Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D01595g8.839ON71970133490.0
SAKL0D01496g8.839ON68858421310.0
ABL127W8.839ON72858820690.0
Ecym_46108.839ON75159120530.0
KLTH0C03894g8.839ON74558520430.0
Kwal_27.102638.839ON74358420360.0
TDEL0B005808.839ON71356718660.0
CAGL0M02959g8.839ON75859118630.0
NCAS0C004208.839ON72559318590.0
ZYRO0G14168g8.839ON76458418400.0
KAFR0B039108.839ON72459118300.0
Kpol_1068.98.839ON74558017700.0
TBLA0D032608.839ON76862617580.0
NDAI0K004208.839ON77852617180.0
TPHA0I002408.839ON73258717130.0
Suva_13.4658.839ON73260016930.0
YMR277W (FCP1)8.839ON73260716760.0
Skud_13.4498.839ON73460616750.0
Smik_13.4908.839ON73260716680.0
KNAG0J002808.839ON74260516660.0
NCAS0A068005.202ON473128930.014
SAKL0G12870g5.202ON39960910.023
TPHA0E030705.202ON49451890.041
NDAI0D018605.202ON51451890.049
YLR019W (PSR2)5.202ON39745880.055
Kpol_478.165.202ON35051870.070
Skud_12.875.202ON39245870.075
TBLA0I014602.530ON393106850.11
Smik_12.825.202ON39245840.14
TPHA0N006705.202ON45241820.26
Smik_8.532.530ON446103820.28
Suva_10.995.202ON38541800.54
TBLA0H019905.202ON68840800.54
TBLA0C060905.202ON484121790.68
YLL010C (PSR1)5.202ON42740790.68
Suva_10.655.202ON41540780.74
Skud_12.575.202ON41540780.85
ZYRO0B10428g5.202ON48240780.86
Smik_12.535.202ON41440780.88
Skud_8.492.530ON447103780.91
YHR004C (NEM1)2.530ON446103771.1
NDAI0F042401.79ON1302132771.2
KNAG0C058502.530ON443103752.1
KLLA0E23101g8.527ON48087752.3
Kpol_2002.1005.202ON47745742.8
Kwal_33.151405.202ON41060742.9
AAL158W5.202ON47840733.1
Suva_8.582.530ON452186733.3
Smik_15.3736.97ON114382733.8
NDAI0I021705.202ON39145724.0
KAFR0A066504.140ON44250725.0
Kpol_1036.978.368ON195694725.2
Suva_16.2498.527ON48080716.0
ZYRO0F10824g8.609ON460116708.4
Smik_16.1728.527ON47780708.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D01595g
         (719 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D01595g Chr4 complement(141459..143618) [2160 bp, 719 aa] {...  1294   0.0  
SAKL0D01496g Chr4 complement(120202..122268) [2067 bp, 688 aa] {...   825   0.0  
ABL127W Chr2 (156798..158984) [2187 bp, 728 aa] {ON} Syntenic ho...   801   0.0  
Ecym_4610 Chr4 (1188871..1191126) [2256 bp, 751 aa] {ON} similar...   795   0.0  
KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {...   791   0.0  
Kwal_27.10263 s27 complement(268744..270975) [2232 bp, 743 aa] {...   788   0.0  
TDEL0B00580 Chr2 complement(111408..113549) [2142 bp, 713 aa] {O...   723   0.0  
CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} simil...   722   0.0  
NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}...   720   0.0  
ZYRO0G14168g Chr7 (1128601..1130895) [2295 bp, 764 aa] {ON} simi...   713   0.0  
KAFR0B03910 Chr2 (811940..814114) [2175 bp, 724 aa] {ON} Anc_8.8...   709   0.0  
Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON...   686   0.0  
TBLA0D03260 Chr4 (810350..812656) [2307 bp, 768 aa] {ON} Anc_8.8...   681   0.0  
NDAI0K00420 Chr11 complement(94101..96437) [2337 bp, 778 aa] {ON...   666   0.0  
TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839...   664   0.0  
Suva_13.465 Chr13 (802947..805145) [2199 bp, 732 aa] {ON} YMR277...   656   0.0  
YMR277W Chr13 (820256..822454) [2199 bp, 732 aa] {ON}  FCP1Carbo...   650   0.0  
Skud_13.449 Chr13 (793592..795796) [2205 bp, 734 aa] {ON} YMR277...   649   0.0  
Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277...   647   0.0  
KNAG0J00280 Chr10 complement(41831..44059) [2229 bp, 742 aa] {ON...   646   0.0  
NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON} Anc_5...    40   0.014
SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} simi...    40   0.023
TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.2...    39   0.041
NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202     39   0.049
YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}  PSR2Funct...    39   0.055
Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}...    38   0.070
Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W...    38   0.075
TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {O...    37   0.11 
Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W...    37   0.14 
TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {...    36   0.26 
Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON} Y...    36   0.28 
Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W...    35   0.54 
TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.2...    35   0.54 
TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa] ...    35   0.68 
YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON} ...    35   0.68 
Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {O...    35   0.74 
Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {O...    35   0.85 
ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} simila...    35   0.86 
Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {O...    35   0.88 
Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON} Y...    35   0.91 
YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}  ...    34   1.1  
NDAI0F04240 Chr6 complement(1034128..1038036) [3909 bp, 1302 aa]...    34   1.2  
KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON} Anc_2...    33   2.1  
KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]...    33   2.3  
Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]...    33   2.8  
Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {...    33   2.9  
AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homo...    33   3.1  
Suva_8.58 Chr8 complement(108197..109555) [1359 bp, 452 aa] {ON}...    33   3.3  
Smik_15.373 Chr15 (641700..645131) [3432 bp, 1143 aa] {ON} YOR18...    33   3.8  
NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202     32   4.0  
KAFR0A06650 Chr1 (1349869..1351197) [1329 bp, 442 aa] {ON} Anc_8...    32   5.0  
Kpol_1036.97 s1036 complement(248945..254815) [5871 bp, 1956 aa]...    32   5.2  
Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063...    32   6.0  
ZYRO0F10824g Chr6 complement(883483..884865) [1383 bp, 460 aa] {...    32   8.4  
Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063...    32   8.7  

>KLLA0D01595g Chr4 complement(141459..143618) [2160 bp, 719 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase ,
          Length = 719

 Score = 1294 bits (3349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 636/701 (90%), Positives = 636/701 (90%)

Query: 1   MSLETNVKVTSDLPYPITVAQLYVKPGDHVEKGQRLFAYEYWDFQDVLVKYEEKTKKQRV 60
           MSLETNVKVTSDLPYPITVAQLYVKPGDHVEKGQRLFAYEYWDFQDVLVKYEEKTKKQRV
Sbjct: 1   MSLETNVKVTSDLPYPITVAQLYVKPGDHVEKGQRLFAYEYWDFQDVLVKYEEKTKKQRV 60

Query: 61  DRVATFDSPVSGTVKEWHCSVKDEFASANHEVITIRQDCNHDITYGGLCVQCGNTVDEED 120
           DRVATFDSPVSGTVKEWHCSVKDEFASANHEVITIRQDCNHDITYGGLCVQCGNTVDEED
Sbjct: 61  DRVATFDSPVSGTVKEWHCSVKDEFASANHEVITIRQDCNHDITYGGLCVQCGNTVDEED 120

Query: 121 NSKNLTISHVNTNIKVSEQQAETLERSSLTRLREEKKLVLVVDLDQTVIHCGVDPTIGEW 180
           NSKNLTISHVNTNIKVSEQQAETLERSSLTRLREEKKLVLVVDLDQTVIHCGVDPTIGEW
Sbjct: 121 NSKNLTISHVNTNIKVSEQQAETLERSSLTRLREEKKLVLVVDLDQTVIHCGVDPTIGEW 180

Query: 181 MRDPKNPNYKALQDVKSFTLEDEPIIPSFYFGPKPPARKSWYYVKLRPGLKEFFEAVSPH 240
           MRDPKNPNYKALQDVKSFTLEDEPIIPSFYFGPKPPARKSWYYVKLRPGLKEFFEAVSPH
Sbjct: 181 MRDPKNPNYKALQDVKSFTLEDEPIIPSFYFGPKPPARKSWYYVKLRPGLKEFFEAVSPH 240

Query: 241 FEMHIYTMATRSYAHEIAKIIDPTGELFGDRILSRDENGSLTTKSLERLFPMDQSMVVVI 300
           FEMHIYTMATRSYAHEIAKIIDPTGELFGDRILSRDENGSLTTKSLERLFPMDQSMVVVI
Sbjct: 241 FEMHIYTMATRSYAHEIAKIIDPTGELFGDRILSRDENGSLTTKSLERLFPMDQSMVVVI 300

Query: 301 DDRGDVWNWFENLIKVVPYSFFVGIGDINSNFLPRQQNSVLHLGRHHRRKQEEEKLISDI 360
           DDRGDVWNWFENLIKVVPYSFFVGIGDINSNFLPRQQNSVLHLGRHHRRKQEEEKLISDI
Sbjct: 301 DDRGDVWNWFENLIKVVPYSFFVGIGDINSNFLPRQQNSVLHLGRHHRRKQEEEKLISDI 360

Query: 361 IDNEKKLKEKIDEEVKRQEEIISHIGDDNTRKEGGPPNKEDISKKLEHSASLEVQQQNRP 420
           IDNEKKLKEKIDEEVKRQEEIISHIGDDNTRKEGGPPNKEDISKKLEHSASLEVQQQNRP
Sbjct: 361 IDNEKKLKEKIDEEVKRQEEIISHIGDDNTRKEGGPPNKEDISKKLEHSASLEVQQQNRP 420

Query: 421 LAELQKHLHNQTLLIDDDDELPHLSQILLRVHKEYFNQYTEAPKNPPDIKYLLPQMKYKV 480
           LAELQKHLHNQTLLIDDDDELPHLSQILLRVHKEYFNQYTEAPKNPPDIKYLLPQMKYKV
Sbjct: 421 LAELQKHLHNQTLLIDDDDELPHLSQILLRVHKEYFNQYTEAPKNPPDIKYLLPQMKYKV 480

Query: 481 FQGCHFVFSGLIPLETDVRKADIVLWTDMFGATTSSDINYKXXXXXXXXXXXFKARLAKS 540
           FQGCHFVFSGLIPLETDVRKADIVLWTDMFGATTSSDINYK           FKARLAKS
Sbjct: 481 FQGCHFVFSGLIPLETDVRKADIVLWTDMFGATTSSDINYKTTHIITTTSRTFKARLAKS 540

Query: 541 FNPDIKIVHPDWLFECLVQWERVKESPYELLIQDPVXXXXXXXXXXXXXXXISNPSSSVN 600
           FNPDIKIVHPDWLFECLVQWERVKESPYELLIQDPV               ISNPSSSVN
Sbjct: 541 FNPDIKIVHPDWLFECLVQWERVKESPYELLIQDPVDEDKVKEFKEKLDKKISNPSSSVN 600

Query: 601 PFEDGNEDEEVLGDEFHLLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 660
           PFEDGNEDEEVLGDEFHLLAG                                       
Sbjct: 601 PFEDGNEDEEVLGDEFHLLAGNDSWLDNDDDEMDELLNDEDDDAQNDEENEGDEETDEDE 660

Query: 661 RPSVKRRKTQLDDTKDFNHSEIPETDGQAENHGVDQSSSEP 701
           RPSVKRRKTQLDDTKDFNHSEIPETDGQAENHGVDQSSSEP
Sbjct: 661 RPSVKRRKTQLDDTKDFNHSEIPETDGQAENHGVDQSSSEP 701

>SAKL0D01496g Chr4 complement(120202..122268) [2067 bp, 688 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase
          Length = 688

 Score =  825 bits (2131), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/584 (67%), Positives = 476/584 (81%), Gaps = 13/584 (2%)

Query: 3   LETNVKVTSDLPYPITVAQLYVKPGDHVEKGQRLFAYEYWDFQDVLVKYEE---KTKKQR 59
           + T +K+  +LPYPIT+AQL    GD ++KGQRLFAY+YW+FQDV+    +   K KKQR
Sbjct: 1   MTTALKLPDNLPYPITIAQLCASTGDPIKKGQRLFAYKYWEFQDVVTSPNDTSTKPKKQR 60

Query: 60  VDRVATFDSPVSGTVKEWHCSVKDEFASANHEVITIRQDCNHDITYGGLCVQCGNTVDE- 118
           VD + TFDSPV G +  ++ S+ DEF ++NH V  I+Q C HD+TYGGLCV CG +V+E 
Sbjct: 61  VDLIGTFDSPVEGALVSFNLSLGDEFVNSNHVVAEIKQACTHDVTYGGLCVICGKSVEEY 120

Query: 119 -----EDNSKN-LTISHVNTNIKVSEQQAETLERSSLTRLREEKKLVLVVDLDQTVIHCG 172
                 D S+N LT+SH NTNIK+SE+QA  +E ++  +LR+ KKLVLVVDLDQTVIHCG
Sbjct: 121 SSNSASDPSQNKLTMSHTNTNIKISERQAAAIEETAQKQLRKLKKLVLVVDLDQTVIHCG 180

Query: 173 VDPTIGEWMRDPKNPNYKALQDVKSFTLEDEPIIPSFYFGPKPPARKSWYYVKLRPGLKE 232
           VDPTIGEW RDPKNPNY+AL+D+KSF L +EPI+P FY GPKPPARK WYYVKLRPGLKE
Sbjct: 181 VDPTIGEWSRDPKNPNYEALKDIKSFALVEEPILPPFYMGPKPPARKCWYYVKLRPGLKE 240

Query: 233 FFEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGELFGDRILSRDENGSLTTKSLERLFPM 292
           FFE ++PHFE+HIYTMATR+YA EIAKIIDP G+LFGDRILSRDENGS+T KSLERLFPM
Sbjct: 241 FFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSITHKSLERLFPM 300

Query: 293 DQSMVVVIDDRGDVWNWFENLIKVVPYSFFVGIGDINSNFLPRQQNSVLHLGRHHRRKQE 352
           DQSMVV+IDDRGDVWNW ENLIKVVPYSFFVG+GDINSNFLPRQQNS+LHLGR HR+K E
Sbjct: 301 DQSMVVIIDDRGDVWNWCENLIKVVPYSFFVGVGDINSNFLPRQQNSMLHLGRRHRKKAE 360

