Gaps = 4/75 (5%)

Query: 9  LYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLTH 68
          +YS  ++ +HN   + W+ +   K+Y+V++F DEHPGG E I+D  G D T+   D+   
Sbjct: 4  VYSYQEVAEHNGPENFWI-IIDDKVYDVSQFKDEHPGGDEIIMDLGGQDATESFVDI--- 59

Query: 69 EHSESAYEIMDESYL 83
           HS+ A  ++   Y+
Sbjct: 60 GHSDEALRLLKGLYI 74

>Smik_14.216 Chr14 complement(396585..396947) [363 bp, 120 aa]
          {ON} YNL111C (REAL)
          Length = 120

 Score = 54.7 bits (130), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 26/75 (34%), Positives = 44/75 (58%), Gaps = 4/75 (5%)

Query: 9  LYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLTH 68
          +YS  ++ +HN   + W+ +   K+Y+V++F DEHPGG E I+D  G D T+   D+   
Sbjct: 4  VYSYQEVAEHNGPENFWI-IIDDKVYDVSKFKDEHPGGDEIIMDLGGQDATESFVDI--- 59

Query: 69 EHSESAYEIMDESYL 83
           HS+ A  ++   Y+
Sbjct: 60 GHSDEALRLLKGLYI 74

>SAKL0F08316g Chr6 complement(634949..635485) [537 bp, 178 aa]
          {ON} some similarities with uniprot|P00175
          Saccharomyces cerevisiae YML054C CYB2 Cytochrome b2
          (L-lactate cytochrome-c oxidoreductase), component of
          the mitochondrial intermembrane space, required for
          lactate utilization; expression is repressed by glucose
          and anaerobic conditions
          Length = 178

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 37/57 (64%), Gaps = 1/57 (1%)

Query: 9  LYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDV 65
          + S +++ KHN  +DCW+ ++  K+YN+T FL +HPGGA  IL Y G D T    +V
Sbjct: 3  VISPSEVVKHNRPDDCWMIIHG-KVYNLTSFLSQHPGGAHVILQYGGRDATKQFDEV 58

>KLTH0D06930g Chr4 complement(604805..605419) [615 bp, 204 aa] {ON}
           weakly similar to uniprot|Q04772 Saccharomyces
           cerevisiae YMR073C Hypothetical ORF
          Length = 204

 Score = 55.5 bits (132), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 42/76 (55%), Gaps = 6/76 (7%)

Query: 11  SKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYIL-DYAGTDITDVMKDVLTHE 69
           +K  L+KHN   DCW  L QR +Y V+ +LD HPGGAE +L   AG D T +        
Sbjct: 130 TKAQLQKHNTAEDCWCVLNQR-VYCVSSYLDFHPGGAEILLRTAAGKDATALFNKY---- 184

Query: 70  HSESAYEIMDESYLVG 85
           H    YE + E+ LVG
Sbjct: 185 HRWVNYERLLETCLVG 200

>TDEL0H02180 Chr8 (369539..370150) [612 bp, 203 aa] {ON} 
          Length = 203

 Score = 54.7 bits (130), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%), Gaps = 1/61 (1%)

Query: 5  RILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKD 64
          R LP     ++ +HN  +DCW++++ R +Y+VT  L +HPGG + +L YAG D T    D
Sbjct: 20 RNLPKIRLAEVREHNTAHDCWMAIHGR-VYDVTPILSKHPGGCQILLKYAGMDATFPFDD 78

Query: 65 V 65
          V
Sbjct: 79 V 79

>TDEL0D00190 Chr4 (29971..31629) [1659 bp, 552 aa] {ON} 
          Length = 552

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 48/78 (61%), Gaps = 6/78 (7%)

Query: 11  SKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLTHEH 70
           S ++L KHN  +DCW++L   ++Y+VT FL  HPGG   +++ AG D T+    +    H
Sbjct: 76  SASELRKHNTVHDCWIAL-NGEVYDVTAFLQMHPGGVARLMEVAGGDATEKFYQI----H 130

Query: 71  SESAYEIMDESYL-VGYL 87
           S+S +E M  +++ +G L
Sbjct: 131 SDSVFEKMKNNFIYIGKL 148

>KLTH0A04026g Chr1 complement(337200..337901) [702 bp, 233 aa]
          {ON} weakly similar to uniprot|P40312 Saccharomyces
          cerevisiae YNL111C CYB5 Cytochrome b5, involved in the
          sterol and lipid biosynthesis pathways
          Length = 233

 Score = 54.3 bits (129), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 36/58 (62%), Gaps = 1/58 (1%)

Query: 8  PLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDV 65
          P+ S+ +L  H    DCW++++   +Y+V+ +L +HPGGA+ +L  AG D T    DV
Sbjct: 32 PVISREELATHTSAEDCWLAIHG-AVYDVSRYLTQHPGGAQVMLKLAGKDATAQFDDV 88

>KLLA0F23672g Chr6 (2212223..2212594) [372 bp, 123 aa] {ON}
          similar to uniprot|P40312 Saccharomyces cerevisiae
          YNL111C CYB5 Cytochrome b5 involved in the sterol and
          lipid biosynthesis pathways required for sterol C5-6
          and fatty acid desaturation
          Length = 123

 Score = 51.2 bits (121), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 45/75 (60%), Gaps = 4/75 (5%)

