Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D01617g8.838ON56256225710.0
Ecym_46098.838ON5204276861e-82
SAKL0D01518g8.838ON5744366333e-74
ABL128W8.838ON4744036011e-70
Kwal_27.102728.838ON5514195538e-63
KLTH0C03916g8.838ON5704135531e-62
TPHA0I002308.838ON6143773626e-36
TDEL0B005908.838ON5413643543e-35
Kpol_1068.108.838ON6173653539e-35
Smik_13.208.838ON5103653136e-30
ZYRO0G14146g8.838ON5074053136e-30
NCAS0B003108.838ON5643613084e-29
NDAI0E003008.838ON6643642944e-27
TBLA0D032508.838ON6832122926e-27
Suva_13.298.838ON5093732871e-26
YML114C (TAF8)8.838ON5103652843e-26
Skud_13.278.838ON5143652782e-25
KAFR0A028208.838ON4533462631e-23
CAGL0B02299g8.838ON6432272143e-17
KNAG0G034108.838ON5263001671e-11
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D01617g
         (562 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D01617g Chr4 complement(143940..145628) [1689 bp, 562 aa] {...   994   0.0  
Ecym_4609 Chr4 (1186861..1188423) [1563 bp, 520 aa] {ON} similar...   268   1e-82
SAKL0D01518g Chr4 complement(122448..124172) [1725 bp, 574 aa] {...   248   3e-74
ABL128W Chr2 (155096..156520) [1425 bp, 474 aa] {ON} Syntenic ho...   236   1e-70
Kwal_27.10272 s27 complement(271405..273060) [1656 bp, 551 aa] {...   217   8e-63
KLTH0C03916g Chr3 complement(342430..344142) [1713 bp, 570 aa] {...   217   1e-62
TPHA0I00230 Chr9 (41435..43279) [1845 bp, 614 aa] {ON} Anc_8.838...   144   6e-36
TDEL0B00590 Chr2 complement(113785..115410) [1626 bp, 541 aa] {O...   140   3e-35
Kpol_1068.10 s1068 complement(18964..20817) [1854 bp, 617 aa] {O...   140   9e-35
Smik_13.20 Chr13 complement(38299..39831) [1533 bp, 510 aa] {ON}...   125   6e-30
ZYRO0G14146g Chr7 (1126767..1128290) [1524 bp, 507 aa] {ON} weak...   125   6e-30
NCAS0B00310 Chr2 complement(37876..39570) [1695 bp, 564 aa] {ON}...   123   4e-29
NDAI0E00300 Chr5 complement(41787..43781) [1995 bp, 664 aa] {ON}...   117   4e-27
TBLA0D03250 Chr4 (807946..809997) [2052 bp, 683 aa] {ON} Anc_8.8...   117   6e-27
Suva_13.29 Chr13 complement(41778..43307) [1530 bp, 509 aa] {ON}...   115   1e-26
YML114C Chr13 complement(42043..43575) [1533 bp, 510 aa] {ON}  T...   114   3e-26
Skud_13.27 Chr13 complement(41670..43214) [1545 bp, 514 aa] {ON}...   111   2e-25
KAFR0A02820 Chr1 (584984..586345) [1362 bp, 453 aa] {ON} Anc_8.8...   105   1e-23
CAGL0B02299g Chr2 (217341..219272) [1932 bp, 643 aa] {ON} some s...    87   3e-17
KNAG0G03410 Chr7 (731420..733000) [1581 bp, 526 aa] {ON} Anc_8.8...    69   1e-11

>KLLA0D01617g Chr4 complement(143940..145628) [1689 bp, 562 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 562

 Score =  994 bits (2571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/562 (88%), Positives = 495/562 (88%)

Query: 1   MTTSEDKDKNDAKIETDQRRVRLDKLPNLNEVPHANPMERLFAQAVLLQLKTLNKNVVIS 60
           MTTSEDKDKNDAKIETDQRRVRLDKLPNLNEVPHANPMERLFAQAVLLQLKTLNKNVVIS
Sbjct: 1   MTTSEDKDKNDAKIETDQRRVRLDKLPNLNEVPHANPMERLFAQAVLLQLKTLNKNVVIS 60

Query: 61  QLAFDDLCYVXXXXXXXXXXXXXXITQVQRRTKISKLDLNLYFKGIGMDLKDLNGQVEIS 120
           QLAFDDLCYV              ITQVQRRTKISKLDLNLYFKGIGMDLKDLNGQVEIS
Sbjct: 61  QLAFDDLCYVSLLQLDDLLQSLKKITQVQRRTKISKLDLNLYFKGIGMDLKDLNGQVEIS 120

Query: 121 NFVHGKFKDEANALNETVLKVKQQFMXXXXXXXXXXXXXXXFFVQDVDILNLLPSSNKSN 180
           NFVHGKFKDEANALNETVLKVKQQFM               FFVQDVDILNLLPSSNKSN
Sbjct: 121 NFVHGKFKDEANALNETVLKVKQQFMKELEEKELLSSKHSEFFVQDVDILNLLPSSNKSN 180

Query: 181 KYVPSWLPELPPDHTYKFTSLYKRPITDERLMKKKLLEEGRLSEKALLNMLSQVVNQDPL 240
           KYVPSWLPELPPDHTYKFTSLYKRPITDERLMKKKLLEEGRLSEKALLNMLSQVVNQDPL
Sbjct: 181 KYVPSWLPELPPDHTYKFTSLYKRPITDERLMKKKLLEEGRLSEKALLNMLSQVVNQDPL 240

Query: 241 VALNKDSDQSANNAALSEHIKESQLETDLIFDPHKTIPTDKEWGTTTVLHGIESFNLSPV 300
           VALNKDSDQSANNAALSEHIKESQLETDLIFDPHKTIPTDKEWGTTTVLHGIESFNLSPV
Sbjct: 241 VALNKDSDQSANNAALSEHIKESQLETDLIFDPHKTIPTDKEWGTTTVLHGIESFNLSPV 300

Query: 301 KNFNVLEYCKKRDAIVKRRAERAENQVSNKRRNPFIRGAMICSPYGQGSTKSRKSVENQL 360
           KNFNVLEYCKKRDAIVKRRAERAENQVSNKRRNPFIRGAMICSPYGQGSTKSRKSVENQL
Sbjct: 301 KNFNVLEYCKKRDAIVKRRAERAENQVSNKRRNPFIRGAMICSPYGQGSTKSRKSVENQL 360

Query: 361 KTMLRRSYLGLIDSIPXXXXXXXXXXXXXXXXXXXXXXXXXIEKEKKMAEQEILDLNNLQ 420
           KTMLRRSYLGLIDSIP                         IEKEKKMAEQEILDLNNLQ
Sbjct: 361 KTMLRRSYLGLIDSIPRVKEVRERARKEAEERERLLQEQRRIEKEKKMAEQEILDLNNLQ 420

Query: 421 TDPLLHGWXXXXXXXXXXXXXKFLTQGPPEVQAITDTNISTLGELASELLHGPDEEKPME 480
           TDPLLHGW             KFLTQGPPEVQAITDTNISTLGELASELLHGPDEEKPME
Sbjct: 421 TDPLLHGWDKDSEDDDENDDEKFLTQGPPEVQAITDTNISTLGELASELLHGPDEEKPME 480

Query: 481 STETFEDVLPSITPANSTPLLSEVASGSASGLTPKDISEDAPEAGSEEAKSELALHTSPG 540
           STETFEDVLPSITPANSTPLLSEVASGSASGLTPKDISEDAPEAGSEEAKSELALHTSPG
Sbjct: 481 STETFEDVLPSITPANSTPLLSEVASGSASGLTPKDISEDAPEAGSEEAKSELALHTSPG 540