Query: 353 EEKLISDIIDNEKKLKEKIDEEVKRQEEIISHIGDDNTRKEGGPPNKEDISKKLEHSASL 412
           EE+L++DI+D EKKL+EKIDEEVKRQEE +S + ++   ++    +KED++KKLEHSASL
Sbjct: 361 EEELLTDILDTEKKLQEKIDEEVKRQEEKLSKMTEEKQPEDTN--SKEDLAKKLEHSASL 418

Query: 413 EVQQQNRPLAELQKHLHNQTLLIDDDDELPHLSQILLRVHKEYFNQYTEAPKNPPDIKYL 472
           EVQQQNRPLAELQKHLHNQ LLIDDDDELPHLS+ILL+VH +Y+   ++   +PP+IK L
Sbjct: 419 EVQQQNRPLAELQKHLHNQKLLIDDDDELPHLSRILLQVHGKYYEDLSKH-SSPPNIKNL 477

Query: 473 LPQMKYKVFQGCHFVFSGLIPLETDVRKADIVLWTDMFGATTSSDINYKXXXXXXXXXXX 532
           +PQ+K +VF  C FVFSGLIPL TDVRKADI LWT MFGA T++DI+             
Sbjct: 478 MPQLKKRVFCKCSFVFSGLIPLGTDVRKADIALWTSMFGAKTTADIDEATTHIITKTPGT 537

Query: 533 FKARLAKSFNPDIKIVHPDWLFECLVQWERVKESPYELLIQDPV 576
           FKARLAK+FNP+IK+VHPDW+FECLV W+RV E  YELLI+ PV
Sbjct: 538 FKARLAKAFNPEIKVVHPDWIFECLVNWKRVDEKAYELLIEQPV 581

>ABL127W Chr2 (156798..158984) [2187 bp, 728 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR277W (FCP1)
          Length = 728

 Score =  801 bits (2069), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/588 (65%), Positives = 465/588 (79%), Gaps = 20/588 (3%)

Query: 3   LETNVKVTSDLPYPITVAQLYVKPGDHVEKGQRLFAYEYWDFQDVLVKYEE----KTKKQ 58
           + T +++   LPYPIT+AQL V  GD VEKGQRL AY+YWD  DV+    E    K +KQ
Sbjct: 1   MSTPIRLPDSLPYPITIAQLGVSTGDTVEKGQRLLAYKYWDLVDVITAPGEEEAGKARKQ 60

Query: 59  RVDRVATFDSPVSGTVKEWHCSVKDEFASANHEVITIRQDCNHDITYGGLCVQCGNTVDE 118
           RVD V TFDSPV+GTV      V DEF ++   V+ IRQ C HD+TYGGLCVQCG  V++
Sbjct: 61  RVDLVGTFDSPVAGTVVSLDVRVGDEFVNSQRPVVEIRQACPHDVTYGGLCVQCGQAVED 120

Query: 119 EDNSKN------LTISHVNTNIKVSEQQAETLERSSLTRLREEKKLVLVVDLDQTVIHCG 172
           E  + +      LT+SH NT+I+VSE+QA +L +S+  +LRE +KLVLVVDLDQTVIHCG
Sbjct: 121 EAGAADGVEQAKLTVSHTNTHIRVSERQAASLGQSAQLKLREARKLVLVVDLDQTVIHCG 180

Query: 173 VDPTIGEWMRDPKNPNYKALQDVKSFTLEDEPIIPSFYFGPKPPARKSWYYVKLRPGLKE 232
           VDPTIGEW +DP NPNY+AL+DV+SF+L++EP++P FY GPKPP RK WYYVKLRPGLKE
Sbjct: 181 VDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYMGPKPPTRKCWYYVKLRPGLKE 240

Query: 233 FFEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGELFGDRILSRDENGSLTTKSLERLFPM 292
           FF  ++PHFE+HIYTMATR+YA EIAKIIDP G+LFGDRILSRDENGSLT KSLERLFPM
Sbjct: 241 FFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSLTQKSLERLFPM 300

Query: 293 DQSMVVVIDDRGDVWNWFENLIKVVPYSFFVGIGDINSNFLPRQQNSVLHLGRHHRRK-Q 351
           DQSMVVVIDDRGDVWNW ENLIKVVPY FFVGIGDINSNFLP QQNS+LHLGR +R+K +
Sbjct: 301 DQSMVVVIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPIQQNSMLHLGRRNRKKPK 360

Query: 352 EEEKLISDIIDNEKKLKEKIDEEVKRQEEIISHIGDDNTRKEGGPPNKEDISKKLEHSAS 411
           +EE+L++DI+D EKKLKEKI+EEVKRQE+ +  + D+        P+  DI+KKLEH+AS
Sbjct: 361 QEEELLTDILDTEKKLKEKINEEVKRQEDQMHRLTDEKL------PDTRDIAKKLEHNAS 414

Query: 412 LEVQQQNRPLAELQKHLHNQTLLIDDDDELPHLSQILLRVHKEYFNQ---YTEAPKNPPD 468
           LEVQQQNRPLAELQKH+ N+ LL DDDDELPHL  ILL+VH  Y++Q   Y       PD
Sbjct: 415 LEVQQQNRPLAELQKHMRNERLLFDDDDELPHLGNILLKVHSAYYDQLQRYNSGEDPIPD 474

Query: 469 IKYLLPQMKYKVFQGCHFVFSGLIPLETDVRKADIVLWTDMFGATTSSDINYKXXXXXXX 528
           IK L+P++K  VF+GC FVFSGLIPL T++ +ADIVLWT+MFGA+T+++++Y        
Sbjct: 475 IKILMPKLKETVFEGCRFVFSGLIPLHTNIERADIVLWTNMFGASTTANLDYNTTHLITR 534

Query: 529 XXXXFKARLAKSFNPDIKIVHPDWLFECLVQWERVKESPYELLIQDPV 576
                KARLAKSFNP IKIVHPDW+FECLV WERV+ESPYEL++++PV
Sbjct: 535 TPGTMKARLAKSFNPAIKIVHPDWIFECLVGWERVEESPYELIVEEPV 582

>Ecym_4610 Chr4 (1188871..1191126) [2256 bp, 751 aa] {ON} similar to
           Ashbya gossypii ABL127W
          Length = 751

 Score =  795 bits (2053), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/591 (64%), Positives = 469/591 (79%), Gaps = 19/591 (3%)

Query: 3   LETNVKVTSDLPYPITVAQLYVKPGDHVEKGQRLFAYEYWDFQDVLVKYEE-----KTKK 57
           + T +++  +LPYPITVAQL V  GD VE+GQRLFAY+YWDF+ ++    +     K+K+
Sbjct: 1   MSTPIRLPDNLPYPITVAQLAVSAGDMVERGQRLFAYKYWDFEQIVTSPGDESAGGKSKR 60

Query: 58  QRVDRVATFDSPVSGTVKEWHCSVKDEFASANHEVITIRQDCNHDITYGGLCVQCGNTVD 117
           QR+D V TFDSPVSG V   + ++ DEF ++   V  I+Q C HD+TYGGLCVQCG TV+
Sbjct: 61  QRIDLVGTFDSPVSGQVVSLNITLGDEFVNSQCTVAEIKQPCTHDVTYGGLCVQCGQTVE 120

Query: 118 EE-------DNSKNLTISHVNTNIKVSEQQAETLERSSLTRLREEKKLVLVVDLDQTVIH 170
           +E       DN   LT+SH N NI++SE+QA TLE+S+  +LRE +KLVLVVDLDQTVIH
Sbjct: 121 DEQTSGSLLDNQAKLTMSHTNMNIRISEKQAYTLEKSAQKQLREARKLVLVVDLDQTVIH 180

Query: 171 CGVDPTIGEWMRDPKNPNYKALQDVKSFTLEDEPIIPSFYFGPKPPARKSWYYVKLRPGL 230
           CGVDPTIGEW +DP NPNY++L+DV+SF+L +EP++P FY GPKPP RK WYYVKLRPGL
Sbjct: 181 CGVDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVLPPFYMGPKPPTRKCWYYVKLRPGL 240

Query: 231 KEFFEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGELFGDRILSRDENGSLTTKSLERLF 290
           ++FF  ++PHFE+HIYTMATR+YA EIAKIIDP G LFGDRILSRDENGSLT KSLERLF
Sbjct: 241 QDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTLFGDRILSRDENGSLTQKSLERLF 300

Query: 291 PMDQSMVVVIDDRGDVWNWFENLIKVVPYSFFVGIGDINSNFLPRQQNSVLHLGRHHRRK 350
           PMDQSMVV+IDDRGDVWNW ENLIKVVPY FFVGIGDINSNFLPRQQNS+LHLGR +R+K
Sbjct: 301 PMDQSMVVIIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPRQQNSMLHLGRRNRKK 360

Query: 351 -QEEEKLISDIIDNEKKLKEKIDEEVKRQEEIISHIGDDNTRKEGGPPNKEDISKKLEHS 409
            +++E+L++DI+D EKKLK KI EEVKRQEE +  + ++  +      +KEDI+KKLEH+
Sbjct: 361 LKQDEELLTDILDTEKKLKVKISEEVKRQEEEMQKLSEE--KIPDHTTSKEDIAKKLEHN 418

Query: 410 ASLEVQQQNRPLAELQKHLHNQTLLIDDDDELPHLSQILLRVHKEYFNQYTE----APKN 465
           ASLEVQQQNRPLAELQKHLHN+ LLIDDDDELPHL+ ILLRVH  Y++Q  +    A + 
Sbjct: 419 ASLEVQQQNRPLAELQKHLHNERLLIDDDDELPHLTDILLRVHSAYYDQLEKNKHGATEL 478

Query: 466 PPDIKYLLPQMKYKVFQGCHFVFSGLIPLETDVRKADIVLWTDMFGATTSSDINYKXXXX 525
            PDIK+L+P +K  VF+GC+FVFSGLIPL T++ +ADIVLWT+ FGA T+ +I+Y     
Sbjct: 479 SPDIKHLIPSLKEIVFKGCNFVFSGLIPLHTNIDRADIVLWTNTFGAKTTINIDYNTTHL 538

Query: 526 XXXXXXXFKARLAKSFNPDIKIVHPDWLFECLVQWERVKESPYELLIQDPV 576
                   KARLA SFN DIKIVHPDW+FEC+V W+RV E PYEL++++PV
Sbjct: 539 ITKTPGTMKARLASSFNRDIKIVHPDWIFECIVNWKRVDEKPYELIVEEPV 589

>KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase
          Length = 745

 Score =  791 bits (2043), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/585 (64%), Positives = 470/585 (80%), Gaps = 15/585 (2%)

Query: 3   LETNVKVTSDLPYPITVAQLYVKPGDHVEKGQRLFAYEYWDFQDVLVKYEEKT--KKQRV 60
           + T +++ S+LP+P+T+A+L V  GD V+KGQRLF Y+YW+ QD++    E+   KK+RV
Sbjct: 1   MTTPIRLPSNLPFPVTIAKLCVSTGDSVKKGQRLFVYKYWELQDIITAPNEEAPKKKRRV 60

Query: 61  DRVATFDSPVSGTVKEWHCSVKDEFASANHEVITIRQDCNHDITYGGLCVQCGNTVDEED 120
           D + TFDSPV GT+   +  + DEF +  + +  + Q C+H++TYGGLCV CG TV+E+D
Sbjct: 61  DLIGTFDSPVEGTLVSLNIGLGDEFVNDANVIAEVNQLCSHEVTYGGLCVVCGKTVEEDD 120

Query: 121 ---------NSKNLTISHVNTNIKVSEQQAETLERSSLTRLREEKKLVLVVDLDQTVIHC 171
                    NSK LT++H NTNIKVSE+QA T+E+++   LRE KKLVLVVDLDQTVIHC
Sbjct: 121 QNVSDNGISNSK-LTVAHNNTNIKVSERQAATIEKTAQKHLREHKKLVLVVDLDQTVIHC 179

Query: 172 GVDPTIGEWMRDPKNPNYKALQDVKSFTLEDEPIIPSFYFGPKPPARKSWYYVKLRPGLK 231
           GVDPTI EW  DP NPNY AL++VK+F+L+++PI+P FY GP+PP RK  YYVKLRPGL+
Sbjct: 180 GVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGPRPPPRKCQYYVKLRPGLQ 239

Query: 232 EFFEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGELFGDRILSRDENGSLTTKSLERLFP 291
           EFF+ ++PHFE+HIYTMATR+YA EIAKIIDP GELFGDRILSRDENGSLT KSLERLFP
Sbjct: 240 EFFDKIAPHFELHIYTMATRAYALEIAKIIDPKGELFGDRILSRDENGSLTHKSLERLFP 299

Query: 292 MDQSMVVVIDDRGDVWNWFENLIKVVPYSFFVGIGDINSNFLPRQQNSVLHLGRHHRRKQ 351
           MDQSMVV+IDDRGDVW+W ENLIKVVPY+FFVG+GDINSNFLPRQQNS+LHLGR +R+K 
Sbjct: 300 MDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHLGRRNRKKA 359

Query: 352 EEEKLISDIIDNEKKLKEKIDEEVKRQEEIISHIGDDNTRKEGGPPNKEDISKKLEHSAS 411
           EEE+L++DI+D EKKL+EKID+EVK+QEE  + I ++N  +   P +KED++KKLEH+AS
Sbjct: 360 EEEELLTDIMDTEKKLQEKIDQEVKKQEEKFNKINEENQPER--PISKEDLTKKLEHNAS 417

Query: 412 LEVQQQNRPLAELQKHLHNQTLLIDDDDELPHLSQILLRVHKEYFNQYTEAPKNPPDIKY 471
           LEVQQQNRPLAELQKH++NQ LL DDDDELPHLS ILL VHK Y+++  E  + PPDIK 
Sbjct: 418 LEVQQQNRPLAELQKHMNNQKLLTDDDDELPHLSNILLNVHKTYYDKLAEQGQ-PPDIKT 476

Query: 472 LLPQMKYKVFQGCHFVFSGLIPLETDVRKADIVLWTDMFGATTSSDINYKXXXXXXXXXX 531
           L+PQMK +VF+ CHFVFSGLIPL T+VR+ADIVLWT MFGATTS D++            
Sbjct: 477 LMPQMKSQVFKRCHFVFSGLIPLGTNVRQADIVLWTSMFGATTSVDVDEATTHVITKTPG 536