Query: 9  LYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLTH 68
          L +  ++ +H   +D W+ +   K+Y+ T+F+DEHPGG E ++D  G D T   +D+   
Sbjct: 4  LLTYKEVSEHKTVDDLWM-IIDGKVYDCTKFVDEHPGGDEILVDLGGQDATGPFEDI--- 59

Query: 69 EHSESAYEIMDESYL 83
           HS+ A ++++  Y+
Sbjct: 60 GHSDDAIKLLEPMYV 74

>KLTH0C11858g Chr3 (979073..980740) [1668 bp, 555 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 555

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 44/76 (57%), Gaps = 6/76 (7%)

Query: 13  TDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLTHEHSE 72
           +++ +HN  +DCW+ L   ++Y+VT FL  HPGGA  I++ AG D T     +    HS+
Sbjct: 79  SEVMQHNKPDDCWIVL-NGEVYDVTSFLQMHPGGAARIMEVAGNDATRKFYSI----HSD 133

Query: 73  SAYEIMDESYL-VGYL 87
           S  E M E  + +G L
Sbjct: 134 STLEKMKEQLVYIGKL 149

>Ecym_5420 Chr5 (865505..865942) [438 bp, 145 aa] {ON} similar to
          Ashbya gossypii AFL223W
          Length = 145

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 43/74 (58%), Gaps = 4/74 (5%)

Query: 10 YSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLTHE 69
          ++  ++  HN + D W+ +   K+Y+ ++F DEHPGG E +LD  G D T    D+    
Sbjct: 5  FTYQEIADHNSEQDLWL-IINGKVYDCSKFADEHPGGDEVLLDLGGQDATIPFLDI---G 60

Query: 70 HSESAYEIMDESYL 83
          H++ A +++D  Y+
Sbjct: 61 HTDDAVKLLDHMYI 74

>Kwal_23.2823 s23 (29032..30714) [1683 bp, 560 aa] {ON} YML054C
           (CYB2) - Cytochrome b2 [L--lactate cytochrome-c
           oxidoreductase] [contig 246] FULL
          Length = 560

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 40/71 (56%), Gaps = 6/71 (8%)

Query: 18  HNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLTHEHSESAYEI 77
           HN  NDCW+ L   ++Y+VT F+  HPGG + IL+ AG+D T+    +    HSE     
Sbjct: 89  HNKLNDCWIVLND-EVYDVTSFIAAHPGGVQRILEVAGSDATEKFYQI----HSEDVLNK 143

Query: 78  MDESYL-VGYL 87
           M E  + VG L
Sbjct: 144 MKEKLVYVGKL 154

>ZYRO0B02090g Chr2 complement(169589..170173) [585 bp, 194 aa] {ON}
           similar to gnl|GLV|KLLA0E18535g Kluyveromyces lactis
           KLLA0E18535g and weakly similar to YMR073C
           uniprot|Q04772 Saccharomyces cerevisiae YMR073C
           Hypothetical ORF
          Length = 194

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 48/91 (52%), Gaps = 14/91 (15%)

Query: 4   SRILPLY--------SKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDY-A 54
           SR +PLY         K  L +HN K+DCW  + Q K+Y +T + D HPGG + +L Y A
Sbjct: 105 SRKVPLYLIRPPLRVDKELLRRHNTKDDCWC-VIQGKVYCLTNYFDFHPGGVDILLRYCA 163

Query: 55  GTDITDVMKDVLTHEHSESAYEIMDESYLVG 85
           G D T +  +     H   +Y+ + E+  VG
Sbjct: 164 GKDATKMFNEY----HRWVSYDKLLETCFVG 190

>KLLA0D02640g Chr4 complement(225482..227251) [1770 bp, 589 aa] {ON}
           similar to uniprot|P00175 Saccharomyces cerevisiae
           YML054C CYB2 Cytochrome b2 (L-lactate cytochrome-c
           oxidoreductase) component of the mitochondrial
           intermembrane space required for lactate utilization
           expression is repressed by glucose and anaerobic
           conditions
          Length = 589

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 34/54 (62%), Gaps = 1/54 (1%)

Query: 8   PLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDV 61
           P  S T++ KH+   DCWV + +  +YN+T+F+  HPGG   I + AG D+T +
Sbjct: 88  PKVSPTEVAKHSSPKDCWV-VIEGYVYNLTDFISAHPGGPAIIENNAGKDVTKI 140

>KNAG0E03860 Chr5 (763388..765202) [1815 bp, 604 aa] {ON} Anc_4.304
           YML054C
          Length = 604

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 34/53 (64%), Gaps = 1/53 (1%)

Query: 11  SKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMK 63
           S +++ KHN  +DCWV + +  +YN+TEF+  HPGG   I   AG D+T + K
Sbjct: 93  SPSEVAKHNTPDDCWV-VIEGYVYNLTEFIPTHPGGPMVIKSNAGKDVTAIFK 144

>ADL085C Chr4 complement(535293..536114) [822 bp, 273 aa] {ON}
           NOHBY406; No homolog in Saccharomyces cerevisiae
          Length = 273

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 43/78 (55%), Gaps = 2/78 (2%)

Query: 6   ILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDV 65
           +L   S  ++ +H  ++DCW  ++ R +Y++T  L+ HPGG + +L YAG D T    DV
Sbjct: 89  LLRKISIEEVSQHTSRDDCWFIIHGR-VYDITGLLENHPGGTKILLKYAGRDATLPFDDV 147