Query: 541 VATDELLENQSQDHDSNVNDLF 562
           VATDELLENQSQDHDSNVNDLF
Sbjct: 541 VATDELLENQSQDHDSNVNDLF 562

>Ecym_4609 Chr4 (1186861..1188423) [1563 bp, 520 aa] {ON} similar to
           Ashbya gossypii ABL128W
          Length = 520

 Score =  268 bits (686), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 152/427 (35%), Positives = 224/427 (52%), Gaps = 13/427 (3%)

Query: 1   MTTSEDKDKNDAKIETDQRRVRLDKLPNLNEVPHANPMERLFAQAVLLQLKTLNKNVVIS 60
           MTT  D   +D   E  +  ++L KLP L EV   NPM+ L +Q+V LQLKT+  +  I+
Sbjct: 1   MTT--DIKSSDGSTEGAKEFIQLKKLPGLQEVAKHNPMQILLSQSVALQLKTMKSDFSIT 58

Query: 61  QLAFDDLCYVXXXXXXXXXXXXXXITQVQRRTKISKLDLNLYFKGIGMDLKDLNGQVEIS 120
           +L F+++                    +QRR +IS  DL L+ KG G++++ L  + E S
Sbjct: 59  ELGFNNMMQFIEMQMNDMFQILHRFANIQRRNEISIKDLKLFLKGTGIEVQSLYDEFEKS 118

Query: 121 NFVHGKFKDEANALNETVLKVKQQFMXXXXXXXXXXXXXXXFFVQDVDILNLLPSSNKSN 180
            ++   ++ E   +    L + +++                FF +DVDILNL+P +N +N
Sbjct: 119 RYIKKTYEAEFKNIERQSLDLVEKWQKPLRDEELLSSNHAEFFFKDVDILNLVPPTNINN 178

Query: 181 KYVPSWLPELPPDHTYKFTSLYKRPITDERLMKKKLLEEGRLSEKALLNMLSQVVNQDPL 240
            YVP+WLPE PPDHTYKFT++Y +PI+DER MK+ L EEG+LSEKALLNML     Q  +
Sbjct: 179 SYVPTWLPEFPPDHTYKFTAIYNKPISDERQMKRMLFEEGKLSEKALLNMLGSA--QAKM 236

Query: 241 VALNKDSDQSANNAALSEHIKESQLETDLIFDPHKTIPT--DKEWGTTTVLHGIESFNLS 298
           + +  +         +++  KESQ ET LI+   K  P   +   G  +  +     N S
Sbjct: 237 LKVEDEE-------TIAQTYKESQEETQLIYGVEKQRPRRENAYVGGNSTNNDDLPLNSS 289

Query: 299 PVKNFNVLEYCKKRDAIVKRRAERAENQVSNKRRNPFIRGAMICSPYGQGSTKSRKSVEN 358
             K FN+ EY + R  + +R+ E  EN     ++NPFIR + ICSPYG     +RK+ E 
Sbjct: 290 HSKGFNIQEYARSRIGLARRKVEEFENHKLQAQKNPFIRASSICSPYGNAQKTTRKAAER 349

Query: 359 QLKTMLRRSYLGLIDSIPXXXXXXXXXXXXXXXXXXXXXXXXXIEKEKKMAEQEILDLNN 418
           +   +LRRSY+G++ SIP                         +E EKK  +Q ++DLN 
Sbjct: 350 EFNILLRRSYVGVLKSIPKLRQLKANEMAAAIERERIKQKEREMELEKKHLQQGVVDLNA 409

Query: 419 LQTDPLL 425
           L  D LL
Sbjct: 410 LHEDALL 416

>SAKL0D01518g Chr4 complement(122448..124172) [1725 bp, 574 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 574

 Score =  248 bits (633), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 151/436 (34%), Positives = 236/436 (54%), Gaps = 30/436 (6%)

Query: 3   TSEDKDKNDAKIETDQRRVRLDKLPNLNEVPH---ANPMERLFAQAVLLQLKTLNKNVVI 59
           T+E+    DA   + ++++RL KLP L+  PH     PM ++ +QAV ++LK +NK+V +
Sbjct: 2   TTEEASHKDAPAPS-RKQIRLKKLPTLHAAPHDSLEQPMHKILSQAVAIRLKPMNKDVAM 60

Query: 60  SQLAFDDLCYVXXXXXXXXXXXXXXITQVQRRTKISKLDLNLYFKGIGMDLKDLNGQVEI 119
           SQ AF++L  +                 +QRR +ISK DL L  KG  +   +L  ++E 
Sbjct: 61  SQFAFENLVQLVSENLSFMLTTLHRFVDIQRRREISKKDLLLLLKGYDLSNSELMRELES 120

Query: 120 SNFVHGKFKDEANALNETVLKVKQQFMXXXXXXXXXXXXXXXFFVQDVDILNLLPSSNKS 179
           S ++     ++ N + +   ++K + +               FF +D+DIL+L+P +NK+
Sbjct: 121 SQYIVSNHPEKVNKIAQKSKELKSKLLKPMTEKELLNSAHSEFFFKDMDILDLVPPTNKN 180

Query: 180 NKYVPSWLPELPPDHTYKFTSLYKRPITDERLMKKKLLEEGRLSEKALLNMLSQ--VVNQ 237
           N+Y+P WLPE PPDHTY+FTS Y +P+ DER +++KL+EEG+ SE+AL+N+L      NQ
Sbjct: 181 NQYIPKWLPEFPPDHTYRFTSQYNKPVVDERQLRRKLVEEGKQSERALVNLLKHHDSTNQ 240

Query: 238 DPLVALNKDSDQSANNAALSEH--IKESQLETDLIFDPHKTIPTDKEWGTTTVLHGIESF 295
           D             NN  + +    +E+Q ET LIF P +     K+  TT   H  E  
Sbjct: 241 D-----------LGNNERVEKRSLYEETQEETFLIFGPER-----KKSHTTENSH--ELL 282

Query: 296 NLSPVKNFNVLEYCKKRDAIVKRRAERAENQVSNKRRNPFIRGAMICSPYGQGSTKSRKS 355
              P+KNF+V EY + R  I +R+    E      ++NPFI+ A +CSP  + ST SRK+
Sbjct: 283 RTLPLKNFSVEEYARNRVEIARRKVLEYEQYQLRLQKNPFIKAANLCSPL-KKSTMSRKA 341

Query: 356 VENQLKTMLRRSYLGLIDSIPXXXXXXXXXXXXXXXXXXXXXXXXXIEKEKKM---AEQE 412
           ++ +LK+ML+RSY+GL+ S+P                          E++++       E
Sbjct: 342 IDKELKSMLQRSYIGLLRSVPKLNEVKARERELANERRREMLEKLNEERQRQAEAGGGDE 401

Query: 413 ILDLNNLQTDPLLHGW 428
           +LDLNNL  DPLL G+
Sbjct: 402 VLDLNNLNEDPLLAGF 417

>ABL128W Chr2 (155096..156520) [1425 bp, 474 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML114C (TAF65)
          Length = 474

 Score =  236 bits (601), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 135/403 (33%), Positives = 199/403 (49%), Gaps = 27/403 (6%)

Query: 21  VRLDKLPNLNEVPHANPMERLFAQAVLLQLKTLNKNVVISQLAFDDLCYVXXXXXXXXXX 80
           ++L KLP+L EV  +NPM++L AQAV L LKT+  +V I+QL F++L             
Sbjct: 19  IQLKKLPDLTEVTKSNPMQKLLAQAVGLHLKTMRSDVGITQLGFENLVQFVELQLDDMLQ 78