Query: 532 XFKARLAKSFNPDIKIVHPDWLFECLVQWERVKESPYELLIQDPV 576
            FKARLAK++NP+IK++HPDW+FECLV+W RV E PYEL  +  V
Sbjct: 537 TFKARLAKTYNPNIKVIHPDWIFECLVKWVRVNEKPYELTTEQDV 581

>Kwal_27.10263 s27 complement(268744..270975) [2232 bp, 743 aa] {ON}
           YMR277W (FCP1) - TFIIF interacting component of CTD
           phosphatase [contig 37] FULL
          Length = 743

 Score =  788 bits (2036), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/584 (64%), Positives = 465/584 (79%), Gaps = 13/584 (2%)

Query: 3   LETNVKVTSDLPYPITVAQLYVKPGDHVEKGQRLFAYEYWDFQDVLVKYEEKT--KKQRV 60
           + T +++  +LP+PIT+A+LYV  G+ V KGQRLF Y+YW+ QDV+    E+   KK+RV
Sbjct: 1   MTTPIRLPPNLPFPITIAKLYVSKGESVTKGQRLFVYKYWELQDVITAPNEEASKKKRRV 60

Query: 61  DRVATFDSPVSGTVKEWHCSVKDEFASANHEVITIRQDCNHDITYGGLCVQCGNTVDEED 120
           D + TFDSP+ GT+      V DEF + ++ +  +RQ C+H++TYG LCV CG  VDE+D
Sbjct: 61  DLIGTFDSPIEGTLVSLKVRVGDEFVNDSNIIAELRQPCSHEVTYGALCVVCGKAVDEDD 120

Query: 121 NSKN--------LTISHVNTNIKVSEQQAETLERSSLTRLREEKKLVLVVDLDQTVIHCG 172
           ++ +        LT++H NTNIKVSE+QA ++E+++   LRE KKLVLVVDLDQTVIHCG
Sbjct: 121 SNMSGSGVSNGKLTVAHNNTNIKVSERQAASIEKTAQKELRERKKLVLVVDLDQTVIHCG 180

Query: 173 VDPTIGEWMRDPKNPNYKALQDVKSFTLEDEPIIPSFYFGPKPPARKSWYYVKLRPGLKE 232
           VDPTI EW  DP NPNY AL++VK+F+L+++PI+P FY GP+PP R+  YYVKLRPGL+E
Sbjct: 181 VDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGPRPPPRRCQYYVKLRPGLQE 240

Query: 233 FFEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGELFGDRILSRDENGSLTTKSLERLFPM 292
           FF+ V+PHFE+HIYTMATR+YA EIAKIIDPT  LFGDRILSRDENGSLT KSLERLFPM
Sbjct: 241 FFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALFGDRILSRDENGSLTHKSLERLFPM 300

Query: 293 DQSMVVVIDDRGDVWNWFENLIKVVPYSFFVGIGDINSNFLPRQQNSVLHLGRHHRRKQE 352
           DQSMVV+IDDRGDVW+W ENLIKVVPY+FFVG+GDINSNFLPRQQNS+LH+GR HR+K E
Sbjct: 301 DQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHMGRRHRKKAE 360

Query: 353 EEKLISDIIDNEKKLKEKIDEEVKRQEEIISHIGDDNTRKEGGPPNKEDISKKLEHSASL 412
           EE+L++DI+D EKKL+EKID+EVK+QEE  + I ++N        +KED++KKLEH+ASL
Sbjct: 361 EEELLTDIMDTEKKLQEKIDQEVKKQEEKFNKISEENQPDRSM--SKEDLTKKLEHNASL 418

Query: 413 EVQQQNRPLAELQKHLHNQTLLIDDDDELPHLSQILLRVHKEYFNQYTEAPKNPPDIKYL 472
           EVQQQNRPLAELQKH++NQ LLIDDDDELPHLS+ILL VH+ Y+ +  +  +  PDIK L
Sbjct: 419 EVQQQNRPLAELQKHMNNQKLLIDDDDELPHLSEILLNVHRTYYEELAKT-EVFPDIKLL 477

Query: 473 LPQMKYKVFQGCHFVFSGLIPLETDVRKADIVLWTDMFGATTSSDINYKXXXXXXXXXXX 532
           +PQMK KVF  CHFVFSGLIPL T++R ADIVLWT+MFGA TSSDI+             
Sbjct: 478 MPQMKAKVFAQCHFVFSGLIPLGTNIRHADIVLWTNMFGAQTSSDIDENTTHVITKTPGT 537

Query: 533 FKARLAKSFNPDIKIVHPDWLFECLVQWERVKESPYELLIQDPV 576
           FKARLAKS+NPDIKIVHPDW+FECLV+W R  E PYEL+I+  V
Sbjct: 538 FKARLAKSYNPDIKIVHPDWIFECLVKWVRADEKPYELIIEQEV 581

>TDEL0B00580 Chr2 complement(111408..113549) [2142 bp, 713 aa] {ON}
           Anc_8.839 YMR277W
          Length = 713

 Score =  723 bits (1866), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/567 (61%), Positives = 429/567 (75%), Gaps = 7/567 (1%)

Query: 13  LPYPITVAQLYVKPGDHVEKGQRLFAYEYWDFQDVLVKYEEK----TKKQRVDRVATFDS 68
           LPYPIT+ QL    G HVEKGQRLFA+++W   ++    +E      KK   + +  F++
Sbjct: 11  LPYPITIDQLIAPIGSHVEKGQRLFAFKFWYMVEIASSPDENEGGHRKKTVRESIEFFEA 70

Query: 69  PVSGTVKEWHCSVKDEFASANHEVITIRQDCNHDITYGGLCVQCGNTVDE-EDNSKNLTI 127
           P  G +  W+  V DE  + N  +  I + CNHDI YGGLC  CG  VDE E  + NL I
Sbjct: 71  PFEGDLMSWNVDVGDEVVAPNQAICEISRPCNHDIVYGGLCTLCGKEVDESEQFNGNLAI 130

Query: 128 SHVNTNIKVSEQQAETLERSSLTRLREEKKLVLVVDLDQTVIHCGVDPTIGEWMRDPKNP 187
           SH + N+KVS ++A  +E +  TRLRE KKLVLVVDLDQTVIHCGVDPTIGEW RD  NP
Sbjct: 131 SHTDVNLKVSRKEATDIENNLKTRLRESKKLVLVVDLDQTVIHCGVDPTIGEWKRDSSNP 190

Query: 188 NYKALQDVKSFTLEDEPIIPSFYFGPKPPARKSWYYVKLRPGLKEFFEAVSPHFEMHIYT 247
           NY+AL+DV+SF L++EPI+P  Y GPKPP RK WYYVK+RPGLKEFF+ V+P FEMHIYT
Sbjct: 191 NYEALKDVQSFALDEEPILPLLYMGPKPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYT 250

Query: 248 MATRSYAHEIAKIIDPTGELFGDRILSRDENGSLTTKSLERLFPMDQSMVVVIDDRGDVW 307
           MATR+YA EIAKIIDP G LFGDRILSRDENGS+T KSLERLFP DQSMVVVIDDRGDVW
Sbjct: 251 MATRAYALEIAKIIDPDGSLFGDRILSRDENGSITQKSLERLFPTDQSMVVVIDDRGDVW 310

Query: 308 NWFENLIKVVPYSFFVGIGDINSNFLPRQQNSVLHLGRHHRRK-QEEEKLISDIIDNEKK 366
           NW  NLIKVVPY+FFVG+GDINSNFLPRQQN++L LGR  R+K QE ++LI+DI+D EKK
Sbjct: 311 NWCPNLIKVVPYNFFVGVGDINSNFLPRQQNTMLQLGRGARKKTQESDELITDIMDTEKK 370

Query: 367 LKEKIDEEVKRQEEIISHIGDDNTRKEGGPPNKEDISKKLEHSASLEVQQQNRPLAELQK 426
           L+EKIDEEVKRQEE ++H    +  +   P +K+ ++KKLE+SASLEVQQQNRPLA LQK
Sbjct: 371 LQEKIDEEVKRQEEKLNH-QMASGEEVPAPESKDQLAKKLEYSASLEVQQQNRPLATLQK 429

Query: 427 HLHNQTLLIDDDDELPHLSQILLRVHKEYFNQYTEAPKNPPDIKYLLPQMKYKVFQGCHF 486
           H+HNQ LL+DDDDEL +L +IL +VH EY+    +  +   DIK LLP MK KVF+ CHF
Sbjct: 430 HMHNQRLLVDDDDELNYLREILAKVHDEYYKTLGQDSEKKADIKTLLPLMKSKVFEDCHF 489

Query: 487 VFSGLIPLETDVRKADIVLWTDMFGATTSSDINYKXXXXXXXXXXXFKARLAKSFNPDIK 546
           VFSGLIPL T++ +ADIVLWT+MFGA +S +I+             +KAR+AK+FN +IK
Sbjct: 490 VFSGLIPLGTNINRADIVLWTNMFGAQSSPEIDDSTTHVITRTPGTYKARIAKAFNENIK 549

Query: 547 IVHPDWLFECLVQWERVKESPYELLIQ 573
           +VHPDW+FECLV W+ V E PYEL+++
Sbjct: 550 VVHPDWVFECLVSWKHVDEKPYELIVE 576

>CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277w FCP1
          Length = 758

 Score =  722 bits (1863), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/591 (60%), Positives = 442/591 (74%), Gaps = 21/591 (3%)

Query: 3   LETNVKVTSDLPYPITVAQLYVKPGDHVEKGQRLFAYEYWDFQDVL-------VKYE--- 52
           + T V     LPYPITV +L V  G +VEKGQRLFAY++W   ++        + YE   
Sbjct: 1   MSTPVLTPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVEIANSPDDNDIDYEGPE 60

Query: 53  -EKTKKQRVDRVATFDSPVSGTVKEWHCSVKDEFASANHEVITIRQDCNHDITYGGLCVQ 111
            EK+K++  + +  +++P  G +  W+   KDE A  N  V  I++ CNHDI YGGLC  
Sbjct: 61  IEKSKRKVRESIEFYEAPFEGDLLSWNVDEKDEIAGPNMAVCEIKRPCNHDIVYGGLCTM 120

Query: 112 CGNTVDEEDN-SKNLTISHVNTNIKVSEQQAETLERSSLTRLREEKKLVLVVDLDQTVIH 170
           CG  VDE D    NLTISH +TN++VS ++A  L++   TRL+ EKKLVLVVDLDQTVIH
Sbjct: 121 CGKEVDEYDQVDANLTISHTDTNLRVSRKEAIDLDKQITTRLKNEKKLVLVVDLDQTVIH 180

Query: 171 CGVDPTIGEWMRDPKNPNYKALQDVKSFTLEDEPIIPSFYFGPKPPARKSWYYVKLRPGL 230
           CGVDPTIGEW  DP NPNY+ L+DVK F+LE+EPI+P  Y GPKPP R  WYYVK+RPGL
Sbjct: 181 CGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYMGPKPPVRTCWYYVKIRPGL 240

Query: 231 KEFFEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGELFGDRILSRDENGSLTTKSLERLF 290
           KEFFE ++P +EMHIYTMATR+YA EIAKIIDP   LFGDRILSRDENGSLT KSL RLF
Sbjct: 241 KEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTQKSLTRLF 300

Query: 291 PMDQSMVVVIDDRGDVWNWFENLIKVVPYSFFVGIGDINSNFLPRQQNSVLHLGRHHRRK 350
           P DQSMVVVIDDRGDVWNW  NLIKVVPY+FFVG+GDINSNFLP+QQ ++L LGR  R+K
Sbjct: 301 PTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQQTTMLQLGRRTRQK 360

Query: 351 -QEEEKLISDIIDNEKKLKEKIDEEVKRQEEIISH---IGDDNTRKEGGPPNKEDISKKL 406
            +E E+L++DI+D EKKL+EKIDEEVKRQEE ++H     +++T +E    +KE I+KKL
Sbjct: 361 IKESEELLTDIMDTEKKLQEKIDEEVKRQEEKLNHQMATAEESTDQE----SKEKIAKKL 416

Query: 407 EHSASLEVQQQNRPLAELQKHLHNQTLLIDDDDELPHLSQILLRVHKEYFNQYTEAP-KN 465
           E SASLEVQQQNRPLA+LQKHLH+Q LLIDDDDEL +L   L  +HKE+++   +A  +N
Sbjct: 417 EFSASLEVQQQNRPLAKLQKHLHDQRLLIDDDDELFYLKDTLAYIHKEFYHLLEDASDQN 476

Query: 466 PPDIKYLLPQMKYKVFQGCHFVFSGLIPLETDVRKADIVLWTDMFGATTSSDINYKXXXX 525
             DI  LLP++K KVF+ CHFVFSGLIPL TD+++ADIV+WT +FGA ++SDI+      
Sbjct: 477 EADITMLLPKLKKKVFKECHFVFSGLIPLGTDIKRADIVIWTSLFGAESTSDIDEHTTHV 536

Query: 526 XXXXXXXFKARLAKSFNPDIKIVHPDWLFECLVQWERVKESPYELLIQDPV 576
                  +KARLAK+FNPDIK+VHPDW+FECL  W+R+ E PY L+++ PV
Sbjct: 537 VTKTPGTYKARLAKAFNPDIKVVHPDWIFECLASWKRIDEKPYLLIVEQPV 587

>NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}
           Anc_8.839 YMR277W
          Length = 725

 Score =  720 bits (1859), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/593 (59%), Positives = 434/593 (73%), Gaps = 23/593 (3%)

Query: 3   LETNVKVTSDLPYPITVAQLYVKPGDHVEKGQRLFAYEYWDFQDVLVKYEEK-------- 54
           + T +     LPYPIT+ QL    GD V+KG RL AY++W   DV    ++         
Sbjct: 1   MSTQILAPIGLPYPITIDQLITHVGDEVQKGDRLLAYKFWFVVDVASSPDDNDVSSPPTA 60

Query: 55  TKKQRVDRVATFDSPVSGTVKEWHCSVKDEFASANHEVITIRQDCNHDITYGGLCVQCGN 114
            KK   + +  F+SP  G +  W+  + DE AS N  +  I + CNHD+ YGGLC  CG 
Sbjct: 61  GKKSIRESIEFFESPYKGQLISWNVDIGDEIASPNQVLAEIIRPCNHDVVYGGLCTLCGE 120