Query: 66  LTHEHSESAYEIMDESYL 83
             H      Y++   SYL
Sbjct: 148 -GHSMESLIYDMAPGSYL 164

>TPHA0B01820 Chr2 complement(406416..408146) [1731 bp, 576 aa] {ON}
           Anc_4.304 YML054C
          Length = 576

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 35/52 (67%), Gaps = 1/52 (1%)

Query: 14  DLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDV 65
           ++ +HN ++DCWV +    +YN+T+F+D HPGG   I+  +G D+T + + +
Sbjct: 77  EVARHNKRDDCWV-VINDSVYNLTDFIDSHPGGKNVIVANSGKDVTKLFEPI 127

>ZYRO0C18524g Chr3 (1450641..1452305) [1665 bp, 554 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 554

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 30/42 (71%), Gaps = 1/42 (2%)

Query: 18  HNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDIT 59
           HN+ NDCW+ L   +IY+VT F+ +HPGGA  +L+ AG D T
Sbjct: 84  HNNVNDCWIVL-NGEIYDVTSFIGKHPGGAARLLEVAGRDAT 124

>KLTH0C11770g Chr3 (970979..972835) [1857 bp, 618 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 618

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 34/49 (69%), Gaps = 1/49 (2%)

Query: 11  SKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDIT 59
           S T++ +HN ++DCWV +    +Y+VT F+D+HPGG+  I   AG D++
Sbjct: 120 SATEVIRHNKEDDCWV-VIDGYVYDVTAFIDQHPGGSAVIRGNAGKDVS 167

>Ecym_4346 Chr4 (739106..739735) [630 bp, 209 aa] {ON} similar to
          Ashbya gossypii ADL085C
          Length = 209

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 40/73 (54%), Gaps = 2/73 (2%)

Query: 11 SKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLTHEH 70
          S +++ +H   +DCW  ++  K+Y++T  L  HPGGA+ +L YAG D T    DV  H  
Sbjct: 7  SLSEVRRHTSADDCWFIIHN-KVYDITNLLSTHPGGAKTLLKYAGRDATLPFDDV-GHST 64

Query: 71 SESAYEIMDESYL 83
              Y++   S L
Sbjct: 65 ESLVYDMAPGSCL 77

>SAKL0G16852g Chr7 (1452894..1454636) [1743 bp, 580 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 580

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 14  DLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDV 61
           D+ KHND  DCWV +    +Y++TEF+  HPGG   I + AG D+T +
Sbjct: 85  DVAKHNDPKDCWV-VIDGYVYDLTEFIHSHPGGPTIIENNAGKDVTAI 131

>NDAI0D04710 Chr4 (1106280..1108130) [1851 bp, 616 aa] {ON}
           Anc_4.304
          Length = 616

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 35/54 (64%), Gaps = 1/54 (1%)

Query: 8   PLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDV 61
           PL S  ++ KH+   DCWV ++  K+Y++T F+  HPGG + I   AG D+T++
Sbjct: 94  PLISPDEVAKHHTPADCWVVIHD-KVYDLTSFIPIHPGGPDIIKSNAGKDVTNI 146

>Kpol_1014.5 s1014 complement(3107..4897) [1791 bp, 596 aa] {ON}
           complement(3107..4897) [1791 nt, 597 aa]
          Length = 596

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 39/59 (66%), Gaps = 1/59 (1%)

Query: 3   SSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDV 61
           S + L + +  ++ KHN K+DCWV +    +Y++T F+ +HPGG + I+  AG D++++
Sbjct: 84  SKKSLKIITPQEVIKHNSKDDCWV-VINDIVYDLTFFIKKHPGGQDVIVGNAGKDVSNI 141

>KLLA0B14795g Chr2 (1299429..1301099) [1671 bp, 556 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 556

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 42/70 (60%), Gaps = 5/70 (7%)

Query: 11  SKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLTHEH 70
           S  +++ HN  +DCW+ +   ++Y++T+FL +HPGG   ++++AG D T+    +    H
Sbjct: 82  SVKEVKMHNRIDDCWI-VIDNEVYDITKFLSQHPGGVARLMEFAGRDATERFYQM----H 136

Query: 71  SESAYEIMDE 80
           S +  E M E
Sbjct: 137 SSATLEKMKE 146

>SAKL0F16610g Chr6 (1373674..1375368) [1695 bp, 564 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 564

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 41/71 (57%), Gaps = 6/71 (8%)

Query: 18  HNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLTHEHSESAYEI 77
           HN+ +DCW+ L    +Y++TEF+  HPGGA  +++ AG D T+    +    HS+   E 
Sbjct: 96  HNNIDDCWIVL-NGDVYDITEFIKIHPGGAARLMEVAGRDATEKFHMI----HSDEVLEK 150

Query: 78  MDE-SYLVGYL 87
           M E   LVG L
Sbjct: 151 MKEYITLVGKL 161

>NDAI0D04700 Chr4 (1103670..1105547) [1878 bp, 625 aa] {ON} 
          Length = 625

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 34/59 (57%), Gaps = 6/59 (10%)

Query: 8   PLYSKT-----DLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDV 61
           P+ SKT     +L KHN   DCWV +   ++Y++T F+  HPGG   I   AG D+T +
Sbjct: 98  PVKSKTPITPNELMKHNTPEDCWV-VINNQVYDLTTFIQVHPGGPNIIRSNAGKDVTAI 155

>KAFR0A04740 Chr1 (942850..944301) [1452 bp, 483 aa] {ON} Anc_6.106
           YGL055W
          Length = 483