Query: 81  XXXXITQVQRRTKISKLDLNLYFKGIGMDLKDLNGQVEISNFVHGKFKDEANALNETVLK 140
                  VQRR ++S  D+ L+  G G++ + L  +   S +V  +      ++ E    
Sbjct: 79  ILHRFANVQRRNEVSLKDVRLFLHGCGVEEESLYEEYVRSQYVRQQHAGAVRSIEEQSAS 138

Query: 141 VKQQFMXXXXXXXXXXXXXXXFFVQDVDILNLLPSSNKSNKYVPSWLPELPPDHTYKFTS 200
           +   +                FF +DVDILNL+P +N +N YVP WLPE PPDHTYKFTS
Sbjct: 139 LMGHWHQPMSEEELLSSSHAEFFFKDVDILNLVPPTNNNNHYVPKWLPEFPPDHTYKFTS 198

Query: 201 LYKRPITDERLMKKKLLEEGRLSEKALLNMLSQVVNQDPLVALNKDSDQSANNAALSEHI 260
           +Y +PITDER MK+KL EE +LSEKALL+ML     +             A++A L + I
Sbjct: 199 IYNQPITDERQMKRKLFEESKLSEKALLHMLGTATKKP-----------RADDAQLPQII 247

Query: 261 KESQLETDLIFDPHKTIPTDKEWGTTTVLHGIESFNLSPVKNFNVLEYCKKRDAIVKRRA 320
            + Q E  LI+ P +     +                +P + FN+ +Y + R  + +RR 
Sbjct: 248 SDGQQENLLIYGPERRRLAPEP---------------APTRGFNIEDYARCRVELARRRV 292

Query: 321 ERAENQVSNKRRNPFIRGAMICSPYGQGSTKSRKSVENQLKTMLRRSYLGLIDSIPXXXX 380
           E  E Q    ++NPFIR A  CSPY   +  SRK++E +   +L RSY+G++ +IP    
Sbjct: 293 EEFEQQKLQVQKNPFIRAAAACSPYAT-TRLSRKAIEREFGVLLHRSYIGVLHAIPRLRR 351

Query: 381 XXXXXXXXXXXXXXXXXXXXXIEKEKKMAEQEILDLNNLQTDP 423
                                   +    +  +LDL+ L  DP
Sbjct: 352 TKARELAAAYERERARQESMRNNTDLTQQQHGVLDLSALHDDP 394

>Kwal_27.10272 s27 complement(271405..273060) [1656 bp, 551 aa] {ON}
           YML114C (TAF8) - TAF65, subunit of transcription factor
           TFIID [contig 37] FULL
          Length = 551

 Score =  217 bits (553), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 146/419 (34%), Positives = 211/419 (50%), Gaps = 30/419 (7%)

Query: 18  QRRVRLDKLPNLNEVPHAN---PMERLFAQAVLLQLKTLNKNVVISQLAFDDLCYVXXXX 74
           QR V+L  LP L+E+P A+   P+++L  +A+ +QLK++N +  ISQLAF++L  +    
Sbjct: 16  QRVVQLKNLPTLHEIPKADMDDPLKKLLEKAIAIQLKSINADASISQLAFENLIILVEEM 75

Query: 75  XXXXXXXXXXITQVQRRTKISKLDLNLYFKGIGMDLKDLNGQVEISNFVHGKFKDEANAL 134
                     +  +QRR  ISK DL L  +G  +   DL  ++E S +V  +  ++   +
Sbjct: 76  LSNMLMDLHKMANIQRRHCISKKDLLLIIEGYNLSSSDLMLELERSRYVRSRHLEQIKKV 135

Query: 135 NETVLKVKQQFMXXXXXXXXXXXXXXXFFVQDVDILNLLPSSNKSNKYVPSWLPELPPDH 194
            E    V++Q                 FFV D D+L L+P S K  K+VP WLP+ PPDH
Sbjct: 136 EEDSKYVEKQEHTPLTQNELLSSTHPEFFVLDKDVLTLVPPSVKDTKHVPRWLPDFPPDH 195

Query: 195 TYKFTSLYKRPITDERLMKKKLLEEGRLSEKAL--LNMLS-QVVNQDPLVALNKDSDQSA 251
           TY+FT+ Y +PITDERLMK+KL EE  LSEKAL  L+MLS +  +  P+     DSD   
Sbjct: 196 TYRFTAQYNKPITDERLMKRKLAEEANLSEKALIHLSMLSHEEASSGPI-----DSDTI- 249

Query: 252 NNAALSEHIKESQLETDLIFDPHKTIPTDKEWGTTTVLHGIESFNLSPVKNFNVLEYCKK 311
                    +E+Q ET L+F P K   T        +L  +      P +NF+V EY + 
Sbjct: 250 --------YEEAQQETQLLFGPVKKKKTAAINEVNDLLRTL------PQQNFSVEEYARN 295

Query: 312 RDAIVKRRAERAENQVSNKRRNPFIRGAMICSPYGQGSTKSRKSVENQLKTMLRRSYLGL 371
           R  I +RR    E      ++  FI+ A + SP+ +  T S K VE +++T+L RS +GL
Sbjct: 296 RVEIARRRVNEYERHQLQLQKGAFIKAAHLLSPFSKKRT-SCKQVEKEIRTLLHRSRIGL 354

Query: 372 IDSIPXXXXXXXXXXXXXXXXXXXXXXXXXIEKE---KKMAEQEILDLNNLQTDPLLHG 427
           + S P                          E+E   K   E ++LDLNNL  DP   G
Sbjct: 355 LKSAPSLKERRKREIALAEENRRLRDEKLRKEREARSKSSNEFDVLDLNNLNEDPFFGG 413

>KLTH0C03916g Chr3 complement(342430..344142) [1713 bp, 570 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 570

 Score =  217 bits (553), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 143/413 (34%), Positives = 205/413 (49%), Gaps = 25/413 (6%)

Query: 21  VRLDKLPNLNEVPHA---NPMERLFAQAVLLQLKTLNKNVVISQLAFDDLCYVXXXXXXX 77
           V+L  LPNL E+P     +P+ +L  +AV +QLK +N NV ISQ AF++L  +       
Sbjct: 19  VQLRHLPNLEEIPRTALDDPLRKLLEKAVAIQLKAVNSNVSISQFAFENLIILVEQMLSN 78

Query: 78  XXXXXXXITQVQRRTKISKLDLNLYFKGIGMDLKDLNGQVEISNFVHGKFKDEANALNET 137
                  +  +QRR  ISK DL L   G  +   DL  ++E S +V     +    + E 
Sbjct: 79  MLVDLHKMVNIQRRHCISKKDLLLIIDGYNLTCADLMVELERSQYVRSHNLERVRKVREE 138

Query: 138 VLKVKQQFMXXXXXXXXXXXXXXXFFVQDVDILNLLPSSNKSNKYVPSWLPELPPDHTYK 197
              V+ +                 FF+QD +IL L+P + K+ KYVP WLPE PPDHTY+
Sbjct: 139 SEVVEAKEKTPLSEKELLESKHLEFFIQDKEILTLVPPTPKNTKYVPRWLPEFPPDHTYR 198

Query: 198 FTSLYKRPITDERLMKKKLLEEGRLSEKALLNMLSQVVNQDPLVALNKDSDQSANNAALS 257
           FTS + RPITDERLMK+KL EE  LSEKAL+++      + P  +   DSD         
Sbjct: 199 FTSQFNRPITDERLMKRKLAEEADLSEKALIHLSKLSHEESP--SEGADSD--------- 247

Query: 258 EHIKESQLETDLIFDPHKTIPTDKEWGTTTVLHGIESFNLSPVKNFNVLEYCKKRDAIVK 317
           E  KESQ +T LIF P K        G + +L  +      P +N+NV EY + R  I +
Sbjct: 248 EIFKESQQDTQLIFGPAKKTKIAAINGASDLLRTL------PQQNYNVEEYARNRVEIAR 301