Query: 115 TVDEEDN-----SKNLTISHVNTNIKVSEQQAETLERSSLTRLREEKKLVLVVDLDQTVI 169
            VDE+DN       NLTISH +TN+K+S ++A  +  +  TRLR+EKKLVLVVDLDQTVI
Sbjct: 121 EVDEDDNDASGSGANLTISHTDTNLKISTREALDIGLNVRTRLRKEKKLVLVVDLDQTVI 180

Query: 170 HCGVDPTIGEWMRDPKNPNYKALQDVKSFTLEDEPIIPSFYFGPKPPARKSWYYVKLRPG 229
           HCGVDPTIGEW  DPKNPN++ L+DVK F+LE+EPI+P+ Y GPKPP RK WYYVK+RPG
Sbjct: 181 HCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYMGPKPPLRKCWYYVKVRPG 240

Query: 230 LKEFFEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGELFGDRILSRDENGSLTTKSLERL 289
           LKEF E ++P FEMHIYTMATR+YA EIAKIIDP G+LFGDRILSRDENGS+TTKSLERL
Sbjct: 241 LKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDRILSRDENGSMTTKSLERL 300

Query: 290 FPMDQSMVVVIDDRGDVWNWFENLIKVVPYSFFVGIGDINSNFLPRQQNSVLHLGRHHRR 349
           FP DQSMV+VIDDRGDVWNW  NLIKVVPY+FFVG+GDINSNFLP+QQ ++L LGR  R 
Sbjct: 301 FPTDQSMVIVIDDRGDVWNWSPNLIKVVPYNFFVGVGDINSNFLPKQQATMLQLGRRSRE 360

Query: 350 KQEE-EKLISDIIDNEKKLKEKIDEEVKRQEEIISHIGDDNTRKEGGPP-----NKEDIS 403
           K ++ E L+ DI+D+EKKLKEKID+EVKRQEE +SH     T +E  PP     NKE+IS
Sbjct: 361 KSKDTEDLLIDIMDSEKKLKEKIDQEVKRQEEELSH--QSATTEE--PPTSAGENKEEIS 416

Query: 404 KKLEHSASLEVQQQNRPLAELQKHLHNQTLLIDDDDELPHLSQILLRVHKEYFNQYTEAP 463
           KK+E+SASLEVQQQNRPLA LQKH H+Q LLIDDDDEL HL   L+R+H +Y+N   +  
Sbjct: 417 KKIEYSASLEVQQQNRPLAALQKHFHDQRLLIDDDDELYHLKDTLVRIHDKYYNVLKKDG 476

Query: 464 KNPPDIKYLLPQMKYKVFQGCHFVFSGLIPLETDVRKADIVLWTDMFGATTSSDINYKXX 523
           +   DIK ++P MK  V   C FVFSGLIPL TD+++ADIV+WT+ FGA ++SDI+ K  
Sbjct: 477 ELKADIKLIMPAMKQNVLDNCRFVFSGLIPLGTDIQRADIVIWTNTFGAISTSDIDEKTT 536

Query: 524 XXXXXXXXXFKARLAKSFNPDIKIVHPDWLFECLVQWERVKESPYELLIQDPV 576
                    +KARLAKSFNP IKI+HPDW+FECL  W+ V E PYEL+++ PV
Sbjct: 537 HVITKTPGTYKARLAKSFNPKIKILHPDWVFECLTSWKHVDEKPYELIVEQPV 589

>ZYRO0G14168g Chr7 (1128601..1130895) [2295 bp, 764 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277W FCP1
           Carboxy-terminal domain (CTD) phosphatase
          Length = 764

 Score =  713 bits (1840), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/584 (59%), Positives = 428/584 (73%), Gaps = 11/584 (1%)

Query: 3   LETNVKVTSDLPYPITVAQLYVKPGDHVEKGQRLFAYEYWDFQDVLVKYEEK-------- 54
           + T V     LPYPIT+ QL    G  V+KGQRLFAY++W   ++    +E         
Sbjct: 1   MATPVIAPESLPYPITIDQLIAPIGSTVKKGQRLFAYKFWYMVEIASSPDENDGNGGAQH 60

Query: 55  TKKQRVDRVATFDSPVSGTVKEWHCSVKDEFASANHEVITIRQDCNHDITYGGLCVQCGN 114
           +KK   + +  F+SP  G +  W     DE ASA   +  I + CNHD+ YGGLC  CG 
Sbjct: 61  SKKTVRESIEFFESPFEGDLVSWEVDRGDEVASARQVICEIMRPCNHDVVYGGLCTMCGK 120

Query: 115 TVDEEDNSK-NLTISHVNTNIKVSEQQAETLERSSLTRLREEKKLVLVVDLDQTVIHCGV 173
            VDE D  + NL ISH +TN+KVS ++AE +E     RLR+ KKLVLVVDLDQTVIHCGV
Sbjct: 121 EVDENDQMEANLAISHTDTNLKVSRKEAEDMEHFLKQRLRQSKKLVLVVDLDQTVIHCGV 180

Query: 174 DPTIGEWMRDPKNPNYKALQDVKSFTLEDEPIIPSFYFGPKPPARKSWYYVKLRPGLKEF 233
           DPTIGEW +DP NPNY+ L+DV+ F+LE+EPI+P  Y GP+ P RK WY+VK+RPGL+EF
Sbjct: 181 DPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMYMGPRLPERKCWYFVKVRPGLREF 240

Query: 234 FEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGELFGDRILSRDENGSLTTKSLERLFPMD 293
           F  ++P +EMHIYTMATR+YA EIAKIIDP G LFGDRILSRDENGSLT KSLERLFP D
Sbjct: 241 FAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSLFGDRILSRDENGSLTQKSLERLFPTD 300

Query: 294 QSMVVVIDDRGDVWNWFENLIKVVPYSFFVGIGDINSNFLPRQQNSVLHLGRH-HRRKQE 352
           QSMV+VIDDRGDVWNW  NLIKVVPY+FFVG+GDINSNFLPRQQ+ +L LGR  H++ QE
Sbjct: 301 QSMVIVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQSGLLQLGRRTHKKPQE 360

Query: 353 EEKLISDIIDNEKKLKEKIDEEVKRQEEIISHIGDDNTRKEGGPPNKEDISKKLEHSASL 412
            ++L++DI+D EK+L+EKIDEEVKRQEE +SH    N     G  +KE ++KKLE+SASL
Sbjct: 361 SDELLTDIMDTEKRLQEKIDEEVKRQEEKLSHQLTTNDEPVQG-ESKEQLTKKLEYSASL 419

Query: 413 EVQQQNRPLAELQKHLHNQTLLIDDDDELPHLSQILLRVHKEYFNQYTEAPKNPPDIKYL 472
           EVQQQNRPLA LQKH+HNQ LL+DDDDEL +L   L ++H++Y+    E  +N  DI+ L
Sbjct: 420 EVQQQNRPLATLQKHMHNQRLLVDDDDELYYLKDTLAKIHRKYYKLLDEGNENSADIQSL 479

Query: 473 LPQMKYKVFQGCHFVFSGLIPLETDVRKADIVLWTDMFGATTSSDINYKXXXXXXXXXXX 532
           +P MK +VF+ C+FVFSGLIPL T++R+ADIVLWT MFGA TSS+I+             
Sbjct: 480 VPTMKGQVFKDCYFVFSGLIPLGTNIRRADIVLWTGMFGAITSSEIDENTTHVITKTPGT 539

Query: 533 FKARLAKSFNPDIKIVHPDWLFECLVQWERVKESPYELLIQDPV 576
           +KAR+AK FN ++K+VHPDW+FECLV W  V E PYEL+IQDP 
Sbjct: 540 YKARIAKGFNENVKVVHPDWVFECLVTWTHVDEKPYELIIQDPA 583

>KAFR0B03910 Chr2 (811940..814114) [2175 bp, 724 aa] {ON} Anc_8.839
           YMR277W
          Length = 724

 Score =  709 bits (1830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/591 (58%), Positives = 433/591 (73%), Gaps = 18/591 (3%)

Query: 3   LETNVKVTSDLPYPITVAQLYVKPGDHVEKGQRLFAYEYWDFQDVLVKYEEKT------- 55
           + T V     LPYPIT+ +L    G ++EKG RLFAY++W   ++    ++         
Sbjct: 1   MTTPVLAPEGLPYPITIDELICPIGTYIEKGIRLFAYKFWYMVEIASSPDDNDPANTDTQ 60

Query: 56  ----KKQRVDRVATFDSPVSGTVKEWHCSVKDEFASANHEVITIRQDCNHDITYGGLCVQ 111
               KK+  + +  FD+P  GT+  W+  V DE +SA+  +  I++ CNHDI YGGLC Q
Sbjct: 61  ASHPKKKIRESIEFFDAPFEGTLISWNIDVGDELSSASQVICEIKRPCNHDIVYGGLCTQ 120

Query: 112 CGNTVDEEDNSK---NLTISHVNTNIKVSEQQAETLERSSLTRLREEKKLVLVVDLDQTV 168
           CG  VDE + S+   N T+SH +TN+K+S ++A  +      RLR EKKLVLVVDLDQTV
Sbjct: 121 CGKEVDESEQSQFGSNFTVSHTDTNLKISRKEALDIGEDFKKRLRNEKKLVLVVDLDQTV 180

Query: 169 IHCGVDPTIGEWMRDPKNPNYKALQDVKSFTLEDEPIIPSFYFGPKPPARKSWYYVKLRP 228
           IHCGVDPTIGEW  DP NPNY  L+DV+ F LE+EP++P  Y GPKP  RK WYYVK+RP
Sbjct: 181 IHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMYMGPKPTPRKCWYYVKVRP 240

Query: 229 GLKEFFEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGELFGDRILSRDENGSLTTKSLER 288
           GLKEFF+ V+P FEMHIYTMATR+YA EI KIIDPTGELFG+RILSRDENGSLT+KSLER
Sbjct: 241 GLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRILSRDENGSLTSKSLER 300

Query: 289 LFPMDQSMVVVIDDRGDVWNWFENLIKVVPYSFFVGIGDINSNFLPRQQNSVLHLGRHHR 348
           LFP DQSMV++IDDRGDVWNW  NLIKVVPYSFFVG+GDINSNFLP+QQ ++L LGR  R
Sbjct: 301 LFPTDQSMVIIIDDRGDVWNWSPNLIKVVPYSFFVGVGDINSNFLPKQQTTMLQLGRRSR 360

Query: 349 RK-QEEEKLISDIIDNEKKLKEKIDEEVKRQEEIISHIGDDNTRKEGGPPNKEDISKKLE 407
            K +E ++L++DI+D EKKL+EKIDEEVKRQE+ +SH     T +      KE+ +KKLE
Sbjct: 361 EKAKEADELLTDIMDTEKKLQEKIDEEVKRQEKNLSH-QVVPTEESVSNETKEEWTKKLE 419

Query: 408 HSASLEVQQQNRPLAELQKHLHNQTLLIDDDDELPHLSQILLRVHKEYFN--QYTEAPKN 465
           HSAS+EVQQQNRPLA LQ+HLHNQ LLIDDDDEL  L   L +VH EY++  +     ++
Sbjct: 420 HSASVEVQQQNRPLAALQEHLHNQRLLIDDDDELYFLKDTLAKVHNEYYSILENKSLDES 479

Query: 466 PPDIKYLLPQMKYKVFQGCHFVFSGLIPLETDVRKADIVLWTDMFGATTSSDINYKXXXX 525
             DIK ++P++K  VF+GCHFVFSGLIPL TD+R+ADIV+WT MFGA +SS+IN      
Sbjct: 480 GADIKLIMPKLKQSVFEGCHFVFSGLIPLHTDIRRADIVVWTSMFGAESSSEINEVTTHV 539

Query: 526 XXXXXXXFKARLAKSFNPDIKIVHPDWLFECLVQWERVKESPYELLIQDPV 576
                  FKARLAKSFN DIKIVHPDW+FECL++W  V E PY L++++P+
Sbjct: 540 ITKTPGTFKARLAKSFNSDIKIVHPDWVFECLIRWTHVDEKPYTLIVEEPI 590

>Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON}
           complement(15966..18203) [2238 nt, 746 aa]
          Length = 745

 Score =  686 bits (1770), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/580 (58%), Positives = 416/580 (71%), Gaps = 12/580 (2%)

Query: 3   LETNVKVTSDLPYPITVAQLYVKPGDHVEKGQRLFAYEYWDFQDVLVK--------YEEK 54
           + T V     LPYPIT+++L    G HVEKGQRLFAY++W   ++            +E 
Sbjct: 1   MSTPVSAPLGLPYPITISKLIASIGSHVEKGQRLFAYKFWYIVEIAKSPDENDDGVNDEH 60

Query: 55  TKKQRVDRVATFDSPVSGTVKEWHCSVKDEFASANHEVITIRQDCNHDITYGGLCVQCGN 114
           +KK   + +  FDSP  G +  W+  V DE    N  +  I + CNHDI Y G+C  CG 
Sbjct: 61  SKKSIRESIEFFDSPFEGDLVSWNVDVGDEIVEPNQTICEIVRPCNHDIVYAGICTMCGK 120

Query: 115 TVDEEDN-SKNLTISHVNTNIKVSEQQAETLERSSLTRLREEKKLVLVVDLDQTVIHCGV 173
            VDE D  S NLTISH +TN+KVS ++A  + +    RL  EKKL+LVVDLDQTVIHCGV
Sbjct: 121 EVDESDQVSANLTISHTDTNLKVSRREANDIGQGIKKRLIREKKLILVVDLDQTVIHCGV 180

Query: 174 DPTIGEWMRDPKNPNYKALQDVKSFTLEDEPIIPSFYFGPKPPARKSWYYVKLRPGLKEF 233
           DPTI EW  DP NPN++ L+DVKSF LE+EPI+P  Y GPKPP  K WYYVK+RPGLKEF
Sbjct: 181 DPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYMGPKPPTHKCWYYVKIRPGLKEF 240

Query: 234 FEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGELFGDRILSRDENGSLTTKSLERLFPMD 293
           FE VS  +EMHIYTMATRSYA EIAKIIDP G LF DRILSR+ENGSLT KSLERLFP D
Sbjct: 241 FEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFADRILSRNENGSLTHKSLERLFPTD 300