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 45/72 (62%), Gaps = 1/72 (1%)

Query: 7   LPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVL 66
           LP+++ ++ ++  +KN+  +++    +++VT+F++EHPGG   I +  G D T V    +
Sbjct: 381 LPVWNYSEFQRQIEKNERKLTIIGGVVHDVTDFINEHPGGEPLIKEALGKDATRVFSGGV 440

Query: 67  THEHSESAYEIM 78
            + HS +AY I+
Sbjct: 441 -YSHSNAAYNIL 451

>ZYRO0D16654g Chr4 complement(1380316..1380888) [573 bp, 190 aa]
          {ON} conserved hypothetical protein
          Length = 190

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 33/59 (55%), Gaps = 1/59 (1%)

Query: 7  LPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDV 65
          LP  S  ++ KH    DCW+ ++ R +YNV   L  HPGG++ +L Y G D T    DV
Sbjct: 27 LPSLSWDEIRKHMTPPDCWMVIHGR-VYNVAPVLASHPGGSQILLHYVGRDATYPFDDV 84

>NCAS0A02770 Chr1 (528814..530643) [1830 bp, 609 aa] {ON} 
          Length = 609

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 34/51 (66%), Gaps = 1/51 (1%)

Query: 11  SKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDV 61
           S  ++ KHN +NDCW+ +   ++Y++T F+  HPGG++ I   AG D++ +
Sbjct: 96  STDEVTKHNSENDCWI-VINGQVYDLTSFMSIHPGGSDIIKLNAGKDVSAI 145

>ZYRO0B13728g Chr2 (1110636..1112432) [1797 bp, 598 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 598

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 8   PLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDV 61
           P  S  ++ KHN  +DCWV +    +Y++TEF   HPGG   I   AG D++ +
Sbjct: 82  PAISPDEVAKHNSPDDCWV-VIDGYVYDLTEFAPVHPGGPTVIKSNAGKDVSAI 134

>YML054C Chr13 complement(165533..167308) [1776 bp, 591 aa] {ON}
           CYB2Cytochrome b2 (L-lactate cytochrome-c
           oxidoreductase), component of the mitochondrial
           intermembrane space, required for lactate utilization;
           expression is repressed by glucose and anaerobic
           conditions
          Length = 591

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 35/61 (57%), Gaps = 5/61 (8%)

Query: 1   MSSSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITD 60
           M+  +I P     ++ KHN  +DCWV +    +Y++T FL  HPGG + I   AG D+T 
Sbjct: 86  MNKQKISP----AEVAKHNKPDDCWV-VINGYVYDLTRFLPNHPGGQDVIKFNAGKDVTA 140

Query: 61  V 61
           +
Sbjct: 141 I 141

>Smik_13.92 Chr13 complement(163135..164910) [1776 bp, 591 aa] {ON}
           YML054C (REAL)
          Length = 591

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 35/61 (57%), Gaps = 5/61 (8%)

Query: 1   MSSSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITD 60
           M+  +I P     ++ KHN  +DCWV +    +Y++T FL  HPGG + I   AG D+T 
Sbjct: 86  MNKQKISP----AEVAKHNKPDDCWV-VINGYVYDLTRFLPNHPGGQDVIKFNAGKDVTA 140

Query: 61  V 61
           +
Sbjct: 141 I 141

>NCAS0F00870 Chr6 (177678..178247) [570 bp, 189 aa] {ON} Anc_2.536
           YMR073C
          Length = 189

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 45/73 (61%), Gaps = 8/73 (10%)

Query: 15  LEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYIL-DYAGTDITDVMKDVLTHE-HSE 72
           L++H  + DCW ++Y+ K+Y V+++L+ HPGG + I  + AG D T     VL ++ HS 
Sbjct: 118 LQRHTSRTDCW-TIYKGKVYCVSDYLEYHPGGPDIIFQNCAGKDST-----VLFNQYHSW 171

Query: 73  SAYEIMDESYLVG 85
              E + E+ L+G
Sbjct: 172 VNAEKLLETCLIG 184

>CAGL0K03069g Chr11 complement(285190..285774) [585 bp, 194 aa] {ON}
           weakly similar to uniprot|Q04772 Saccharomyces
           cerevisiae YMR073c
          Length = 194

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 40/72 (55%), Gaps = 4/72 (5%)

Query: 14  DLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLTHEHSES 73
           +L +HN   DCW ++   K+Y+++ +L  HPGGA+ ++D +    + V+       H   
Sbjct: 123 ELARHNTAEDCW-TVINGKVYSISSYLSFHPGGAKILIDKSSGQDSTVL---FNRYHRWI 178

Query: 74  AYEIMDESYLVG 85
           + E M E+ LVG
Sbjct: 179 SVEKMLETCLVG 190

>Skud_13.92 Chr13 complement(163654..165429) [1776 bp, 591 aa] {ON}
           YML054C (REAL)
          Length = 591

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 35/61 (57%), Gaps = 5/61 (8%)

Query: 1   MSSSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITD 60
           M+  +I P     ++ KHN  +DCWV +    +Y++T F+  HPGG + I   AG D+T 
Sbjct: 86  MNKQKISP----AEVAKHNKADDCWV-VINGYVYDLTRFMPNHPGGPDVIKFNAGRDVTA 140