Query: 318 RRAERAENQVSNKRRNPFIRGAMICSPYGQGSTKSRKSVENQLKTMLRRSYLGLIDSIPX 377
           R+ E  E      ++  FI+ A + SP+ +   ++ K VE +++T+L RSY+GL+ S P 
Sbjct: 302 RKVEEYERHQLLLQKGAFIKAAHLLSPFAK--KRNCKQVEKEVRTLLHRSYIGLLKSAPL 359

Query: 378 XXXXXXXXXXXXXXXXXXXXXXXXIEKE---KKMAEQEILDLNNLQTDPLLHG 427
                                    E+E   K   + ++LDL+NL  DP   G
Sbjct: 360 LREQRKREVELAEENRRLREEQIRQEREERLKNSKDYDVLDLDNLNEDPFFGG 412

>TPHA0I00230 Chr9 (41435..43279) [1845 bp, 614 aa] {ON} Anc_8.838
           YML114C
          Length = 614

 Score =  144 bits (362), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 102/377 (27%), Positives = 182/377 (48%), Gaps = 33/377 (8%)

Query: 11  DAKIETDQRRVRLDKLPNLNEVPHAN---PMERLFAQAVLLQLKTLNKNVVISQLAFDDL 67
           D ++   ++ V+L KLP L E  + +   PME + A+A+ LQLK +N++  I++ AF  L
Sbjct: 36  DKEVTEQKKYVQLTKLPTLTEFKYEDTKGPMEVILAKAIALQLKLMNRDTTITKFAFTHL 95

Query: 68  CYVXXXXXXXXXXXXXXITQVQRRTKISKLDLNLYFKGIGMDLKDLNGQVEISNFVHGKF 127
             +              +  +QRR +++K D++L+ +G  +   DL    + S ++  K+
Sbjct: 96  TSLVDEQLSDMVNQMEKLAALQRRKEVAKKDIDLWLRGFNLQPSDLTITHQQSEYIKEKY 155

Query: 128 KDEANALNETVLKVKQQFMXXXXXXXXXXXXXXXFFVQDVDILNLLPSSNKSNKYVPSWL 187
             E   LN       +                       ++ L L+P +N     +P WL
Sbjct: 156 GGEVTLLNRLATDTNEVLTVFKKTDKTLKDDST------LETLKLVPITNTLENIIPDWL 209

Query: 188 PELPPDHTYKFTSLYKRPITDERLMKKKLLEEGRLSEKALLNML-SQVVNQDPLVALNK- 245
           P  PPD+TYKFT  + + ITD  +++KK+  EG+ SEKALL++L S+ +    L+ L+K 
Sbjct: 210 PSFPPDYTYKFTPQFNKHITDATVIRKKVAAEGKKSEKALLHLLESEKITTSKLLNLDKF 269

Query: 246 DSDQSANNAALSEHIKESQLETDLIFD------PHKTIPTDKEWGTTTVLHGIESFNLSP 299
           DSD           +  ++LE D ++         +T   + E       HG  + N   
Sbjct: 270 DSDD----------MDTAKLEMDALYSGGSCDRKKRTAFFEDEEDRMVDEHGNSTSN--- 316

Query: 300 VKNFNVLEYCKKRDAIVKRRAERAENQVSNKRRNPFIRGAMICSPYGQGSTKSRKSVENQ 359
              F++ +Y  KR  IV+ + ++ E++    + +PF++   + S        SR+ +   
Sbjct: 317 --KFDIEKYVHKRINIVRNKVKQYEDKQLRLQNDPFLKMTALLSEQTDKKV-SREVINTN 373

Query: 360 LKTMLRRSYLGLIDSIP 376
           ++ +L+RS+L LI+SIP
Sbjct: 374 IENVLKRSFLQLINSIP 390

>TDEL0B00590 Chr2 complement(113785..115410) [1626 bp, 541 aa] {ON}
           Anc_8.838 YML114C
          Length = 541

 Score =  140 bits (354), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 103/364 (28%), Positives = 182/364 (50%), Gaps = 39/364 (10%)

Query: 18  QRRVRLDKLPNLNEVPHAN---PMERLFAQAVLLQLKTLNKNVVISQLAFDDLCYVXXXX 74
           +R ++L  LP L+E+ H      + ++ ++AV LQLK +  +  IS+ AF+ L  +    
Sbjct: 7   ERHIQLTHLPTLDEIDHGKTEAAVVKILSKAVALQLKPMKAD--ISKFAFEHLMILIDDQ 64

Query: 75  XXXXXXXXXXITQVQRRTKISKLDLNLYFKGIGMDLKDLNGQVEISNFVHGKFKDEANAL 134
                      + VQRR  I+K D++L+ +G  +   DL+ Q + S +    +  E ++L
Sbjct: 65  LNDMIGQLHRFSNVQRRESIAKGDVHLFLQGYNLTPADLDKQHQASQYYSKTYGKEFDSL 124

Query: 135 NETVLKVKQQFMXXXXXXXXXXXXXXXFFVQDVDILN-LLPSSNKSNKYVPSWLPELPPD 193
           +     +K+ F                      D++N L+  +N   +Y+P W+P  PPD
Sbjct: 125 H----SLKETFTDAVVDEDNGSE----------DVINELVRPNNPLIRYIPKWMPAFPPD 170

Query: 194 HTYKFTSLYKRPITDERLMKKKLLEEGRLSEKALLNMLSQVVNQDPLVALNKDSDQSANN 253
           HTYKFT  Y +PITDE ++++++++EG+ SE ALL++L    N +P    + D+D ++ +
Sbjct: 171 HTYKFTPQYNQPITDETIIRRRIVDEGKQSEVALLHLLK---NMNPPTP-SSDADGASYD 226

Query: 254 AALSEHIKESQLETDLIFDPHKTIPTDKEWGTTTVLHGIESFNLSPVKNFNVLEYCKKRD 313
            AL   ++E   ET  I+        +++          +  +  P  NF++ EY + R 
Sbjct: 227 EAL---VRE---ETAAIYG------NEQKKRKKNASSSSDLLSKLPQTNFSIEEYARSRV 274

Query: 314 AIVKRRAERAENQVSNKRRNPFIRGAMICSPYGQGSTKS-RKSVENQLKTMLRRSYLGLI 372
            I +++    E +    +RNPFI+ + I       S KS R+    ++ +ML+RS   LI
Sbjct: 275 EIARKKVVEYEERQMKLQRNPFIKYSKIA--LSNSSDKSGRRQATREIHSMLQRSLQHLI 332

Query: 373 DSIP 376
            SIP
Sbjct: 333 KSIP 336

>Kpol_1068.10 s1068 complement(18964..20817) [1854 bp, 617 aa] {ON}
           complement(18964..20817) [1854 nt, 618 aa]
          Length = 617

 Score =  140 bits (353), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 102/365 (27%), Positives = 175/365 (47%), Gaps = 37/365 (10%)

Query: 19  RRVRLDKLPNLNEVPHAN---PMERLFAQAVLLQLKTLNKNVVISQLAFDDLCYVXXXXX 75
           + ++L +LP L E  +      +E++ A+AV LQLK++N +  I++ AF+ L  +     
Sbjct: 7   KYIQLTELPTLTEYKYEETEPAIEKILAKAVALQLKSMNCDTSITKFAFEHLMSLVVGQI 66

Query: 76  XXXXXXXXXITQVQRRTKISKLDLNLYFKGIGMDLKDLNGQVEISNFVHGKFKDEANALN 135
                    ++ +QRR  ++K D++++ +G  +  +DL  Q + S ++   +  +  +L 
Sbjct: 67  DDMVLELHRLSSLQRRNTVAKADISVWLRGFNLTPEDLEEQNQKSQYLSKLYDKDYESLT 126