Query: 294 QSMVVVIDDRGDVWNWFENLIKVVPYSFFVGIGDINSNFLPRQQNSVLHLG-RHHRRKQE 352
           QSMVVVIDDRGDVWNW  NLIKV PY+FFVGIGDINSNFLPRQQ ++L LG R+H++ ++
Sbjct: 301 QSMVVVIDDRGDVWNWCPNLIKVTPYNFFVGIGDINSNFLPRQQTTMLQLGRRNHKKTED 360

Query: 353 EEKLISDIIDNEKKLKEKIDEEVKRQEEIISHIGDDNTRKEGGPPNKEDISKKLEHSASL 412
            ++L++DI+D EKKL+EKIDEEVKRQEE +SH       +      KEDI+KK+E SASL
Sbjct: 361 TDELLTDIMDTEKKLQEKIDEEVKRQEENLSHQSAALGEEISSQVRKEDITKKIEFSASL 420

Query: 413 EVQQQNRPLAELQKHLHNQTLLIDDDDELPHLSQILLRVHKEYFNQYTEAPKNPPDIKYL 472
           EVQQQNRPLAELQKH+HNQ LL DDDDEL +L  IL  V ++Y+ +          I+ L
Sbjct: 421 EVQQQNRPLAELQKHMHNQQLLTDDDDELFYLKDILKNVQQKYYEEL--KTDKEIQIQTL 478

Query: 473 LPQMKYKVFQGCHFVFSGLIPLETDVRKADIVLWTDMFGATTSSDINYKXXXXXXXXXXX 532
           +P++K KV +GC+FVFSGLIPL T+++KADIVLWT+MFGA +S+DI              
Sbjct: 479 MPKLKKKVLEGCNFVFSGLIPLGTNIQKADIVLWTNMFGAQSSADITEDTTHVITKTPHT 538

Query: 533 FKARLAKSFNPDIKIVHPDWLFECLVQWERVKESPYELLI 572
           +KA++AK+F  DIK++HPDW+FECL+ W+ + E PYE  I
Sbjct: 539 YKAKIAKAFKSDIKVLHPDWVFECLLNWKYMPEFPYEYNI 578

>TBLA0D03260 Chr4 (810350..812656) [2307 bp, 768 aa] {ON} Anc_8.839
           YMR277W
          Length = 768

 Score =  681 bits (1758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/626 (53%), Positives = 434/626 (69%), Gaps = 54/626 (8%)

Query: 3   LETNVKVTSDLPYPITVAQLYVKPGDHVEKGQRLFAYEYWDFQDVLVKYEEK-------- 54
           + T V   +DLP+PIT+ QL    G HVEKGQRLFAY++W   ++    +          
Sbjct: 1   MSTPVLSPADLPFPITIDQLITPIGSHVEKGQRLFAYKFWYMVEIAQSPDNNDPTSENSS 60

Query: 55  ------------------TKKQRVDRVATFDSPVSGTVKEWHCSVKDEFASANHEVITIR 96
                              KK   + +  F+SP  G +  W+    DE  S N  +  I+
Sbjct: 61  DLSGNNSDSNENGNNASHQKKSIRESIEFFESPFEGDLIGWNVDKGDEIISENQLLCDIK 120

Query: 97  QDCNHDITYGGLCVQCGNTVDEED-NSKNLTISHVNTNIKVSEQQAETLERSSLTRLREE 155
           + CNHDI Y G+C QCG  VD+ D    +L+ISH +TN+K+S ++A  +++SS++RL++ 
Sbjct: 121 RPCNHDIVYAGICTQCGKEVDDSDIMDASLSISHTDTNLKISRKEARDIDQSSMSRLKKI 180

Query: 156 KKLVLVVDLDQTVIHCGVDPTIGEWMRDPKNPNYKALQDVKSFTLEDEPIIPSFYFGPKP 215
           KKL+LVVDLDQTVIHCGVDPTIGEW  DPKNPNY+ L+DV+SF+L++EPI+P  Y GP+P
Sbjct: 181 KKLILVVDLDQTVIHCGVDPTIGEWKNDPKNPNYETLKDVRSFSLDEEPILPPSYMGPRP 240

Query: 216 PARKSWYYVKLRPGLKEFFEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGELFGDRILSR 275
           P RK WYYVK+RPGLKEFF  ++P +EMHIYTMATR+YA EIAKIIDP G LFG RILSR
Sbjct: 241 PVRKCWYYVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSLFGSRILSR 300

Query: 276 DENGSLTTKSLERLFPMDQSMVVVIDDRGDVWNWFENLIKVVPYSFFVGIGDINSNFLPR 335
           DENGSLT KSLERLFP DQSMV++IDDRGDVWNW  NLIKV+PY+FFVGIGDINSNFLPR
Sbjct: 301 DENGSLTQKSLERLFPTDQSMVIIIDDRGDVWNWCNNLIKVIPYNFFVGIGDINSNFLPR 360

Query: 336 QQNSVLHLG-RHHRRKQ----------------------EEEKLISDIIDNEKKLKEKID 372
           QQ+++L LG R H++K                       + E+L++DI+D EKKL++KID
Sbjct: 361 QQSTMLQLGIRSHKKKNTNETLNSEDDKSDSTLSVHEKDKTEELLTDIMDTEKKLQKKID 420

Query: 373 EEVKRQEEIISHIGDDNTRKE--GGPPNKEDISKKLEHSASLEVQQQNRPLAELQKHLHN 430
           EEV+RQE+ +  I D+  +++      +  ++SKK+E SASLEVQQQNRPLA LQ+H  N
Sbjct: 421 EEVRRQEKKL--IKDEMPKRKSISDESSNNELSKKIEFSASLEVQQQNRPLATLQRHRQN 478

Query: 431 QTLLIDDDDELPHLSQILLRVHKEYFNQYTEAPKNPPDIKYLLPQMKYKVFQGCHFVFSG 490
           Q LLIDDDDEL +L  IL  VH  ++ Q  E       I+ L+P++K+ VF G +FVFSG
Sbjct: 479 QRLLIDDDDELFYLKDILTEVHDTFYEQLDEDKNESVSIQTLMPRLKFSVFSGYNFVFSG 538

Query: 491 LIPLETDVRKADIVLWTDMFGATTSSDINYKXXXXXXXXXXXFKARLAKSFNPDIKIVHP 550
           LIPL TD+R+ADIVLWT+MFGA +++DI+             +KARLAK+FNP+IK+VHP
Sbjct: 539 LIPLGTDIRRADIVLWTNMFGANSTADIDENTTHVITKTAGTYKARLAKAFNPEIKVVHP 598

Query: 551 DWLFECLVQWERVKESPYELLIQDPV 576
           DW+FECLV W+R+ E PYEL+I+ P 
Sbjct: 599 DWIFECLVSWKRMPEKPYELIIEQPA 624

>NDAI0K00420 Chr11 complement(94101..96437) [2337 bp, 778 aa] {ON}
           Anc_8.839 YMR277W
          Length = 778

 Score =  666 bits (1718), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/526 (60%), Positives = 398/526 (75%), Gaps = 15/526 (2%)

Query: 66  FDSPVSGTVKEWHCSVKDEFASANHEVITIRQDCNHDITYGGLCVQCGNTVDEED----N 121
           FD P  G +  W     D+    N  +  I++ CNHD+ YGGLC  CG  VDE D    +
Sbjct: 116 FDCPYDGILTSWLVEKGDQIVGPNQPLCEIQRPCNHDVIYGGLCTLCGKEVDENDIDDLS 175

Query: 122 SKNLTISHVNTNIKVSEQQAETLERSSLTRLREEKKLVLVVDLDQTVIHCGVDPTIGEWM 181
             NLTISH +TN+K+S ++A  + +S   RLR++KKL+LVVDLDQTVIHCGVDPTIGEW 
Sbjct: 176 GPNLTISHTDTNLKISTREAVDIGQSVKKRLRDDKKLILVVDLDQTVIHCGVDPTIGEWK 235

Query: 182 RDPKNPNYKALQDVKSFTLEDEPIIPSFYFGPKPPARKSWYYVKLRPGLKEFFEAVSPHF 241
           RDP NPN++ L+DVK F LE+EPI+P  Y GPKPPARK WYYVK+RPGLK+FF+ V+P F
Sbjct: 236 RDPTNPNFETLKDVKEFALEEEPILPLMYMGPKPPARKCWYYVKVRPGLKDFFQKVAPLF 295

Query: 242 EMHIYTMATRSYAHEIAKIIDPTGELFGDRILSRDENGSLTTKSLERLFPMDQSMVVVID 301
           EMHIYTMATR+YA EIAKIIDPTG+LFG+RILSRDENGSLTTKSLERLFP DQSMV++ID
Sbjct: 296 EMHIYTMATRAYASEIAKIIDPTGDLFGNRILSRDENGSLTTKSLERLFPTDQSMVIIID 355

Query: 302 DRGDVWNWFENLIKVVPYSFFVGIGDINSNFLPRQQNSVLHLGRHHRR------KQEEEK 355
           DRGDVWNW  NLIKV+PY+FFVG+GDINSNFLP+QQ ++L LGR   R       +E + 
Sbjct: 356 DRGDVWNWSPNLIKVIPYNFFVGVGDINSNFLPKQQATMLQLGRRSSRGESKVSTKENDD 415

Query: 356 LISDIIDNEKKLKEKIDEEVKRQEEIISH-IGDDNTRKEGGPPNKEDISKKLEHSASLEV 414
           L++DI+D EK L+ KI+EEVKRQEE ++H +            NKE+ISKK+E+SASLEV
Sbjct: 416 LLTDIMDTEKVLQRKINEEVKRQEEKLNHQLATIEEPPTTAGENKEEISKKIEYSASLEV 475

Query: 415 QQQNRPLAELQKHLHNQTLLIDDDDELPHLSQILLRVHKEYFNQYTEAPKNP----PDIK 470
           QQ+NRPLA LQKH H+Q LLIDDD+EL HL   L ++H +Y+    +A +N     PDIK
Sbjct: 476 QQKNRPLATLQKHFHDQRLLIDDDEELYHLKDTLSKIHSKYYEMLQKANENKDSIEPDIK 535

Query: 471 YLLPQMKYKVFQGCHFVFSGLIPLETDVRKADIVLWTDMFGATTSSDINYKXXXXXXXXX 530
           Y++PQMK  V Q CHFVFSGLIPL T+++K+DIV+WT+MFGA +++DI+           
Sbjct: 536 YIMPQMKQTVLQDCHFVFSGLIPLGTNIQKSDIVIWTNMFGARSTADIDENTTHVITKTP 595

Query: 531 XXFKARLAKSFNPDIKIVHPDWLFECLVQWERVKESPYELLIQDPV 576
             +KARLAKS++PDIKIVHPDW+FECL++W+ V+E PYELL++  V
Sbjct: 596 GTYKARLAKSYDPDIKIVHPDWVFECLMRWKHVEEKPYELLVEQLV 641

 Score = 38.1 bits (87), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 24/42 (57%)

Query: 1  MSLETNVKVTSDLPYPITVAQLYVKPGDHVEKGQRLFAYEYW 42
          M+  T ++    LPYPIT+ +L    G  + K  RL AY++W
Sbjct: 1  MATPTVIRAPLGLPYPITIDELMKPIGTEMNKDDRLLAYKFW 42

>TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839
           YMR277W
          Length = 732

 Score =  664 bits (1713), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/587 (56%), Positives = 413/587 (70%), Gaps = 17/587 (2%)

Query: 3   LETNVKVTSDLPYPITVAQLYVKPGDHVEKGQRLFAYEYWDFQDVL-----------VKY 51
           + T VK    +PYPIT+++L    G ++ KG RLFAY++W   ++            V+ 
Sbjct: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60

Query: 52  EEKTKKQRVDRVATFDSPVSGTVKEWHCSVKDEFASANHEVITIRQDCNHDITYGGLCVQ 111
            E++KK   + +  FD+P  GT+  W+  V DE       V  +++ C+HDI Y G+C  
Sbjct: 61  GEQSKKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICTM 120

Query: 112 CGNTVDEEDN-SKNLTISHVNTNIKVSEQQAETLERSSLTRLREEKKLVLVVDLDQTVIH 170
           CG  VDE D  S NLTISH +TN+KVS Q+A  + +++ +RL   KKL+LVVDLDQTVIH
Sbjct: 121 CGKEVDERDQVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVVDLDQTVIH 180

Query: 171 CGVDPTIGEWMRDPKNPNYKALQDVKSFTLEDEPIIPSFYFGPKPPARKSWYYVKLRPGL 230
           CGVDPTI EW  DP NPNY+ L++VKSF LE+E I+P  Y GPKPP  K  YYVK+RPGL
Sbjct: 181 CGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSYYVKVRPGL 240

Query: 231 KEFFEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGELFGDRILSRDENGSLTTKSLERLF 290
           KEFFE V+P +EMHIYTMATR+YA EIAKIIDP G LFG+RILSRDENGSLT KSLERLF
Sbjct: 241 KEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLTHKSLERLF 300

Query: 291 PMDQSMVVVIDDRGDVWNWFENLIKVVPYSFFVGIGDINSNFLPRQQNSVLHLGRHHRRK 350
           P DQSMVV+IDDRGDVWNW  NLIKV PY+FFVGIGDINSNFLPRQQ ++L +GR +   
Sbjct: 301 PTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQMGRRNHNA 360

Query: 351 ---QEEEKLISDIIDNEKKLKEKIDEEVKRQEEIISHIGDDNTRKEGGPPNKEDISKKLE 407
              +E E+L++DIID EKKL+EKID+EVKRQE  ++H       +        DI+KK+E
Sbjct: 361 EKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGEEAVAQVRNGDITKKIE 420

Query: 408 HSASLEVQQQNRPLAELQKHLHNQTLLIDDDDELPHLSQILLRVHKEYFNQYTEAPKNPP 467
            SASLEVQQQNRPLAELQKH+HNQ LL DDDDEL +L +IL  V  E++        N  
Sbjct: 421 FSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYKALELKNGNSD 480