Query: 61  V 61
           +
Sbjct: 141 I 141

>Suva_13.105 Chr13 complement(168279..170054) [1776 bp, 591 aa] {ON}
           YML054C (REAL)
          Length = 591

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 35/61 (57%), Gaps = 5/61 (8%)

Query: 1   MSSSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITD 60
           M+  +I P     ++ KHN  +DCWV +    +Y++T F+  HPGG + I   AG D+T 
Sbjct: 86  MNKQKISP----AEVAKHNSADDCWV-VINGYVYDLTRFVPNHPGGPDVIKYNAGRDVTA 140

Query: 61  V 61
           +
Sbjct: 141 I 141

>Kwal_26.8046 s26 complement(621715..622311) [597 bp, 198 aa] {ON}
           YMR073C - Hypothetical ORF [contig 55] FULL
          Length = 198

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 39/76 (51%), Gaps = 6/76 (7%)

Query: 11  SKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILD-YAGTDITDVMKDVLTHE 69
           +K  L +H    DCW  + Q K+Y ++ +LD HPGG + ++   AG D T     +    
Sbjct: 124 NKAQLAQHKAPEDCWCVINQ-KVYCISSYLDFHPGGVDILMKGAAGKDCT----SMFNKY 178

Query: 70  HSESAYEIMDESYLVG 85
           H    YE + E+ LVG
Sbjct: 179 HRWVNYEKVLETSLVG 194

>CAGL0K10736g Chr11 (1046127..1047908) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P00175 Saccharomyces cerevisiae
           YML054c CYB2 lactate dehydrogenase cytochrome b2
          Length = 593

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 1/54 (1%)

Query: 8   PLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDV 61
           P  S +++ KHN   DCWV +    +Y++T F+  HPGG + I   AG D+T +
Sbjct: 88  PKISPSEVIKHNTPEDCWV-VIDGYVYDLTNFIALHPGGPDIIKTNAGKDVTAI 140

>NCAS0A02780 Chr1 (531072..532880) [1809 bp, 602 aa] {ON} Anc_4.304
          Length = 602

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 37/63 (58%), Gaps = 3/63 (4%)

Query: 1   MSSSRILP--LYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDI 58
            + S++ P  +   +++ +HN   DCW+ +    +Y++T F+  HPGGA+ I   AG D+
Sbjct: 78  QNESKLAPKRVIDPSEVARHNTPADCWI-VINGVVYDLTSFIPVHPGGADIIKSNAGKDV 136

Query: 59  TDV 61
           T +
Sbjct: 137 TAI 139

>TDEL0D01140 Chr4 complement(214858..216612) [1755 bp, 584 aa] {ON}
           Anc_4.304 YML054C
          Length = 584

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 14  DLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDV 61
           ++EKHN  +DCWV +    +Y++++F+  HPGG   I   AG D++ +
Sbjct: 82  EVEKHNAPDDCWV-VIDGYVYDLSDFIPSHPGGPAVIRANAGKDVSAI 128

>KNAG0C05780 Chr3 (1124591..1125133) [543 bp, 180 aa] {ON} Anc_2.536
           YMR073C
          Length = 180

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 48/86 (55%), Gaps = 7/86 (8%)

Query: 5   RILPLYSKTD--LEKHND---KNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDIT 59
           +I PL +     L+ H D   K+D W ++Y+ K+Y ++ +LD HPGG E I+D+A  D  
Sbjct: 92  KIRPLMAINSKILKNHQDYLSKHDFW-AVYKGKVYCLSYYLDFHPGGIEIIIDHATRDPP 150

Query: 60  DVMKDVLTHEHSESAYEIMDESYLVG 85
           D+ +      H   + E + E+ LVG
Sbjct: 151 DI-RGAFDRYHRWVSAEKLLETCLVG 175

>KAFR0I00520 Chr9 complement(107239..108999) [1761 bp, 586 aa] {ON}
           Anc_4.304 YML054C
          Length = 586

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 35/61 (57%), Gaps = 5/61 (8%)

Query: 1   MSSSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITD 60
           +++  ILP     ++ KH   +DCWV +    +Y++T F+  HPGG + +   AG D+T 
Sbjct: 78  ITTRLILP----EEVAKHKTPDDCWV-VINGYVYDITSFIMSHPGGPDVLETNAGKDVTA 132

Query: 61  V 61
           +
Sbjct: 133 I 133

>KNAG0F03250 Chr6 complement(607667..609136) [1470 bp, 489 aa] {ON}
           Anc_6.106 YGL055W
          Length = 489

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 41/72 (56%), Gaps = 2/72 (2%)

Query: 7   LPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVL 66
           LP++ K + E++  +N   V +    I++VT F++EHPGGA  + D  G D T      +
Sbjct: 389 LPVWDKAEFERNLSQNPNLVVI-GGIIHDVTGFVEEHPGGAPLLNDALGKDATTAFTGGV 447

Query: 67  THEHSESAYEIM 78
            + HS +A+ ++
Sbjct: 448 -YRHSNAAHNVL 458

>SAKL0A09570g Chr1 complement(838406..839041) [636 bp, 211 aa] {ON}
           similar to gnl|GLV|CAGL0K03069g Candida glabrata
           CAGL0K03069g and weakly similar to YMR073C
           uniprot|Q04772 Saccharomyces cerevisiae YMR073C
           Hypothetical ORF
          Length = 211

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 30/49 (61%), Gaps = 2/49 (4%)