Query: 136 ETVLKVKQQFMXXXXXXXXXXXXXXXFFVQDVDILNLLPSSNKSNKYVPSWLPELPPDHT 195
           +      +                            L+P SN   K +PSWLP+ PPD+T
Sbjct: 127 KIATTTTRTLSTYQKLDLTHKDTST------AQTSKLVPISNPLQKLIPSWLPDFPPDYT 180

Query: 196 YKFTSLYKRPITDERLMKKKLLEEGRLSEKALLNMLSQVVNQDPLVALNKDSDQSANNAA 255
           YKFT  Y  PITDE ++++K++EEG+ SEKALLN+L                 +      
Sbjct: 181 YKFTPQYNTPITDETIIRRKVVEEGKQSEKALLNLL-----------------RGGQEDR 223

Query: 256 LSEHIKESQLETDLIFDPHKTIPTDKEWGTTTVL--HGIESFNLSPVKN-FNVLEYCKKR 312
           +S  +K S  E +L  +  +T+ T   +   T+   H    F   P++N  NV EY + R
Sbjct: 224 ISRDLKFSSSEMELATE--ETLAT---YSAITLRNKHLTSFFEKEPIQNSLNVEEYARTR 278

Query: 313 DAIVKRRAERAENQVSNKRRNPFIRGAMICSPYGQGSTKSRKSVEN-QLKTMLRRSYLGL 371
             I +++    E +    +RNPF++ + + S       K  KSV N +++  L+RS L  
Sbjct: 279 VEIERKKVLGYEERQLQIQRNPFLKISRLIS--ANNDNKVSKSVANTEIRKYLKRSLLNF 336

Query: 372 IDSIP 376
           I SIP
Sbjct: 337 IHSIP 341

>Smik_13.20 Chr13 complement(38299..39831) [1533 bp, 510 aa] {ON}
           YML114C (REAL)
          Length = 510

 Score =  125 bits (313), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 99/365 (27%), Positives = 162/365 (44%), Gaps = 45/365 (12%)

Query: 21  VRLDKLPNLNEVPHAN---PMERLFAQAVLLQLKTLNKNVVISQLAFDDLCYVXXXXXXX 77
           V+L +LP+L E+ H     P+  +  + VL QL +LN  + IS  A D+L  +       
Sbjct: 17  VQLRRLPDLTEISHLEIDAPVVEILKKTVLFQLNSLN--ICISNFALDELVNLVAVQMDG 74

Query: 78  XXXXXXXITQVQRRTKISKLDLNLYFKGIGMDLKDLNGQVEISNFVHGKFKDEANALNET 137
                  +T +QRR++ S+ DL L F+   +D   L  Q ++S F+        +A+   
Sbjct: 75  MFRNLHNLTLLQRRSEASQADLKLLFREFNVDAASLYQQFQVSEFIKSN-----HAVEYG 129

Query: 138 VLKVKQQFMXXXXXXXXXXXXXXXFFVQDVDILNLLPSSNKSNKYVPSWLPELPPDHTYK 197
            L     F                   Q  +I  LLP SN   K +PSWLP  PPDHTYK
Sbjct: 130 KLVRLSSFPALAHNEEDEEDELSNIEEQQSEINVLLPPSNPLEKLIPSWLPNFPPDHTYK 189

Query: 198 FTSLYKRPITDERLMKKKLLEEGRLSEKALLNM------LSQVVNQDPLVALNKDSDQSA 251
           FT  +  PITD + +KK++++E   SEKALLN+      LS   +  P   L+ D+D + 
Sbjct: 190 FTPEFNHPITDLKTIKKEIVKESEESEKALLNLNKRLSHLSSASHTSPPPVLD-DADAT- 247

Query: 252 NNAALSEHIKESQLETDLIFDPHKTIPTDKEWGTTTVLHGIESFNLSPVKNFNVLEYCKK 311
                     E QLE                WG   +     +   + +   N+ +Y K 
Sbjct: 248 ----------EQQLEI---------------WG-NALQERKPTITATSLNESNIEQYAKY 281

Query: 312 RDAIVKRRAERAENQVSNKRRNPFIRGAMICSPYGQGSTKSRKSVENQLKTMLRRSYLGL 371
           R  + + R  + E     + +NPF++ +     + +G  +S K++++ +    R+S    
Sbjct: 282 RVELARERVAKFELNQLKRTKNPFLKLSETLY-FSEGPHQSHKTIQSAIDLQFRKSMTLF 340

Query: 372 IDSIP 376
           + ++P
Sbjct: 341 MHNLP 345

>ZYRO0G14146g Chr7 (1126767..1128290) [1524 bp, 507 aa] {ON} weakly
           similar to uniprot|Q03750 Saccharomyces cerevisiae
           YML114C TAF8 TFIID subunit (65 kDa) involved in RNA
           polymerase II transcription initiation
          Length = 507

 Score =  125 bits (313), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 105/405 (25%), Positives = 188/405 (46%), Gaps = 33/405 (8%)

Query: 21  VRLDKLPNLNEVPHANP---MERLFAQAVLLQLKTLNKNVVISQLAFDDLCYVXXXXXXX 77
           +++ KLP L E+ H +    + ++ A++V LQLK +N    I+Q AFD L  +       
Sbjct: 5   IQITKLPTLQELQHEDREPNVVKVLAKSVALQLKPMNAQ--ITQFAFDRLLQLVDGQLND 62

Query: 78  XXXXXXXITQVQRRTKISKLDLNLYFKGIGMDLKDLNGQVEISNFVHGKFKDEANALNET 137
                  ++ +QRR  I+K D+++  +G  +    +  Q  IS F   K+  E N L+  
Sbjct: 63  MISQLHRMSNLQRRETIAKGDISMLMEGFNISPSSIELQSRISEFYSQKYFKEFNHLHS- 121

Query: 138 VLKVKQQFMXXXXXXXXXXXXXXXFFVQDVDILNLLPSSNKSNKYVPSWLPELPPDHTYK 197
            L+  Q  +                  Q+V  + L+P +N    ++P WLP+ PPDHTYK
Sbjct: 122 -LRDLQSSLAHEMVPFEDQEAVR----QNVSTV-LVPPTNPLQDFLPKWLPDFPPDHTYK 175

Query: 198 FTSLYKRPITDERLMKKKLLEEGRLSEKALLNMLSQVVNQDPLVALNKDSDQSANNAALS 257
           FT  Y  PITDE  ++++++EE + SE AL ++  +    D +V  ++   + A    L+
Sbjct: 176 FTPQYSHPITDETTIRRQIVEEAKQSELALSHLSQKKNPTDDIVNRSQYDSELAEQETLA 235

Query: 258 EHIKESQLETDLIFDPHKTIPTDKEWGTTTVLHGIESFNLSPVKNFNVLEYCKKRDAIVK 317
             I  SQL+      P        +  +  +L  +      P  NF+V EY   R  + +
Sbjct: 236 --IYGSQLKKRKTQHP--------QANSADLLSKL------PQTNFSVEEYAHNRIEVAR 279

Query: 318 RRAERAENQVSNKRRNPFIRGAMICSPYGQGSTK-SRKSVENQLKTMLRRSYLGLIDSIP 376
           ++    E +    +++PF++ + I   + Q + K ++K V  + +  L+RS++ L+ SIP
Sbjct: 280 KKVLEFEERQLQSQQDPFLKLSRIA--FTQCNDKFTKKQVHREFQLALQRSFIHLVKSIP 337

Query: 377 XXXXXXXXXXXXXXXXXXXXXXXXXIEKE--KKMAEQEILDLNNL 419
                                     ++E  +K  E+++LDL+ L
Sbjct: 338 ELERNKLETEEKAKEERSKRLQELRAQREEQEKKGERDVLDLDEL 382