Query: 468 D--IKYLLPQMKYKVFQGCHFVFSGLIPLETDVRKADIVLWTDMFGATTSSDINYKXXXX 525
           D  I+ L+P++K  VF+ C+FVFSGLIPL TD++KADIVLWT MFGA+++S+I       
Sbjct: 481 DTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSNITENTTHV 540

Query: 526 XXXXXXXFKARLAKSFNPDIKIVHPDWLFECLVQWERVKESPYELLI 572
                   KAR+AKSFNP IK+VHPDW+FECL  W+ V E  +EL +
Sbjct: 541 ITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKV 587

>Suva_13.465 Chr13 (802947..805145) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score =  656 bits (1693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/600 (54%), Positives = 418/600 (69%), Gaps = 28/600 (4%)

Query: 3   LETNVKVTSDLPYPITVAQLYVKPGDHVEKGQRLFAYEYWDFQD---------------- 46
           + T ++    LPYPI + +L    G  +++G RL  Y++W   +                
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSFLQEGDRLLVYKFWYLVERPSDAGDDDNDHDSSP 60

Query: 47  --VLVKYEEKTKKQRVDRVATFDSPVSGTVKEWHCSVKDEFASANHEVITIRQDCNHDIT 104
                       KQ  + +  F+SP  G +  W+  V DE A+AN  +  I++ CNHDI 
Sbjct: 61  GGGGGGSVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHDIV 120

Query: 105 YGGLCVQCGNTVDEEDNSKNLTISHV-NTNIKVSEQQAETLERSSLTRLREEKKLVLVVD 163
           YGGLC QCG  V   D    + +  V + ++++SE +A    R+    LR +KKL+LVVD
Sbjct: 121 YGGLCTQCGKEV-SADAFDGVPLDVVGDMDLQISETEAIRTGRALKEHLRRDKKLILVVD 179

Query: 164 LDQTVIHCGVDPTIGEWMRDPKNPNYKALQDVKSFTLEDEPIIPSFYFG-----PKPP-A 217
           LDQT+IHCGVDPTI EW  DP NPN++ L+DVKSFTL++E ++P  Y       PKPP  
Sbjct: 180 LDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGSVPKPPPV 239

Query: 218 RKSWYYVKLRPGLKEFFEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGELFGDRILSRDE 277
           RK WYYVK+RPGLKEFF  V+P FEMHIYTMATR+YA +IAKI+DPTGELFGDRILSRDE
Sbjct: 240 RKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSRDE 299

Query: 278 NGSLTTKSLERLFPMDQSMVVVIDDRGDVWNWFENLIKVVPYSFFVGIGDINSNFLPRQQ 337
           NGSLTTKSL +LFP DQSMVVVIDDRGDVWNW  NLIKVVPY+FFVG+GDINSNFLP+Q 
Sbjct: 300 NGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQS 359

Query: 338 NSVLHLGRHHRRK-QEEEKLISDIIDNEKKLKEKIDEEVKRQEEIISHIGDDNTRKEGGP 396
             +L LGR  R+K QE ++LI+DI+DNEKKL+EKID EVKRQEE ++H       +    
Sbjct: 360 TGMLQLGRKTRQKSQESQELITDIMDNEKKLQEKIDIEVKRQEEQLNH-QLATAEEPSAN 418

Query: 397 PNKEDISKKLEHSASLEVQQQNRPLAELQKHLHNQTLLIDDDDELPHLSQILLRVHKEYF 456
            +KE+++KKLE+SASLEVQQQNRPLA+LQKHLH+Q LL+DDDDEL +L   LL +HK Y+
Sbjct: 419 ESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELHYLMSTLLNIHKTYY 478

Query: 457 NQYTEAPKNPPDIKYLLPQMKYKVFQGCHFVFSGLIPLETDVRKADIVLWTDMFGATTSS 516
              ++  +  P++  ++P +K KVFQ C+FVFSGLIPL TD++++DIV+WT  FGAT++S
Sbjct: 479 QMLSQPGEIEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATSTS 538

Query: 517 DINYKXXXXXXXXXXXFKARLAKSFNPDIKIVHPDWLFECLVQWERVKESPYELLIQDPV 576
           DINY            +KARLAK FNP+IK+VHPDW+FECLV W++V E PY L++  P+
Sbjct: 539 DINYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLVNWKKVDEKPYTLIVDSPI 598

>YMR277W Chr13 (820256..822454) [2199 bp, 732 aa] {ON}
           FCP1Carboxy-terminal domain (CTD) phosphatase, essential
           for dephosphorylation of the repeated C-terminal domain
           of the RNA polymerase II large subunit (Rpo21p)
          Length = 732

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/607 (53%), Positives = 419/607 (69%), Gaps = 41/607 (6%)

Query: 3   LETNVKVTSDLPYPITVAQLYVKPGDHVEKGQRLFAYEYWDFQDVLVKYEEKT------- 55
           + T ++    LPYPI + +L    G ++ +G RL  Y++W     LV+    T       
Sbjct: 1   MTTQIRSPQGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFW----YLVERASDTGDDDNEH 56

Query: 56  ----------------KKQRVDRVATFDSPVSGTVKEWHCSVKDEFASANHEVITIRQDC 99
                            KQ  + +  F+SP  G +  W+  V DE A+AN  +  I++ C
Sbjct: 57  DVSPGGSAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPC 116

Query: 100 NHDITYGGLCVQCGNTVDEEDNSKNLTISHV-NTNIKVSEQQAETLERSSLTRLREEKKL 158
           NHDI YGGLC QCG  V   D    + +  V + ++++SE +A    ++    LR +KKL
Sbjct: 117 NHDIVYGGLCTQCGKEV-SADAFDGVPLDVVGDVDLQISETEAIRTGKALKEHLRRDKKL 175

Query: 159 VLVVDLDQTVIHCGVDPTIGEWMRDPKNPNYKALQDVKSFTLEDEPIIPSFYFGPK---- 214
           +LVVDLDQT+IHCGVDPTI EW  DP NPN++ L+DVKSFTL++E ++P  Y        
Sbjct: 176 ILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDGSML 235

Query: 215 --PPARKSWYYVKLRPGLKEFFEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGELFGDRI 272
             PP RK WYYVK+RPGLKEFF  V+P FEMHIYTMATR+YA +IAKI+DPTGELFGDRI
Sbjct: 236 RPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRI 295

Query: 273 LSRDENGSLTTKSLERLFPMDQSMVVVIDDRGDVWNWFENLIKVVPYSFFVGIGDINSNF 332
           LSRDENGSLTTKSL +LFP DQSMVVVIDDRGDVWNW  NLIKVVPY+FFVG+GDINSNF
Sbjct: 296 LSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNF 355

Query: 333 LPRQQNSVLHLGRHHRRK-QEEEKLISDIIDNEKKLKEKIDEEVKRQEEIISHIGDDNTR 391
           LP+Q   +L LGR  R+K QE ++L++DI+DNEKKL+EKID+EVKRQEE ++H       
Sbjct: 356 LPKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNH---QLAT 412

Query: 392 KEGGPPN--KEDISKKLEHSASLEVQQQNRPLAELQKHLHNQTLLIDDDDELPHLSQILL 449
            E  P N  KE+++KKLE+SASLEVQQQNRPLA+LQKHLH+Q LL+DDDDEL +L   L 
Sbjct: 413 AEEPPANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLS 472

Query: 450 RVHKEYFNQYTEAPKNPPDIKYLLPQMKYKVFQGCHFVFSGLIPLETDVRKADIVLWTDM 509
            +HK Y++  ++  +  P++  ++P +K KVFQ C+FVFSGLIPL TD++++DIV+WT  
Sbjct: 473 NIHKTYYDMLSQQNEPEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTST 532

Query: 510 FGATTSSDINYKXXXXXXXXXXXFKARLAKSFNPDIKIVHPDWLFECLVQWERVKESPYE 569
           FGAT++ DI+Y            +KARLAK FNP IKIVHPDW+FECLV W++V E PY 
Sbjct: 533 FGATSTPDIDYLTTHLITKNPSTYKARLAKKFNPQIKIVHPDWIFECLVNWKKVDEKPYT 592

Query: 570 LLIQDPV 576
           L++  P+
Sbjct: 593 LIVDSPI 599

>Skud_13.449 Chr13 (793592..795796) [2205 bp, 734 aa] {ON} YMR277W
           (REAL)
          Length = 734

 Score =  649 bits (1675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/606 (52%), Positives = 419/606 (69%), Gaps = 38/606 (6%)

Query: 3   LETNVKVTSDLPYPITVAQLYVKPGDHVEKGQRLFAYEYWDFQDVLVKYEEKTK------ 56
           + T ++    LPYPI + +L    G ++ +G RL  Y++W     LV+    T       
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLVPSVGSYLHEGDRLIVYKFW----YLVERASDTTGDDDNE 56

Query: 57  ------------------KQRVDRVATFDSPVSGTVKEWHCSVKDEFASANHEVITIRQD 98
                             KQ  + +  F+SP  G +  W+  V DE A+AN  +  I++ 
Sbjct: 57  HDATPGGGAGSGSVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRP 116

Query: 99  CNHDITYGGLCVQCGNTVDEEDNSKNLTISHV-NTNIKVSEQQAETLERSSLTRLREEKK 157
           CNHDI YGGLC QCG  V   D    + +  V + ++++SE +A     +    LR +KK
Sbjct: 117 CNHDIVYGGLCTQCGKEV-SADAFDGVPLDVVGDMDLQISETEAIRSGEALKEHLRRDKK 175

Query: 158 LVLVVDLDQTVIHCGVDPTIGEWMRDPKNPNYKALQDVKSFTLEDEPIIPSFYFGPK--- 214
           L+LVVDLDQT+IHCGVDPTI EW  DP NPN++ L+DVKSFTL++E ++P  Y       
Sbjct: 176 LILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSV 235

Query: 215 ---PPARKSWYYVKLRPGLKEFFEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGELFGDR 271
              PP RK WYYVK+RPGLKEFF+ V+P FEMHIYTMATR+YA +IAKI+DPTGELFGDR
Sbjct: 236 LKPPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGELFGDR 295

Query: 272 ILSRDENGSLTTKSLERLFPMDQSMVVVIDDRGDVWNWFENLIKVVPYSFFVGIGDINSN 331
           ILSRDENGSLTTKSL +LFP DQSMVVVIDDRGDVWNW  NLIKVVPY+FFVG+GDINSN
Sbjct: 296 ILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSN 355

Query: 332 FLPRQQNSVLHLGRHHRRK-QEEEKLISDIIDNEKKLKEKIDEEVKRQEEIISHIGDDNT 390
           FLP+Q   +L LGR  R+K QE ++L++DI+DNEKKL+EKID+EVKRQEE ++H      
Sbjct: 356 FLPKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNH-QLATA 414

Query: 391 RKEGGPPNKEDISKKLEHSASLEVQQQNRPLAELQKHLHNQTLLIDDDDELPHLSQILLR 450
            +     +KE+++KKLE+SASLEVQQQNRPLA+LQKHLH+Q LL+DDDDEL +L   L  
Sbjct: 415 EEPSANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLSN 474

Query: 451 VHKEYFNQYTEAPKNPPDIKYLLPQMKYKVFQGCHFVFSGLIPLETDVRKADIVLWTDMF 510
           +H  Y+   +++ +  P++  ++P +K KVFQ CHFVFSGLIPL TD++++DIV+WT  F
Sbjct: 475 IHNTYYQMISQSNEPEPNLMEIIPSLKQKVFQNCHFVFSGLIPLGTDIQRSDIVIWTSTF 534

Query: 511 GATTSSDINYKXXXXXXXXXXXFKARLAKSFNPDIKIVHPDWLFECLVQWERVKESPYEL 570
           GAT++SDI+Y            +KARLAK FNP+IKI+HPDW+FECLV W++V E PY L
Sbjct: 535 GATSTSDIDYLTTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFECLVNWKKVDEKPYTL 594

Query: 571 LIQDPV 576
           ++  P+
Sbjct: 595 IVDSPI 600

>Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/607 (53%), Positives = 419/607 (69%), Gaps = 41/607 (6%)

Query: 3   LETNVKVTSDLPYPITVAQLYVKPGDHVEKGQRLFAYEYWDFQDVLVKYEEKT------- 55
           + T ++    LPYPI + +L    G ++ +G RL  Y++W     LV+   +T       
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFW----YLVERASETGVDDNEH 56

Query: 56  ----------------KKQRVDRVATFDSPVSGTVKEWHCSVKDEFASANHEVITIRQDC 99
                            KQ  + +  F+SP  G +  W+  V DE A+AN  +  I++ C
Sbjct: 57  DASPGGGAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPC 116

Query: 100 NHDITYGGLCVQCGNTVDEEDNSKNLTISHV-NTNIKVSEQQAETLERSSLTRLREEKKL 158
           NHDI YGGLC QCG  V   D    + +  V + ++++SE +A    ++    LR +KKL
Sbjct: 117 NHDIVYGGLCTQCGKEV-SADAFDGVPLDVVGDMDLQISETEAIRTGKALKEHLRRDKKL 175

Query: 159 VLVVDLDQTVIHCGVDPTIGEWMRDPKNPNYKALQDVKSFTLEDEPIIPSFYFGPK---- 214
           +LVVDLDQT+IHCGVDPTI EW  DP NPN++ L+DVKSFTL++E ++P  Y        
Sbjct: 176 ILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVL 235

Query: 215 --PPARKSWYYVKLRPGLKEFFEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGELFGDRI 272
             PP RK WYYVK+RPGLKEFF  V+P FEMHIYTMATR+YA +IAKI+DPTG+LFGDRI
Sbjct: 236 RPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFGDRI 295

Query: 273 LSRDENGSLTTKSLERLFPMDQSMVVVIDDRGDVWNWFENLIKVVPYSFFVGIGDINSNF 332
           LSRDENGSLTTKSL +LFP DQSMVVVIDDRGDVWNW  NLIKVVPY+FFVG+GDINSNF
Sbjct: 296 LSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNF 355

Query: 333 LPRQQNSVLHLGRHHRRK-QEEEKLISDIIDNEKKLKEKIDEEVKRQEEIISHIGDDNTR 391
           LP+Q   +L LGR  R+K QE ++L++DI+DNEKKL+EKID+EVKRQEE ++H       
Sbjct: 356 LPKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNH---QLAT 412