Query: 12  KTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILD-YAGTDIT 59
           K +L KH   +DCW  L + K+Y ++ + D HPGG E +L+  AG D T
Sbjct: 138 KDELIKHKTVDDCWCVL-KGKVYCLSAYFDFHPGGVEILLNKCAGRDAT 185

>TBLA0I01530 Chr9 (334102..334767) [666 bp, 221 aa] {ON} Anc_2.536
           YMR073C
          Length = 221

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 39/60 (65%), Gaps = 4/60 (6%)

Query: 5   RILPLY--SKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYA-GTDITDV 61
           +I P++  ++  L +H + +DCW  +  R +Y+++ ++D HPGG + +++   G D++++
Sbjct: 137 KIRPMFKINQKILSEHQEVDDCWCVIKGR-VYSISRYMDYHPGGKQILINTCLGKDVSNL 195

>NDAI0H01370 Chr8 (336807..337481) [675 bp, 224 aa] {ON} Anc_2.536
          Length = 224

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 32/46 (69%), Gaps = 2/46 (4%)

Query: 15  LEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYIL-DYAGTDIT 59
           L+KH  ++DCW +++  K+Y +T +L  HPGGA+ +L + AG D T
Sbjct: 152 LQKHVSEDDCW-TVHNGKVYCMTYYLHFHPGGADILLEEAAGKDCT 196

>Kwal_14.807 s14 complement(57218..58954) [1737 bp, 578 aa] {ON}
           YML054C (CYB2) - Cytochrome b2 [L--lactate cytochrome-c
           oxidoreductase] [contig 245] FULL
          Length = 578

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 14  DLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDV 61
           ++ KH+  +DCWV +    +Y++++F+  HPGG   I   AG D++ +
Sbjct: 83  EVAKHSKPDDCWV-VINGYVYDLSDFIAVHPGGPAIIKANAGKDVSAI 129

>NDAI0I01620 Chr9 complement(382761..384086) [1326 bp, 441 aa] {ON}
           Anc_6.106
          Length = 441

 Score = 38.5 bits (88), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 40/75 (53%), Gaps = 2/75 (2%)

Query: 7   LPLYSKTD-LEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDV 65
           LP++ K D + + N  N+  + +    I++VT +  EHPGG + +    G D T   +  
Sbjct: 338 LPIWDKNDFMNEVNSNNNRKLVIISGIIHDVTNYTKEHPGGEKLLNSAVGKDGTRAFQGG 397

Query: 66  LTHEHSESAYEIMDE 80
           + + HS SA+ ++ +
Sbjct: 398 V-YRHSNSAHNVLAD 411

>Kpol_348.12 s348 complement(21978..22631) [654 bp, 217 aa] {ON}
           complement(21978..22631) [654 nt, 218 aa]
          Length = 217

 Score = 37.4 bits (85), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 36/58 (62%), Gaps = 4/58 (6%)

Query: 5   RILP--LYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDY-AGTDIT 59
           +++P  + +K  + KH D +DCW  + + K+Y+++ +   HPGG + +++  +G D T
Sbjct: 136 KLMPPLMITKKMVAKHKDIDDCWC-IIRGKVYSISNYFKFHPGGDKILINQCSGRDCT 192

>TDEL0A03110 Chr1 complement(554890..555492) [603 bp, 200 aa] {ON}
           Anc_2.536 YMR073C
          Length = 200

 Score = 36.6 bits (83), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 38/72 (52%), Gaps = 6/72 (8%)

Query: 15  LEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILD-YAGTDITDVMKDVLTHEHSES 73
           L+KH   +DCW  +  R +Y +T + D HPGG + +    AG D T++        H   
Sbjct: 130 LQKHKTLDDCWCVIKGR-VYCLTYYFDFHPGGVDILFKTCAGKDGTEMFNKY----HRWV 184

Query: 74  AYEIMDESYLVG 85
           +++ + E+ LVG
Sbjct: 185 SFDKLLETCLVG 196

>KAFR0A01890 Chr1 complement(392001..392486) [486 bp, 161 aa] {ON}
           Anc_2.536 YMR073C
          Length = 161

 Score = 35.4 bits (80), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 31/49 (63%), Gaps = 2/49 (4%)

Query: 11  SKTDLEKHN-DKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDI 58
           +K  L++H   K D W  +Y+ K+Y+++ +L+ HPGG E IL+    ++
Sbjct: 85  NKKILQRHQISKEDFW-GVYKGKVYSLSRYLEYHPGGIEIILNNCKKNV 132

>TPHA0G03550 Chr7 complement(755688..756344) [657 bp, 218 aa] {ON}
           Anc_2.536 YMR073C
          Length = 218

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 32/51 (62%), Gaps = 2/51 (3%)

Query: 11  SKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDY-AGTDITD 60
           S+  + +HN  +DCW  + + K+Y +T + + HPGG + + ++ +G D T+
Sbjct: 144 SEKMVAEHNTVDDCWC-IIKGKVYCITNYFEYHPGGDKILKNFCSGVDATE 193

>CAGL0I00418g Chr9 (30058..31530) [1473 bp, 490 aa] {ON} highly
           similar to uniprot|P21147 Saccharomyces cerevisiae
           YGL055w OLE1 stearoyl-CoA desaturase
          Length = 490

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 39/72 (54%), Gaps = 2/72 (2%)