>NCAS0B00310 Chr2 complement(37876..39570) [1695 bp, 564 aa] {ON}
           Anc_8.838 YML114C
          Length = 564

 Score =  123 bits (308), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 99/361 (27%), Positives = 171/361 (47%), Gaps = 32/361 (8%)

Query: 23  LDKLPNLNEVPHANPME---RLFAQAVLLQLKTLNKNVVISQLAFDDLCYVXXXXXXXXX 79
           +++L N  E+P  +  E   +L  +++ LQLK LN  + +SQLAF++L  +         
Sbjct: 30  MNELTNPTEIPSNSSDEQVRKLLNKSIALQLKPLN--LELSQLAFNELSLLVNDQLDFLI 87

Query: 80  XXXXXITQVQRRTKISKLDLNLYFKGIGMDLKDLNGQVEISNFVHGKFKDEANALNETVL 139
                ++ +QRR   +K D+ L  +G+ +++ +L+ Q+++SNF+  K   + + L     
Sbjct: 88  SELHRMSVIQRRNAAAKTDIELLLRGLNLNMSELHYQLQVSNFMKSKNGKDYDTL----- 142

Query: 140 KVKQQFMXXXXXXXXXXXXXXXFFVQDVDILNLLPSSNKSNKYVPSWLPELPPDHTYKFT 199
            +K                         +IL  +  +N     +P+WLP  PPDHTYKFT
Sbjct: 143 -IKDSSTIFDSSDTMANPGHDSMVNNPSNIL--IKPNNPFEISIPNWLPAFPPDHTYKFT 199

Query: 200 SLYKRPITDERLMKKKLLEEGRLSEKALLNMLSQVVNQDPLVALNKDSDQSANNAALSEH 259
             + +PITD+ L+K+KL+EEG+ SEK+LLN+L+ +  Q            S  N   S  
Sbjct: 200 PQFNKPITDQVLIKQKLIEEGKKSEKSLLNLLNDITEQ-----------SSIENEETSNF 248

Query: 260 IKESQLETDLIFDPHKTIPTDKEWGTTTV-LHGIES--FNL-SPVKNFNVLEYCKKRDAI 315
             E   E ++    +  +   K      + +H  E   FN     K+FNV  Y   R  +
Sbjct: 249 DSELAREENIAIYGYDAMSRKKRKPPHLISIHDTEQNFFNHPQGSKHFNVGNYAHFRVEL 308

Query: 316 VKRRAERAENQVSNKRRNPFIRGAMICSPYGQGSTKSRKSVENQLKTMLRRSYLGLIDSI 375
            ++R E  E +     +NPF+R + + +        SR  ++ ++K  L+RSY  +  + 
Sbjct: 309 TRKRVEEFELEQLKWEKNPFLRLSRMIN----DKKVSRSDLKLEIKNSLQRSYKSIFRNY 364

Query: 376 P 376
           P
Sbjct: 365 P 365

>NDAI0E00300 Chr5 complement(41787..43781) [1995 bp, 664 aa] {ON}
           Anc_8.838 YML114C
          Length = 664

 Score =  117 bits (294), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 100/364 (27%), Positives = 161/364 (44%), Gaps = 74/364 (20%)

Query: 38  MERLFAQAVLLQLKTLNKNVVISQLAFDDLCYVXXXXXXXXXXXXXXITQVQRRTKISKL 97
           +E+L  +++ +QLK     V  S+LAF+ L  +              ++ +QRR  ++K+
Sbjct: 30  IEKLLQKSIAIQLKAFK--VDFSKLAFNQLTLLVDDQLNSLITELHRLSLLQRRNSMAKV 87

Query: 98  DLNLYFKGIGMDLKDLNGQVEISNFVHGKFKDEA----NALNETVLKVKQQFMXXXXXXX 153
           DL L+ +G  ++  DLN Q E S ++  K   +       LNE V+K +   M       
Sbjct: 88  DLELWMRGFNINPSDLNYQYESSKYIQEKLSGKEYRILRDLNEEVVKQRTHIMESSTSDD 147

Query: 154 XXXXXXXXFFVQDV-DILNLL--PSSNKSNKYVPSWLPELPPDHTYKFTSLYKRPITDER 210
                     + D  D  N+L  P++      + SWLP  PPDHTYKFT  +  PITDE+
Sbjct: 148 NYDLTKQFRNISDATDSSNILIKPTNPFKGINISSWLPSFPPDHTYKFTPQFNNPITDEK 207

Query: 211 LMKKKLLEEGRLSEKALLNMLSQV--------------------VNQDPLVALNKDSDQS 250
           L+K+KL+EEG  SEKALLN L  +                     N+ P+   +++  Q+
Sbjct: 208 LIKQKLVEEGTKSEKALLNFLKNISNAKKGTSIAPMTIPPSPSLSNEGPITDTDEEEKQA 267

Query: 251 ANNAALSEHIKESQLETDLIFDPHKTIPTDKE-----------WGTTTVLHGIE------ 293
            N        KE + E  +I      IP D +           +GT +  + IE      
Sbjct: 268 KNE-------KEKEQEDTVI------IPKDIDMNLANEETLAIYGTKSQSYEIERDSSSK 314

Query: 294 ------------SF--NLSPVKNFNVLEYCKKRDAIVKRRAERAENQVSNKRRNPFIR-G 338
                       +F  + S  K F+V +Y   R  +V+++ E  EN+     +NPF++  
Sbjct: 315 PNIISIHDEKIVNFFGHSSSDKKFDVNKYSHHRVELVRKKVEAFENKKLRLEKNPFLKLS 374

Query: 339 AMIC 342
            ++C
Sbjct: 375 KLVC 378

>TBLA0D03250 Chr4 (807946..809997) [2052 bp, 683 aa] {ON} Anc_8.838
           YML114C
          Length = 683

 Score =  117 bits (292), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 71/212 (33%), Positives = 109/212 (51%), Gaps = 3/212 (1%)

Query: 23  LDKLPNLNEVPH---ANPMERLFAQAVLLQLKTLNKNVVISQLAFDDLCYVXXXXXXXXX 79
           L  LP+L + P+   ++ + +L A+++ LQLK +N N  IS +AF+ L  +         
Sbjct: 42  LKNLPDLIQSPNRLESSCIGQLLAKSIALQLKPMNDNTSISTVAFNRLLTLVDLQLNDMI 101

Query: 80  XXXXXITQVQRRTKISKLDLNLYFKGIGMDLKDLNGQVEISNFVHGKFKDEANALNETVL 139
                ++  QRR  I+  DL+L+ +   ++  DL   +E SNF+  KF  + N L E + 
Sbjct: 102 YQLARLSITQRRLTIASNDLSLWLRSFNLNPSDLTLYLEESNFIKSKFNKDYNLLYELLR 161

Query: 140 KVKQQFMXXXXXXXXXXXXXXXFFVQDVDILNLLPSSNKSNKYVPSWLPELPPDHTYKFT 199
               +                     +     ++P SN   + +P WLP LPPDHTYKFT
Sbjct: 162 DYNTETNHNFKNPNYSTSDLLNNKSSESSSSRIVPPSNTILRSMPEWLPSLPPDHTYKFT 221

Query: 200 SLYKRPITDERLMKKKLLEEGRLSEKALLNML 231
            LY  PITDE +MKK L+ EG+L+E AL+ +L
Sbjct: 222 PLYNEPITDETVMKKILVNEGKLAESALIKLL 253

>Suva_13.29 Chr13 complement(41778..43307) [1530 bp, 509 aa] {ON}
           YML114C (REAL)
          Length = 509