Query: 392 KEGGPPN--KEDISKKLEHSASLEVQQQNRPLAELQKHLHNQTLLIDDDDELPHLSQILL 449
            E  P N  KE+++KKLE+SASLEVQQQNRPLA+LQKHLH+Q LL+DDDDEL +L   L 
Sbjct: 413 AEEPPANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLS 472

Query: 450 RVHKEYFNQYTEAPKNPPDIKYLLPQMKYKVFQGCHFVFSGLIPLETDVRKADIVLWTDM 509
            +H  Y+   ++  +  P++  ++P +K KVFQ C FVFSGLIPL TD++++DIV+WT  
Sbjct: 473 NIHMTYYQMLSQENEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVIWTST 532

Query: 510 FGATTSSDINYKXXXXXXXXXXXFKARLAKSFNPDIKIVHPDWLFECLVQWERVKESPYE 569
           FGAT++SDI++            +KARLAK FNP+IKIVHPDW+FECLV W++V E PY 
Sbjct: 533 FGATSTSDIDFLTTHLITKNPSTYKARLAKKFNPEIKIVHPDWIFECLVNWKKVDEKPYT 592

Query: 570 LLIQDPV 576
           L++  P+
Sbjct: 593 LIVDSPI 599

>KNAG0J00280 Chr10 complement(41831..44059) [2229 bp, 742 aa] {ON}
           Anc_8.839 YMR277W
          Length = 742

 Score =  646 bits (1666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/605 (54%), Positives = 422/605 (69%), Gaps = 34/605 (5%)

Query: 5   TNVKVTSDLPYPITVAQLYVKPGDHVEKGQRLFAYEYW---DFQDVLVKYE-------EK 54
           T V   + LPYP+TV +L  + GD V +G RLFAY++W   +   V    E         
Sbjct: 7   TPVVSGAGLPYPVTVDELIPQVGDRVSRGDRLFAYKFWYVVELAGVDAAAEGDSDGTGTT 66

Query: 55  TKKQRVDRVATFDSPVSGTVKEWHCSVKDEFASANHEVITIRQDCNHDITYGGLCVQCGN 114
            KK   + V  F+SP  GTV  W     DE       +  +R+ CNHD+ Y GLC  CG 
Sbjct: 67  AKKSVRESVEFFESPFEGTVVSWDVDAGDEIPGPGAPLCLLRRPCNHDVVYNGLCTLCGR 126

Query: 115 TVDEED----------NSKNLTISHVNTNIKVSEQQAETLERSSLTRLREEKKLVLVVDL 164
            VDE +             NLT+SH +TN+++S  +A+ L+     RLR  +KLVLVVDL
Sbjct: 127 EVDEYEIQAAAAASGGVGPNLTVSHRDTNLQISRVEAQQLDLQLQQRLRAAQKLVLVVDL 186

Query: 165 DQTVIHCGVDPTIGEWMRDPKNPNYKALQDVKSFTLEDEPIIPSFYFGPKPPA-RKSWYY 223
           DQTV+HCGVDPTIGEW RDP+NPNY+AL+DV+SF LE+EPI+P  Y G K PA RK WYY
Sbjct: 187 DQTVVHCGVDPTIGEWKRDPRNPNYEALRDVQSFALEEEPILPFLYVGGKRPAPRKCWYY 246

Query: 224 VKLRPGLKEFFEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGELFGDRILSRDENGSLTT 283
           VK+RPGLK+FF+ ++P FEMHIYTMATR+YA EIAKIIDP   LFGDRILSRDENGSLT 
Sbjct: 247 VKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTH 306

Query: 284 KSLERLFPMDQSMVVVIDDRGDVWNWFENLIKVVPYSFFVGIGDINSNFLPRQQNSVLHL 343
           KSLERLFP DQSMV VIDDRGDVWNW  NLIKVVPY+FFVG+GDINSNFLP+QQ ++L +
Sbjct: 307 KSLERLFPTDQSMVTVIDDRGDVWNWCANLIKVVPYNFFVGVGDINSNFLPKQQPTMLQM 366

Query: 344 GRH-------HRRKQEEEK-----LISDIIDNEKKLKEKIDEEVKRQEEIISHIGDDNTR 391
           GR        H  KQ+++      L++DI++ EK+L+EKID+EVKRQE  ++        
Sbjct: 367 GRRSKLNERGHESKQQQDDVKDDLLLTDIMNTEKQLQEKIDQEVKRQEHKLNKGNAAGDE 426

Query: 392 KEGGPPNKEDISKKLEHSASLEVQQQNRPLAELQKHLHNQTLLIDDDDELPHLSQILLRV 451
           ++    +KE+ +KKLE SAS+EVQQ+NRPLA LQKHLHNQ LL+D+DDEL +L   L  +
Sbjct: 427 QQTPGQSKEEWTKKLEFSASVEVQQKNRPLATLQKHLHNQKLLVDNDDELFYLKDRLADL 486

Query: 452 HKEYFNQYTEAPKNPPDIKYLLPQMKYKVFQGCHFVFSGLIPLETDVRKADIVLWTDMFG 511
           HK Y++   E P++  +I+ ++ Q+K +VFQ CHFVFSGLIPL T+V+ ADIV+WT+ FG
Sbjct: 487 HKRYYSTLKENPQD-TNIQSIMTQLKTRVFQDCHFVFSGLIPLNTNVQAADIVIWTNKFG 545

Query: 512 ATTSSDINYKXXXXXXXXXXXFKARLAKSFNPDIKIVHPDWLFECLVQWERVKESPYELL 571
           ATT++D++              KARLAK+FNPDIKIVHPDW+FECL++WERV   PY L+
Sbjct: 546 ATTTNDLDETTTHLITKTPGTNKARLAKAFNPDIKIVHPDWIFECLIKWERVDVKPYLLI 605

Query: 572 IQDPV 576
           ++DPV
Sbjct: 606 VEDPV 610

>NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON}
           Anc_5.202
          Length = 473

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 54/128 (42%), Gaps = 38/128 (29%)

Query: 153 REEKKLV----LVVDLDQTVIHCGVDPTIGEWMRDPKNPNYKALQDVKSFTLE---DEPI 205
           + EKKL+    LV+DLD+T++H                  +K LQ    F L    DE I
Sbjct: 294 KTEKKLIGKKCLVLDLDETLVHSS----------------FKYLQ-TADFVLPVNIDEQI 336

Query: 206 IPSFYFGPKPPARKSWYYVKLRPGLKEFFEAVSPHFEMHIYTMATRSYAHEIAKIIDPTG 265
                            YV  RPG++EF + V   FE+ ++T +   Y   +  I+DP  
Sbjct: 337 --------------HNVYVIKRPGVEEFLKRVGELFEVVVFTASVARYGDPLLDILDPGR 382

Query: 266 ELFGDRIL 273
           +L   R+ 
Sbjct: 383 QLIHHRLF 390

>SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 399

 Score = 39.7 bits (91), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 4/60 (6%)

Query: 223 YVKLRPGLKEFFEAVSPHFEMHIYTMATRSYAHEIAKIIDPTG----ELFGDRILSRDEN 278
           YV  RPG+ EF E V   +E+ ++T +   Y   +  I+DP G     LF D   + D N
Sbjct: 267 YVIKRPGVDEFLERVGKLYEVVVFTASVSRYGDPLLDILDPRGAVHHRLFRDSCYNYDGN 326

>TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.202
           YLL010C
          Length = 494

 Score = 38.9 bits (89), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 27/51 (52%)

Query: 223 YVKLRPGLKEFFEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGELFGDRIL 273
           YV  RPG+ EF + VS  +E+ ++T +   Y   +  I+DP   +   R+ 
Sbjct: 361 YVIKRPGVDEFLKRVSELYEVVVFTASVSRYGDPLLNILDPANTIIHHRLF 411

>NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202
          Length = 514

 Score = 38.9 bits (89), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%)

Query: 223 YVKLRPGLKEFFEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGELFGDRIL 273
           YV  RPG+ EF E V   FE+ I+T +   Y   +   +DP G+    R+ 
Sbjct: 381 YVIKRPGVDEFLEKVGKLFEVVIFTASVSRYGDPLLDRLDPKGKSIHHRLF 431

>YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}
           PSR2Functionally redundant Psr1p homolog, a plasma
           membrane phosphatase involved in the general stress
           response; required with Psr1p and Whi2p for full
           activation of STRE-mediated gene expression, possibly
           through dephosphorylation of Msn2p
          Length = 397

 Score = 38.5 bits (88), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 26/45 (57%)

Query: 223 YVKLRPGLKEFFEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGEL 267
           YV  RPG+ EF   VS  +E+ ++T +   YA+ +   +DP G +
Sbjct: 265 YVIKRPGVDEFLNRVSQLYEVVVFTASVSRYANPLLDTLDPNGTI 309

>Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}
           complement(58800..59852) [1053 nt, 351 aa]
          Length = 350

 Score = 38.1 bits (87), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 27/51 (52%)

Query: 223 YVKLRPGLKEFFEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGELFGDRIL 273
           YV  RPG+  F +  S  FE+ I+T +   Y + +  I+D T +L   R+ 
Sbjct: 217 YVIKRPGVDAFLQYTSKLFEVVIFTASVEKYGNPLLDILDSTNDLVHHRLF 267

>Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 38.1 bits (87), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 26/45 (57%)

Query: 223 YVKLRPGLKEFFEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGEL 267
           YV  RPG+ EF   VS  +E+ ++T +   YA+ +   +DP G +
Sbjct: 260 YVIKRPGVDEFLHRVSQVYEVVVFTASVSRYANPLLDTLDPNGTI 304

>TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {ON}
           Anc_2.530 YHR004C
          Length = 393

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 49/106 (46%), Gaps = 10/106 (9%)

Query: 152 LREEKKLVLVVDLDQTVIHCGVDPTIGEWMRDPKNPNYKALQDVKSFTLEDEPIIPSFYF 211
           L+  K+  L++DLD+T+IH     ++   +      NY  L +VK  T    P       
Sbjct: 187 LKTNKRKKLILDLDETLIH-----SMSRNISSSTISNYH-LIEVKFPTPTSAPTSAP--- 237

Query: 212 GPKPPARKSWYYVKLRPGLKEFFEAVSPHFEMHIYTMATRSYAHEI 257
           GP  P   S YYV  RP    F   VS  +++ I+T + + YA  +
Sbjct: 238 GPSLPL-SSLYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPV 282

>Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 25/45 (55%)

Query: 223 YVKLRPGLKEFFEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGEL 267
           YV  RPG+ EF   V   +E+ ++T +   YA+ +   +DP G +
Sbjct: 260 YVIKRPGVDEFLSRVCQLYEVVVFTASVSRYANPLLDTLDPNGTI 304

>TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {ON}
           Anc_5.202 YLL010C
          Length = 452

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 24/41 (58%)

Query: 223 YVKLRPGLKEFFEAVSPHFEMHIYTMATRSYAHEIAKIIDP 263
           YV  RPG+ EF + V   +E+ ++T +   Y + +  I+DP
Sbjct: 320 YVSKRPGVDEFLKIVGDLYEVIVFTASVSRYGNPLMDILDP 360

>Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON}
           YHR004C (REAL)
          Length = 446

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 44/103 (42%), Gaps = 22/103 (21%)

Query: 152 LREEKKLVLVVDLDQTVIHCGVDPTIGEWMRDPKNPNYKALQDVKSFTLEDEPIIPSFYF 211
           L  +KK  LV+DLD+T+IH     T         N +   L +VK              F
Sbjct: 246 LNTQKKKKLVIDLDETLIHSASRSTTHS------NSSQGHLVEVK--------------F 285

Query: 212 GPKPPARKSWYYVKLRPGLKEFFEAVSPHFEMHIYTMATRSYA 254
           G      ++ Y++  RP    F   VS  +E+ I+T + + YA
Sbjct: 286 G--ISGIRTLYFIHKRPYCDLFLTKVSKWYELIIFTASMKEYA 326

>Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W
           (REAL)
          Length = 385

 Score = 35.4 bits (80), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 24/41 (58%)

Query: 223 YVKLRPGLKEFFEAVSPHFEMHIYTMATRSYAHEIAKIIDP 263
           YV  RPG+ EF   VS  +E+ ++T +   YA+ +   +DP
Sbjct: 253 YVIKRPGVDEFLHRVSQLYEVVVFTASVSRYANPLLDTLDP 293

>TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.202
           YLL010C
          Length = 688

 Score = 35.4 bits (80), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 23/40 (57%)

Query: 223 YVKLRPGLKEFFEAVSPHFEMHIYTMATRSYAHEIAKIID 262
           YV  RPG+ +F E VS  FE+ ++T +   Y   +  ++D
Sbjct: 556 YVIKRPGVDQFLETVSKIFEVVVFTASVSRYGDPLLDVLD 595

>TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa]
           {ON} Anc_5.202 YLL010C
          Length = 484

 Score = 35.0 bits (79), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 27/121 (22%), Positives = 50/121 (41%), Gaps = 27/121 (22%)

Query: 153 REEKKLVLVVDLDQTVIHCGVDPTIGEWMRDPKNPNYKALQDVKSFTLEDEPIIPSFYFG 212
           +++ K  L++DLD+T++H           +   NP++     +    +ED  I       
Sbjct: 308 KDKHKKCLILDLDETLVHSS--------FKFINNPDF-----ILPIEIEDGQI------- 347

Query: 213 PKPPARKSWYYVKLRPGLKEFFEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGELFGDRI 272
                     YV  RPG+  F   V   +E+ I+T +   YA+ +  ++D    L   R+
Sbjct: 348 -------HNVYVIKRPGVDRFLREVKKWYEIVIFTASLSRYANPLLDLLDKDHNLINHRL 400

Query: 273 L 273
            
Sbjct: 401 F 401

>YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON}
           PSR1Plasma membrane associated protein phosphatase
           involved in the general stress response; required along
           with binding partner Whi2p for full activation of
           STRE-mediated gene expression, possibly through
           dephosphorylation of Msn2p
          Length = 427

 Score = 35.0 bits (79), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 23/40 (57%)

Query: 223 YVKLRPGLKEFFEAVSPHFEMHIYTMATRSYAHEIAKIID 262
           YV  RPG++EF E V   FE+ ++T +   Y   +  I+D
Sbjct: 295 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD 334

>Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 34.7 bits (78), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 23/40 (57%)