Query: 7   LPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVL 66
           LP ++K +  + N +ND  V +    +++V+ ++ EHPGG + + +  G D T      +
Sbjct: 386 LPAWTKEEFLEKNRENDGLV-IVGGIVHDVSGYITEHPGGEKLLKNALGKDATKAFSGGV 444

Query: 67  THEHSESAYEIM 78
            + HS +A+  +
Sbjct: 445 -YRHSNAAHNTL 455

>Kpol_478.17 s478 (61375..62829) [1455 bp, 484 aa] {ON}
           (61375..62829) [1455 nt, 485 aa]
          Length = 484

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 38/74 (51%), Gaps = 2/74 (2%)

Query: 7   LPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVL 66
           LP++SK D    N K+D  + +    ++NV  ++++HPGG   I    G D T      +
Sbjct: 382 LPVWSK-DQFLENLKSDPELVVISGVVHNVKNYINDHPGGKTLIKSALGKDATSAFNGGV 440

Query: 67  THEHSESAYEIMDE 80
            + HS +A  ++ +
Sbjct: 441 -YRHSNAAQNVLAD 453

>KLLA0E18459g Chr5 (1641507..1641953) [447 bp, 148 aa] {ON} similar
           to uniprot|Q59TA9 Candida albicans CaO19 Potential
           heme/steroid binding protein and some similarites with
           YMR073C uniprot|Q04772 Saccharomyces cerevisiae YMR073C
           Hypothetical ORF
          Length = 148

 Score = 33.5 bits (75), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 35/81 (43%), Gaps = 5/81 (6%)

Query: 5   RILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKD 64
           RI P           +K++ W  +  RK+Y +  +L  HPGG   +   AG D+T     
Sbjct: 65  RIQPPLRVNKEALKANKDNFWC-VINRKVYCIKAYLSYHPGGEVILKQCAGKDVT----S 119

Query: 65  VLTHEHSESAYEIMDESYLVG 85
           +    H    YE + E+  +G
Sbjct: 120 LFNKYHRWVNYERLLETCFIG 140

>Ecym_3080 Chr3 (149461..150900) [1440 bp, 479 aa] {ON} similar to
           Ashbya gossypii AAR153C
          Length = 479

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 35/72 (48%), Gaps = 2/72 (2%)

Query: 7   LPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVL 66
           LP++ K +  K    N   V +    +++VT ++ EHPGG   I    G D T      +
Sbjct: 379 LPVWDKAEFMKETKANPGLVVI-SGIVHDVTGYITEHPGGETLIRASLGKDATKAFNGGV 437

Query: 67  THEHSESAYEIM 78
            + HS +A+ I+
Sbjct: 438 -YLHSNAAHNIL 448

>TBLA0C06220 Chr3 (1507690..1509174) [1485 bp, 494 aa] {ON} 
          Length = 494

 Score = 34.7 bits (78), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 33  IYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLTHEHSESAYEIM 78
           ++++T ++D HPGG + I +  G D T V    + + HS +A  ++
Sbjct: 415 VHDITNYIDRHPGGQKLIKEARGKDATSVFNGGV-YNHSNAANNVL 459

>NCAS0D03250 Chr4 (608476..609969) [1494 bp, 497 aa] {ON} Anc_6.106
          Length = 497

 Score = 33.9 bits (76), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 36/74 (48%), Gaps = 2/74 (2%)

Query: 7   LPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVL 66
           LP++ K +  +    N   V +    I++++ ++ EHPGG   I    G D T   +  +
Sbjct: 396 LPVWDKKEFVEQAQLNKNLVVI-SGIIHDISNYIPEHPGGESLIKQALGKDATRAFQGGV 454

Query: 67  THEHSESAYEIMDE 80
            + HS +A  ++ E
Sbjct: 455 -YRHSTAAQNVLSE 467

>SAKL0A07326g Chr1 (648420..649862) [1443 bp, 480 aa] {ON}
           uniprot|Q9HFB2 Saccharomyces kluyveri Sk Delta 9- fatty
           acid desaturase
          Length = 480

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 2/72 (2%)

Query: 7   LPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVL 66
           LP++ K +  K    N   V +    +++V+ ++ EHPGG   I   AG D T      +
Sbjct: 379 LPVWDKEEFMKSLKSNPGLV-IVSGIVHDVSGYITEHPGGETLIQAAAGKDATKAFNGGV 437

Query: 67  THEHSESAYEIM 78
            + HS +A+ ++
Sbjct: 438 -YLHSNAAHNVL 448

>AAR153C Chr1 complement(619953..621389) [1437 bp, 478 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL055W
           (OLE1)
          Length = 478

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 38/72 (52%), Gaps = 2/72 (2%)

Query: 7   LPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVL 66
           LP++ +++  + + +N   V +    +++V+ ++ EHPGG   I    G D T      +
Sbjct: 378 LPVWDRSEFVRASRENSGLVVI-SGIVHDVSGYITEHPGGETLIQAALGKDATRAFNGGV 436

Query: 67  THEHSESAYEIM 78
            + HS +A+ I+
Sbjct: 437 -YMHSNAAHNIL 447

>SAKL0E08800g Chr5 complement(720729..721727) [999 bp, 332 aa] {ON}
           some similarities with uniprot|P40473 Saccharomyces
           cerevisiae YIL122W POG1 Promoter of Growth
          Length = 332

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 42/92 (45%), Gaps = 9/92 (9%)