 Score =  115 bits (287), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 100/373 (26%), Positives = 162/373 (43%), Gaps = 56/373 (15%)

Query: 18  QRRVRLDKLPNLNEVPHAN---PMERLFAQAVLLQLKTLNKNVVISQLAFDDLCYVXXXX 74
           Q  V+L  LP+L EV H     P+  +  ++VL QL +LN  + IS  A D++  +    
Sbjct: 14  QTMVQLTNLPDLTEVSHLEIDAPVLEILKKSVLFQLNSLN--ICISNFALDEMVNLVAVQ 71

Query: 75  XXXXXXXXXXITQVQRRTKISKLDLNLYFKGIGMDLKDLNGQVEISNFVHGKFKDEANAL 134
                     +  +QRR+++S+ DL L F+   ++   L  Q++IS  +  K   E   L
Sbjct: 72  MDGMFRNLHNLALLQRRSQVSQADLKLLFREFNLNSASLFQQLQISEHIKSKHSVEYEKL 131

Query: 135 NETVLKVKQQFMXXXXXXXXXXXXXXXFFVQDVDILNLLPSSNKSNKYVPSWLPELPPDH 194
            ++       F                   Q  +I  LLP SN   K +PSWLP  PPDH
Sbjct: 132 VKS-----SSFTAVSHIEDDEEDEINNIEEQQNEINVLLPPSNPLEKLIPSWLPNFPPDH 186

Query: 195 TYKFTSLYKRPITDERLMKKKLLEEGRLSEKALLNMLSQV-----VNQDPLVALNKDSDQ 249
           TYKFT  +  PITD + +K+++++E   SE+ALLN+  ++      +  P   L   SD 
Sbjct: 187 TYKFTPEFNHPITDLKTIKREIVKESGESERALLNLNKRLFRISSASHTPSPRLPDASDA 246

Query: 250 SANNAALSEHIKESQLETDLIFDPHKTIPTDKEWGTTTVLHG------IESFNLSPVKNF 303
           S             +LE                WG T  LH        +SFN       
Sbjct: 247 S------------ERLEI---------------WGNT--LHERKPAIIAKSFNEK----- 272

Query: 304 NVLEYCKKRDAIVKRRAERAENQVSNKRRNPFIRGAMICSPYGQGSTKSRKSVENQLKTM 363
           N+ +Y K R  + + R  + E     + +NPF++ +     + +   +S K ++  +   
Sbjct: 273 NIEQYAKYRIELARERVSKFEVNQLKRTKNPFLKISESLYSF-KNPHQSHKVIQRSIDLQ 331

Query: 364 LRRSYLGLIDSIP 376
           LR+S    + ++P
Sbjct: 332 LRKSVTLFMHNLP 344

>YML114C Chr13 complement(42043..43575) [1533 bp, 510 aa] {ON}
           TAF8TFIID subunit (65 kDa), involved in RNA polymerase
           II transcription initiation
          Length = 510

 Score =  114 bits (284), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 98/365 (26%), Positives = 155/365 (42%), Gaps = 45/365 (12%)

Query: 21  VRLDKLPNLNEVPHAN---PMERLFAQAVLLQLKTLNKNVVISQLAFDDLCYVXXXXXXX 77
           V+L  LP+L E+ H     P+  +  + VL QL +LN  + IS  A D+L  +       
Sbjct: 17  VQLRNLPDLTEISHLEIDAPVVEILKKTVLFQLNSLN--ICISNFALDELVNLVTVQMDG 74

Query: 78  XXXXXXXITQVQRRTKISKLDLNLYFKGIGMDLKDLNGQVEISNFVHGKFKDEANALNET 137
                  +T +QRR++ S+ DL L  +   +D   L  Q + S F+  K   E   L   
Sbjct: 75  MFRNLHNLTLLQRRSQASQADLKLLLREFNLDAPSLYQQFQASEFIKSKHSTEYEKL--- 131

Query: 138 VLKVKQQFMXXXXXXXXXXXXXXXFFVQDVDILNLLPSSNKSNKYVPSWLPELPPDHTYK 197
                                      Q  +I  LLP SN   K +PSWLP  PPDHTYK
Sbjct: 132 --MSWSSLAALPHNEEDEEDELNNIEEQQNEINVLLPPSNPLEKQIPSWLPNFPPDHTYK 189

Query: 198 FTSLYKRPITDERLMKKKLLEEGRLSEKALLNMLSQVVNQDPLVALNKDSDQSANNAALS 257
           FT  +  PITD + +KK++++E + SEKALLN+         L  ++  S+         
Sbjct: 190 FTPEFNHPITDLKTIKKEIVKESQESEKALLNL------NKSLSHISSASNTPQPPGLDD 243

Query: 258 EHIKESQLETDLIFDPHKTIPTDKEWGTT------TVLHGIESFNLSPVKNFNVLEYCKK 311
           E   E QLE                WG        T+    +SFN +     N+ +Y K 
Sbjct: 244 EDAIEQQLEI---------------WGNALEERKPTITE--KSFNEN-----NIEQYAKY 281

Query: 312 RDAIVKRRAERAENQVSNKRRNPFIRGAMICSPYGQGSTKSRKSVENQLKTMLRRSYLGL 371
           R  + + R  + E     + +NPF++ +       +   +S K+++  ++   R+S    
Sbjct: 282 RVELARERVTKFEVNQLKRTKNPFLKISETLY-LPESPHQSHKTIQKTIELQFRKSMTLF 340

Query: 372 IDSIP 376
           + ++P
Sbjct: 341 MHNLP 345

>Skud_13.27 Chr13 complement(41670..43214) [1545 bp, 514 aa] {ON}
           YML114C (REAL)
          Length = 514

 Score =  111 bits (278), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 95/365 (26%), Positives = 157/365 (43%), Gaps = 45/365 (12%)

Query: 21  VRLDKLPNLNEVPHAN---PMERLFAQAVLLQLKTLNKNVVISQLAFDDLCYVXXXXXXX 77
           V+L  LP+L E+ H     P+  +  + VL QL +L+  + IS  A D+L  +       
Sbjct: 17  VQLKNLPDLTEISHLKIDAPVVEILRKTVLFQLNSLD--ICISNFALDELVNLVAVQMDG 74

Query: 78  XXXXXXXITQVQRRTKISKLDLNLYFKGIGMDLKDLNGQVEISNFVHGKFKDEANALNET 137
                  +  +QRR++ ++ DL L FK   +D   L  Q++IS F+      E   L  +
Sbjct: 75  MFRNLHNLALLQRRSRATQADLKLLFKEFNLDPASLYQQLQISEFIKSNHSVEYEKLVSS 134

Query: 138 VLKVKQQFMXXXXXXXXXXXXXXXFFVQDVDILNLLPSSNKSNKYVPSWLPELPPDHTYK 197
                                      Q  +I  LLP SN   K +PSWLP  PPDHTY+
Sbjct: 135 SSFSASSHNEEDEEDELNNIEE-----QQNEISVLLPPSNPLEKLMPSWLPNFPPDHTYR 189

Query: 198 FTSLYKRPITDERLMKKKLLEEGRLSEKALLNMLSQVVN-----QDPLVALNKDSDQSAN 252
           FT  +  PITD + +K+++++E + SEKALLN+  ++++       P   L  D+D    
Sbjct: 190 FTPEFNHPITDLKTIKREIVKESKESEKALLNLNKRLLHISLASHAPPPRLPDDADAG-- 247

Query: 253 NAALSEHIKESQLETDLIFDPHKTIPTDKEWGTTTVLHGIESFNLSPVKNFNVLEYCKKR 312
                    E QLE                WG         + + S  +N N+ +Y K R
Sbjct: 248 ---------EQQLEI---------------WGNALQEEKRTAISKSFNEN-NIEQYAKYR 282