Query: 223 YVKLRPGLKEFFEAVSPHFEMHIYTMATRSYAHEIAKIID 262
           YV  RPG++EF E V   FE+ ++T +   Y   +  I+D
Sbjct: 283 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD 322

>Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 34.7 bits (78), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 23/40 (57%)

Query: 223 YVKLRPGLKEFFEAVSPHFEMHIYTMATRSYAHEIAKIID 262
           YV  RPG++EF E V   FE+ ++T +   Y   +  I+D
Sbjct: 283 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD 322

>ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 482

 Score = 34.7 bits (78), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 22/40 (55%)

Query: 223 YVKLRPGLKEFFEAVSPHFEMHIYTMATRSYAHEIAKIID 262
           YV  RPG+ EF + V   FE+ I+T +   Y   +  I+D
Sbjct: 350 YVMKRPGVDEFLKKVGSLFEVVIFTASVARYGDPLLDILD 389

>Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {ON}
           YLL010C (REAL)
          Length = 414

 Score = 34.7 bits (78), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 23/40 (57%)

Query: 223 YVKLRPGLKEFFEAVSPHFEMHIYTMATRSYAHEIAKIID 262
           YV  RPG++EF E V   FE+ ++T +   Y   +  I+D
Sbjct: 282 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD 321

>Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON}
           YHR004C (REAL)
          Length = 447

 Score = 34.7 bits (78), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 45/103 (43%), Gaps = 22/103 (21%)

Query: 152 LREEKKLVLVVDLDQTVIHCGVDPTIGEWMRDPKNPNYKALQDVKSFTLEDEPIIPSFYF 211
           L  +KK  LV+DLD+T+IH     T         N +   L +VK F +     IP+ YF
Sbjct: 246 LNTQKKKKLVIDLDETLIHSASRSTTHS------NSSQGHLVEVK-FGISG---IPTLYF 295

Query: 212 GPKPPARKSWYYVKLRPGLKEFFEAVSPHFEMHIYTMATRSYA 254
                       +  RP    F   VS  +++ I+T + + YA
Sbjct: 296 ------------IHKRPYCDFFLTKVSRWYDLIIFTASMKEYA 326

>YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}
           NEM1Probable catalytic subunit of Nem1p-Spo7p
           phosphatase holoenzyme; regulates nuclear growth by
           controlling phospholipid biosynthesis, required for
           normal nuclear envelope morphology and sporulation;
           homolog of the human protein Dullard
          Length = 446

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 44/103 (42%), Gaps = 22/103 (21%)

Query: 152 LREEKKLVLVVDLDQTVIHCGVDPTIGEWMRDPKNPNYKALQDVKSFTLEDEPIIPSFYF 211
           L  +KK  LV+DLD+T+IH     T         N +   L +VK              F
Sbjct: 246 LNTQKKKKLVIDLDETLIHSASRSTTHS------NSSQGHLVEVK--------------F 285

Query: 212 GPKPPARKSWYYVKLRPGLKEFFEAVSPHFEMHIYTMATRSYA 254
           G      ++ Y++  RP    F   VS  +++ I+T + + YA
Sbjct: 286 GLS--GIRTLYFIHKRPYCDLFLTKVSKWYDLIIFTASMKEYA 326

>NDAI0F04240 Chr6 complement(1034128..1038036) [3909 bp, 1302 aa]
           {ON} Anc_1.79 YNL273W
          Length = 1302

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 63/132 (47%), Gaps = 10/132 (7%)

Query: 356 LISDIIDNEK-KLKEKIDEEVKRQEEIISH---IGDDNTRKEGGPPNKEDISKKLEHSAS 411
           L+S +ID++K +L EK+ E +KR  +I S    +  +N  +   PPN+    +++     
Sbjct: 815 LVSSLIDDDKTELLEKLIEHIKRAIDIFSSWLTVNINNGNETANPPNETFKLQEVSARNP 874

Query: 412 LEVQQQNRPLAELQKHL----HNQTLLIDDDDELPHLSQILLRVHKEYFNQYTEAPKNPP 467
           L   +  R L +L  +     H +  ++    E+  L + L  V K+Y N   E P   P
Sbjct: 875 LLSDKDFRALLQLIGYQIPMNHLEQCILPGTVEITALKESLELV-KKYMNSPFETPNGLP 933

Query: 468 DIKYLL-PQMKY 478
              YLL P+ K+
Sbjct: 934 SSSYLLRPRSKF 945

>KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON}
           Anc_2.530 YHR004C
          Length = 443

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 46/103 (44%), Gaps = 22/103 (21%)

Query: 152 LREEKKLVLVVDLDQTVIHCGVDPTIGEWMRDPKNPNYKALQDVKSFTLEDEPIIPSFYF 211
           L  EKK  LV+DLD+T+IH     ++      P N +   + +VK F++           
Sbjct: 244 LNREKKKTLVMDLDETLIH-----SVSRGTTHP-NSSQGHIVEVK-FSIS---------- 286

Query: 212 GPKPPARKSWYYVKLRPGLKEFFEAVSPHFEMHIYTMATRSYA 254
                   + YYV  RP    F   VS  +++ I+T + + YA
Sbjct: 287 -----GVSTLYYVFKRPYCDLFLTKVSKWYDIVIFTASMKEYA 324

>KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]
           {ON} similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 480

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 43/87 (49%), Gaps = 10/87 (11%)

Query: 220 SWYYVKLRPGLKEFFEAVSPHFEMHIYTMATRSYAHEIAKIIDP-----TGELFGDRILS 274
            W   K RPG+  F   +S ++E+ +++     YA +IA+ +DP     T  LF +  L 
Sbjct: 215 GWRTAK-RPGVDYFLGYLSQYYEIVLFSSNYMMYAEKIAEKLDPIHAFITYNLFKEHCLY 273

Query: 275 RDENGSLTTKSLERLFPMDQSMVVVID 301
           +D    +  K L +L   D   V++ID
Sbjct: 274 KD---GVHIKDLSKL-NRDLGKVLIID 296

>Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]
           {ON} complement(238947..240380) [1434 nt, 478 aa]
          Length = 477

 Score = 33.1 bits (74), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 24/45 (53%)

Query: 223 YVKLRPGLKEFFEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGEL 267
           YV  RPG+ EF + V   FE+ ++T +   Y   +  I+D +  +
Sbjct: 345 YVIKRPGVDEFLKRVGKIFEVVVFTASVSRYGDPLLDILDSSKSI 389

>Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {ON}
           YLR019W (PSR2) - Plasma membrane Sodium Response 2
           [contig 94] FULL
          Length = 410

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 4/60 (6%)

Query: 223 YVKLRPGLKEFFEAVSPHFEMHIYTMATRSYAHEIAKIIDPTG----ELFGDRILSRDEN 278
           YV  RPG+ EF + V   +E+ ++T +   Y   +  ++D T      LF D   + D N
Sbjct: 278 YVIKRPGVDEFLKLVGQLYEVVVFTASVSRYGDPLLDVLDQTQCIHHRLFRDSCYNYDGN 337

>AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLL010C (PSR1) and YLR019W
           (PSR2)
          Length = 478

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 22/40 (55%)

Query: 223 YVKLRPGLKEFFEAVSPHFEMHIYTMATRSYAHEIAKIID 262
           YV  RPG+ EF + V   FE+ ++T +   Y   +  I+D
Sbjct: 346 YVIKRPGVDEFLKRVGELFEVVVFTASVSRYGDPLLDILD 385

>Suva_8.58 Chr8 complement(108197..109555) [1359 bp, 452 aa] {ON}
           YHR004C (REAL)
          Length = 452

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 77/186 (41%), Gaps = 28/186 (15%)

Query: 152 LREEKKLVLVVDLDQTVIHCGVDPTIGEWMRDPKNPNYKALQDVKSFTLEDEPIIPSFYF 211
           L  +KK  LV+DLD+T+IH     T         N +   L +VK F +     I + YF
Sbjct: 251 LNTQKKKKLVIDLDETLIHSASRGTTHS------NSSQGHLVEVK-FGISG---ISTLYF 300

Query: 212 GPKPP-------ARKSWY-YVKLRPGLKEFFEAVSPHFEMHIYTMATRSYAHEIAKIIDP 263
             K P           WY  +     +KE+ + V    E       ++ Y      + D 
Sbjct: 301 IHKRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDG 360

Query: 264 TGELFGDRIL-SRDENGSLTT-KSLERLFPMDQSMV---VVIDDRGDVWNWFE-----NL 313
            G +    IL S +ENG  ++  SL+ +  +D S V   + +D+   V  W       +L
Sbjct: 361 VGYIKDLSILKSSEENGKGSSLSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDL 420

Query: 314 IKVVPY 319
           + ++P+
Sbjct: 421 LNLLPF 426

>Smik_15.373 Chr15 (641700..645131) [3432 bp, 1143 aa] {ON} YOR188W
            (REAL)
          Length = 1143

 Score = 32.7 bits (73), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 32/82 (39%)

Query: 187  PNYKALQDVKSFTLEDEPIIPSFYFGPKPPARKSWYYVKLRPGLKEFFEAVSPHFEMHIY 246
            PN    Q V  +  + +P IP+ Y+   PP R S     + P  +  +     +     +
Sbjct: 1028 PNQYQHQHVDKYIPQAQPAIPAEYYNGPPPMRVSPMVTHIMPSQEPVYYTAGANRRSFPH 1087

Query: 247  TMATRSYAHEIAKIIDPTGELF 268
             M   SYA  +  +  P  E +
Sbjct: 1088 GMQQNSYAVPVQPMRAPNSEFY 1109

>NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202
          Length = 391

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 24/45 (53%)

Query: 223 YVKLRPGLKEFFEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGEL 267
           YV  RPG+ EF   V+  +E+ ++T +   Y   +  I+D +  +
Sbjct: 259 YVIKRPGVDEFLRRVAQLYEVVVFTASVSRYGDPLLDILDSSNSI 303

>KAFR0A06650 Chr1 (1349869..1351197) [1329 bp, 442 aa] {ON}
           Anc_8.592 YBR168W
          Length = 442

 Score = 32.3 bits (72), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query: 363 NEKKLKEKIDEEVKRQEEI-ISHIGDDNTRKEGGPPNKEDISKKLEHSAS 411
           N+    E   +  +R+  I  + + +D+T KEG P N EDIS  L   AS
Sbjct: 369 NKPSAHESFSKYTRRRRWIRTAELVNDDTHKEGAPSNTEDISAVLSEEAS 418

>Kpol_1036.97 s1036 complement(248945..254815) [5871 bp, 1956 aa] {ON}
            complement(248945..254815) [5871 nt, 1957 aa]
          Length = 1956

 Score = 32.3 bits (72), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 43/94 (45%), Gaps = 6/94 (6%)

Query: 341  LHLGRHHRRKQEEEKLISDIIDNEKKLKEKIDEEVKR--QEEIISHIGDD----NTRKEG 394
            LH GR     +   K  + I ++ +   E IDE VKR  QEE    +G+D    N   +G
Sbjct: 1666 LHQGRKSSVPKVNNKKETSIKEDNESANESIDETVKRANQEESSEDVGNDVDTSNQENQG 1725

Query: 395  GPPNKEDISKKLEHSASLEVQQQNRPLAELQKHL 428
                   IS   E +ASL+    ++   EL++ L
Sbjct: 1726 NEDQDRIISASHEDNASLKKSATHKSSEELRQRL 1759

>Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 32.0 bits (71), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 41/80 (51%), Gaps = 9/80 (11%)

Query: 227 RPGLKEFFEAVSPHFEMHIYTMATRSYAHEIAKIIDP-----TGELFGDRILSRDENGSL 281
           RPG   F   +S +FE+ +++     Y+ +IA+ +DP     +  LF +  + +D    +
Sbjct: 223 RPGADYFLGYLSQYFEIVLFSSNYMMYSEKIAEKLDPIHAFVSYNLFKEHCVYKD---GV 279

Query: 282 TTKSLERLFPMDQSMVVVID 301
             K L +L   D S V++ID
Sbjct: 280 HIKDLSKL-NRDLSKVIIID 298

>ZYRO0F10824g Chr6 complement(883483..884865) [1383 bp, 460 aa] {ON}
           similar to uniprot|P38934 Saccharomyces cerevisiae
           YOR198C BFR1 Component of mRNP complexes associated with
           polyribosomes implicated in secretion and nuclear
           segregation multicopy suppressor of BFA (Brefeldin A)
           sensitivity
          Length = 460

 Score = 31.6 bits (70), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 63/116 (54%), Gaps = 14/116 (12%)

Query: 349 RKQEEEKLISDIIDNE-KKLKEKIDEEVKRQEEIISHIG---------DDNTRKEGGPPN 398
           RKQ ++  ISD+  NE KKL+E+  E +K Q ++ S            D N +++ G  N
Sbjct: 36  RKQIDQNQISDVTQNERKKLQEQTREIIKTQADLKSRRNAIHERVKQLDANIKRKTGEIN 95

Query: 399 KEDISKKLEHSASLEVQQQNRPLAELQKHLHNQTLLIDDDDELPHLSQILLRVHKE 454
            E + +K ++S + EV+Q+   + E+++ + +  L + D+  L    Q L +++K+
Sbjct: 96  -EKLGRKAKYSTTAEVKQR---INEIEEAISSGDLTLVDEKRLVKEMQALNKLNKD 147

>Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063W
           (REAL)
          Length = 477

 Score = 31.6 bits (70), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 41/80 (51%), Gaps = 9/80 (11%)

Query: 227 RPGLKEFFEAVSPHFEMHIYTMATRSYAHEIAKIIDP-----TGELFGDRILSRDENGSL 281
           RPG   F   +S +FE+ +++     Y+ +IA+ +DP     +  LF +  + +D    +
Sbjct: 218 RPGADYFLGYLSQYFEIVLFSSNYMMYSDKIAEKLDPIHAFVSYNLFKEHCVYKD---GV 274

Query: 282 TTKSLERLFPMDQSMVVVID 301
             K L +L   D S V++ID
Sbjct: 275 HIKDLSKL-NRDLSKVIIID 293

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 76,439,837
Number of extensions: 3515548
Number of successful extensions: 17260
Number of sequences better than 10.0: 228
Number of HSP's gapped: 17820
Number of HSP's successfully gapped: 251
Length of query: 719
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 602
Effective length of database: 40,065,477
Effective search space: 24119417154
Effective search space used: 24119417154
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)