Query: 34  YNVTEFLDEHPGGAEYI-LDYAGTDITDVMKDVLTHEHSESAYEIMDESYLVGYLAXXXX 92
           YNV +   +  G AE I +DY    + D+  ++      + A E+MDES L+ Y++    
Sbjct: 16  YNVEDVPKDKEGSAETIKMDYKARILEDMGLEI------DDATELMDESLLIEYISFKKE 69

Query: 93  XXXXXXNKDHVVEVNLKGNNEFDSTVFVKELP 124
                   +H+ ++NL   NE  S +     P
Sbjct: 70  QEKRET--EHLKQLNLLKVNEILSKLVQTNFP 99

>Smik_13.252 Chr13 complement(396365..396970) [606 bp, 201 aa] {ON}
           YMR073C (REAL)
          Length = 201

 Score = 31.2 bits (69), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 34/56 (60%), Gaps = 4/56 (7%)

Query: 5   RILP--LYSKTDLEKH-NDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTD 57
           +I+P    ++  ++KH  D+++ W  +   K+Y+++ +L  HPGG + +L +  +D
Sbjct: 118 KIMPPLRINRAIVKKHCKDEDELWC-VINNKVYDISSYLKFHPGGTDILLRHRNSD 172

>Skud_7.226 Chr7 (402118..403647) [1530 bp, 509 aa] {ON} YGL055W
           (REAL)
          Length = 509

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 35/74 (47%), Gaps = 2/74 (2%)

Query: 7   LPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVL 66
           LPL+ K      + +N   V +    +++V+ ++ EHPGG   I    G D T      +
Sbjct: 408 LPLWDKQTFLAKSKENKGLV-IISGIVHDVSGYISEHPGGETLIKTALGKDATKAFSGGV 466

Query: 67  THEHSESAYEIMDE 80
            + HS +A  ++ +
Sbjct: 467 -YRHSNAAQNVLAD 479

>TDEL0G03650 Chr7 (673347..674798) [1452 bp, 483 aa] {ON} Anc_6.106
           YGL055W
          Length = 483

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 35/72 (48%), Gaps = 2/72 (2%)

Query: 7   LPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVL 66
           LP++ K D  K  +     V +    +++V+ ++ EHPGG   +    G D T      +
Sbjct: 382 LPVWDKQDFLKEMETRKGLVVI-SGIVHDVSGYITEHPGGETLLQAALGKDATKAFNGGV 440

Query: 67  THEHSESAYEIM 78
            + HS +A+ ++
Sbjct: 441 -YRHSNAAHNVL 451

>Kwal_23.5693 s23 (1277807..1279348) [1542 bp, 513 aa] {ON} YGL055W
           (OLE1) - delta-9-fatty acid desaturase [contig 11] FULL
          Length = 513

 Score = 31.2 bits (69), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 33  IYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLTHEHSESAYEIM 78
           +++VT F+ +HPGG   +    G D T      + + HS++A  ++
Sbjct: 410 VHDVTPFIHDHPGGVALVETSIGKDATQAFNGAV-YSHSQAARNLL 454

>AAL078W Chr1 (209600..211378) [1779 bp, 592 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGL055W
          Length = 592

 Score = 31.2 bits (69), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 33  IYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLTHEHSESAYEIM 78
           I++VT F+ +HPGG   ++   G D T      + + HS +A  ++
Sbjct: 496 IHDVTPFMHDHPGGMALVVASVGKDATPAFNGAV-YAHSTAARNLL 540

>KLTH0H06798g Chr8 (596966..598432) [1467 bp, 488 aa] {ON}
           uniprot|P79047 Delta 9-fatty acid desaturase
          Length = 488

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 36/72 (50%), Gaps = 2/72 (2%)

Query: 7   LPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVL 66
           LP++ K    + N K +  + +    +++V+ ++ EHPGG   I    G D T      +
Sbjct: 387 LPVWDKQQFME-NIKTNPGLVIISGIVHDVSNYITEHPGGETLIQAALGKDATKAFNGGV 445

Query: 67  THEHSESAYEIM 78
            + HS +A+ ++
Sbjct: 446 -YLHSNAAHNVL 456

>Suva_13.250 Chr13 complement(393510..394115) [606 bp, 201 aa] {ON}
           YMR073C (REAL)
          Length = 201

 Score = 30.0 bits (66), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 12/43 (27%), Positives = 26/43 (60%)

Query: 15  LEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTD 57
           ++KH    D +  +   K+Y+++ +L  HPGG++ +L +  +D
Sbjct: 130 VKKHCKGEDEFWCVINGKVYDISGYLKFHPGGSKIVLRHRDSD 172

>AFL079W Chr6 (290134..291750) [1617 bp, 538 aa] {ON} NOHBY604; No
          homolog in Saccharomyces cerevisiae
          Length = 538

 Score = 30.4 bits (67), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 14/57 (24%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 7  LPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMK 63
          + + SK+++E+     +  + +Y+  +  + +++  HPGG + I    G D TD M 
Sbjct: 1  MAVLSKSEVEERIANGEV-IVIYKSAVLKLDKWIKYHPGGDKAIYHMVGRDATDEMN 56

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.142    0.461 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 41,328,051
Number of extensions: 1770702
Number of successful extensions: 5142
Number of sequences better than 10.0: 114
Number of HSP's gapped: 5136
Number of HSP's successfully gapped: 114
Length of query: 381
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 270
Effective length of database: 40,753,473
Effective search space: 11003437710
Effective search space used: 11003437710
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 67 (30.4 bits)