Query: 313 DAIVKRRAERAENQVSNKRRNPFIRGAMICSPYGQGST-KSRKSVENQLKTMLRRSYLGL 371
             + + R  + E     + +NPF+R +     Y   S  +  ++++  +    R+S +  
Sbjct: 283 VELARERVSKFEVNQLKRTKNPFLRISETL--YSSKSPHQPHRAIQRAIDLQFRKSMMLF 340

Query: 372 IDSIP 376
             ++P
Sbjct: 341 AHNLP 345

>KAFR0A02820 Chr1 (584984..586345) [1362 bp, 453 aa] {ON} Anc_8.838
           YML114C
          Length = 453

 Score =  105 bits (263), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 87/346 (25%), Positives = 160/346 (46%), Gaps = 53/346 (15%)

Query: 35  ANP-MERLFAQAVLLQLKTLNKNVVISQLAFDDLCYVXXXXXXXXXXXXXXITQVQRR-T 92
            NP ++ L  ++V ++LK +N +  +   AFD L Y+              ++ +QRR +
Sbjct: 22  GNPQLDNLLVKSVAMRLKPVNLHTQLPNSAFDYLIYLMDVQLNDLIKQLGRLSLLQRRNS 81

Query: 93  KISKLDLNLYFKGIGMDLKDLNGQVEISNFVHGKFKDEANALNETVLKVKQQFMXXXXXX 152
             +K D+ L  KG  +   +LN ++EISN +   + ++   L+E  +   Q         
Sbjct: 82  NATKSDILLLLKGFNLSESELNTELEISNHIKRLYSEDEKKLSEDSIHYNQH-------- 133

Query: 153 XXXXXXXXXFFVQDVDI--LNLLPSSNKSNKYVPSWLPELPPDHTYKFTSLYKRPITDER 210
                     FV  V+     LL  +N     +PSW P LPPDHTYKFT  Y   I D +
Sbjct: 134 --------TDFVGPVETSSFQLLNPTNPLKDAIPSWFPSLPPDHTYKFTPKYNNFINDPK 185

Query: 211 LMKKKLLEEGRLSEKALLNMLSQVVNQDPLVALNKDSDQSANNAALSEHIKESQLETDLI 270
           ++K+K  +E +  + AL N+++++           +S++  N+    E +  ++LE+  +
Sbjct: 186 IIKQKRFDESKTVKTALFNLINKI-----------ESNEERNDLHYDETL--AKLESQAL 232

Query: 271 FDPHKTIPTDKEWGTTTVLHGIESFNLSPVKNFNVLEYCKKRDAIVKRRAERAENQVSNK 330
           F        +++  T   ++   +  + P+  F++ EY  KR  I + +  + EN++   
Sbjct: 233 FG-----TVEEKMNTNKKVYKSLNSIIVPITKFDIEEYSHKRVNIARNKVSKFENKMLAL 287

Query: 331 RRNPFIRGAMICSPYGQGSTKSRKSVENQLKTMLRRSYLGLIDSIP 376
           + NPFI   +I               +  +K+ L RS+  +I+SIP
Sbjct: 288 KYNPFIN--LIND-------------QTDVKSYLNRSFQLMINSIP 318

>CAGL0B02299g Chr2 (217341..219272) [1932 bp, 643 aa] {ON} some
           similarities with uniprot|Q03750 Saccharomyces
           cerevisiae YML114c TAF65 TBP Associated Factor
          Length = 643

 Score = 87.0 bits (214), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 60/227 (26%), Positives = 107/227 (47%), Gaps = 22/227 (9%)

Query: 28  NLNEVPHANPME----RLFAQAVLLQLKTLNKNVVISQLAFDDLCYVXXXXXXXXXXXXX 83
           ++ E+  +N M+     L  +AV +QL+T++K+V ++++A D L                
Sbjct: 20  DIKEINSSNRMDYQMGELLKRAVGVQLQTIDKDVTVTRMAMDQLVLFAEDQLNALVDGLH 79

Query: 84  XITQVQRRTKISKLDLNLYFKGIGMDLKDLNGQVEISNFVHGKFKDEAN----------- 132
            I+ +QRR  I+  DL ++ +G  +   DL    E S F+   ++++ +           
Sbjct: 80  RISLLQRRQSIAVSDLEIWMRGYNLLPSDLYMTAEESKFIRENYRNDTSVVFKDINIDNP 139

Query: 133 ---ALNETVLKVKQQFMXXXXXXXXXXXXXXXFF-VQDVDILNLLPSS---NKSNKYVPS 185
              AL    ++ K+                     +Q   +  L  +     ++ +Y P 
Sbjct: 140 MESALGRINIQNKENIEPTDNDVDIDEDDDYELIELQQHAMEQLFKTDTGRGRNLRYKPG 199

Query: 186 WLPELPPDHTYKFTSLYKRPITDERLMKKKLLEEGRLSEKALLNMLS 232
           WLP+ PPDHTYK+T  Y   +  E  +++KL+EEGRLSEKAL+ ++S
Sbjct: 200 WLPDFPPDHTYKYTPSYVNVVKPETEIRQKLVEEGRLSEKALVKLMS 246

>KNAG0G03410 Chr7 (731420..733000) [1581 bp, 526 aa] {ON} Anc_8.838
           YML114C
          Length = 526

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 70/300 (23%), Positives = 128/300 (42%), Gaps = 59/300 (19%)

Query: 85  ITQVQRRTKISKLDLNLYFKGIGMDLKDLNGQVEISNFVHG-----------KFKDEANA 133
           I  VQRR   +  D+ L  +G  +  +D+  Q+ +S  +             + +D   +
Sbjct: 88  IATVQRRQHATHDDVALLLQGFQLTPEDIEEQMYLSKKIGYNRMQVPREQTVQLQDATGS 147

Query: 134 LNETVLKVKQQFMXXXXXXXXXXXXXXXFFVQDVDILNLLPSSNKSNKYVPSWLPELPPD 193
            +   L   QQ +                 +   D+   LP + K    +P+WLP+LPP+
Sbjct: 148 YDRFKLVENQQLIASG--------------LSGSDMSQELPIAEK----IPAWLPKLPPN 189

Query: 194 HTYKFTSLYKRPITDERLMKKKLLEEGRLSEKALLNMLSQVVNQDPLVALNKDSDQSANN 253
           HTYKFT+ Y + + DE+++K+K+++E    E +L N++            ++D+D   + 
Sbjct: 190 HTYKFTTEYNKLLNDEKVLKEKIIKESMEIEVSLSNLVRNC---------DRDADTKVDE 240

Query: 254 AALS---EHIKESQLETDLIFDPHKTIPTDKEWGTTTVLHGIESFNLSPV---KNFNVLE 307
            A     E +K    E   ++ P + I    E        G  +   +P+   K+F+V  
Sbjct: 241 RARETPPEELKRIDDEIVALYGPLEEIAERHE--------GPRTKRRTPLYLKKSFDVQA 292

Query: 308 YCKKRDAIVKRRAERAENQVSNKRRNPFIRGAMICSPYG--QGSTKSRKSVENQLKTMLR 365
           Y   R  + +   +R E +   + RNPF     +CS     + S K    +EN L  +++
Sbjct: 293 YSLGRVKLARNAVQRFEWETKYRPRNPF-----LCSHRAVPENSKKVYSMLENSLNELVQ 347

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.130    0.362 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,314,355
Number of extensions: 2239529
Number of successful extensions: 7082
Number of sequences better than 10.0: 51
Number of HSP's gapped: 7294
Number of HSP's successfully gapped: 52
Length of query: 562
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 447
Effective length of database: 40,294,809
Effective search space: 18011779623
Effective search space used: 18011779623
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 68 (30.8 bits)