Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D01573g8.840ON60760732790.0
KLTH0C03872g8.840ON62162419200.0
SAKL0D01474g8.840ON62462519040.0
Kwal_27.102588.840ON62062018760.0
TPHA0I002508.840ON62962518560.0
YMR278W (PGM3)8.840ON62263018370.0
NDAI0K004108.840ON62662518330.0
Suva_13.4668.840ON62263118200.0
TDEL0B005708.840ON63062718190.0
NCAS0C004108.840ON62562417960.0
KNAG0J002708.840ON62562817800.0
Smik_13.4918.840ON62262517610.0
Skud_13.4508.840ON62263217600.0
ZYRO0G14190g8.840ON61061717530.0
Ecym_46118.840ON63062617450.0
Kpol_1068.88.840ON63262917360.0
CAGL0M02981g8.840ON61762717320.0
KAFR0B039208.840ON62461917060.0
TBLA0B032508.840ON64363716950.0
ABL126W8.840ON62462816850.0
NCAS0F002006.11ON54931940.009
TBLA0G009806.11ON55830940.009
Kpol_1032.26.11ON53935940.011
CAGL0B03597g6.11ON54036930.011
TDEL0G046006.11ON52831920.015
Smik_5.296.11ON55562910.020
ACR015W6.11ON55239910.022
KAFR0L003406.11ON54031900.031
KNAG0E009406.11ON53822890.039
YEL058W (PCM1)6.11ON55731880.044
Skud_5.316.11ON55731880.047
Suva_5.106.11ON55331880.050
SAKL0E00902g6.11ON54466880.054
NDAI0K028906.11ON56130880.054
ZYRO0F00506g6.11ON55027860.084
KLLA0D00858g6.11ON54148860.084
Kwal_56.223556.11ON54122860.095
KLTH0C11506g6.11ON54422850.10
AGR322W5.154ON500139840.15
TPHA0M002106.11ON54530810.29
Kpol_1033.542.445ON570134810.35
Ecym_30146.11ON55122780.79
KNAG0E023902.445ON569493780.80
SAKL0E03630g2.445ON571304780.81
TPHA0O004501.484ON38586751.7
NCAS0A043502.445ON569188732.7
TPHA0G029002.445ON569129733.2
KNAG0K003405.43ON26593713.8
NCAS0F014702.445ON569419714.8
CAGL0F08415g5.43ON26658696.8
KLLA0C03300g1.131ON82651707.3
KAFR0D030102.445ON569294707.8
KNAG0A062802.445ON570132698.0
Suva_7.3354.193ON28172698.1
TPHA0G024702.445ON569130698.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D01573g
         (607 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {...  1267   0.0  
KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {...   744   0.0  
SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {...   738   0.0  
Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {...   727   0.0  
TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840...   719   0.0  
YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}  PGM3Phosp...   712   0.0  
NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON...   710   0.0  
Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278...   705   0.0  
TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {O...   705   0.0  
NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}...   696   0.0  
KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON...   690   0.0  
Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278...   682   0.0  
Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278...   682   0.0  
ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} simi...   679   0.0  
Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar...   676   0.0  
Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON...   673   0.0  
CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} simil...   671   0.0  
KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.8...   661   0.0  
TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.8...   657   0.0  
ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic ho...   653   0.0  
NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}...    41   0.009
TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {O...    41   0.009
Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON} ...    41   0.011
CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {...    40   0.011
TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.1...    40   0.015
Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)    40   0.020
ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic ho...    40   0.022
KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON...    39   0.031
KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.1...    39   0.039
YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essentia...    39   0.044
Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)    39   0.047
Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)    39   0.050
SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON...    39   0.054
NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6....    39   0.054
ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON...    38   0.084
KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON...    38   0.084
Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON...    38   0.095
KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} simila...    37   0.10 
AGR322W Chr7 (1333129..1334631) [1503 bp, 500 aa] {ON} Syntenic ...    37   0.15 
TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON...    36   0.29 
Kpol_1033.54 s1033 (136243..137955) [1713 bp, 570 aa] {ON} (1362...    36   0.35 
Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON} s...    35   0.79 
KNAG0E02390 Chr5 (475467..477176) [1710 bp, 569 aa] {ON} Anc_2.4...    35   0.80 
SAKL0E03630g Chr5 complement(294321..296036) [1716 bp, 571 aa] {...    35   0.81 
TPHA0O00450 Chr15 complement(80090..81247) [1158 bp, 385 aa] {ON...    33   1.7  
NCAS0A04350 Chr1 (878688..880397) [1710 bp, 569 aa] {ON} Anc_2.4...    33   2.7  
TPHA0G02900 Chr7 (622303..624012) [1710 bp, 569 aa] {ON}               33   3.2  
KNAG0K00340 Chr11 (55186..55983) [798 bp, 265 aa] {ON} Anc_5.43 ...    32   3.8  
NCAS0F01470 Chr6 complement(293218..294927) [1710 bp, 569 aa] {O...    32   4.8  
CAGL0F08415g Chr6 complement(840334..841134) [801 bp, 266 aa] {O...    31   6.8  
KLLA0C03300g Chr3 complement(296848..299328) [2481 bp, 826 aa] {...    32   7.3  
KAFR0D03010 Chr4 (594118..595827) [1710 bp, 569 aa] {ON} Anc_2.4...    32   7.8  
KNAG0A06280 Chr1 (955994..957706) [1713 bp, 570 aa] {ON}               31   8.0  
Suva_7.335 Chr7 complement(570219..571064) [846 bp, 281 aa] {ON}...    31   8.1  
TPHA0G02470 Chr7 (507445..509154) [1710 bp, 569 aa] {ON} Anc_2.4...    31   8.6  

>KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 607

 Score = 1267 bits (3279), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 607/607 (100%), Positives = 607/607 (100%)

Query: 1   MSETEVIESLPSDLQGKVRNWLKYDKVEETRNEILQLCLKGDITELHKRLDTMIAFGTAG 60
           MSETEVIESLPSDLQGKVRNWLKYDKVEETRNEILQLCLKGDITELHKRLDTMIAFGTAG
Sbjct: 1   MSETEVIESLPSDLQGKVRNWLKYDKVEETRNEILQLCLKGDITELHKRLDTMIAFGTAG 60

Query: 61  LRGRMEAGFNRMNALTVKQASQGLAKYIKKQFPENLTVVVGHDHRHNSRLFGKVTVDTFL 120
           LRGRMEAGFNRMNALTVKQASQGLAKYIKKQFPENLTVVVGHDHRHNSRLFGKVTVDTFL
Sbjct: 61  LRGRMEAGFNRMNALTVKQASQGLAKYIKKQFPENLTVVVGHDHRHNSRLFGKVTVDTFL 120

Query: 121 QLGFKVFHLNHENEKSLVHTPLVPFTVNATGASVGIMITASHNPKMDNGYKVYYTNGCQI 180
           QLGFKVFHLNHENEKSLVHTPLVPFTVNATGASVGIMITASHNPKMDNGYKVYYTNGCQI
Sbjct: 121 QLGFKVFHLNHENEKSLVHTPLVPFTVNATGASVGIMITASHNPKMDNGYKVYYTNGCQI 180

Query: 181 IPPHDKLIAESIIHNLEPFSSPQTGTIIDCKEKMTKKYIDAIGSTLIDGAVNKKTNEPWF 240
           IPPHDKLIAESIIHNLEPFSSPQTGTIIDCKEKMTKKYIDAIGSTLIDGAVNKKTNEPWF
Sbjct: 181 IPPHDKLIAESIIHNLEPFSSPQTGTIIDCKEKMTKKYIDAIGSTLIDGAVNKKTNEPWF 240

Query: 241 VYTPMHGVGFEIFESISKQLLSLEEGKDYLVVEEQKYPDADFPTVSFPNPEEKGALDLAV 300
           VYTPMHGVGFEIFESISKQLLSLEEGKDYLVVEEQKYPDADFPTVSFPNPEEKGALDLAV
Sbjct: 241 VYTPMHGVGFEIFESISKQLLSLEEGKDYLVVEEQKYPDADFPTVSFPNPEEKGALDLAV 300

Query: 301 EYGRKNDTVDLIIANDPDADRFSVAVRDNDQNTTTAWRQLTGNEIGFLFAYYEWERYKHS 360
           EYGRKNDTVDLIIANDPDADRFSVAVRDNDQNTTTAWRQLTGNEIGFLFAYYEWERYKHS
Sbjct: 301 EYGRKNDTVDLIIANDPDADRFSVAVRDNDQNTTTAWRQLTGNEIGFLFAYYEWERYKHS 360

Query: 361 PIDEPLAMLNSTVSSQMIKRMAEIEGFHYEDTLTGFKWLGNRALELEQEGYYTPFAYEEA 420
           PIDEPLAMLNSTVSSQMIKRMAEIEGFHYEDTLTGFKWLGNRALELEQEGYYTPFAYEEA
Sbjct: 361 PIDEPLAMLNSTVSSQMIKRMAEIEGFHYEDTLTGFKWLGNRALELEQEGYYTPFAYEEA 420

Query: 421 IGYMFSSVVHDKDGISAAIVFLQAYSKWRASGQTVLDILATASLKYGHFKEFNGYYIVPD 480
           IGYMFSSVVHDKDGISAAIVFLQAYSKWRASGQTVLDILATASLKYGHFKEFNGYYIVPD
Sbjct: 421 IGYMFSSVVHDKDGISAAIVFLQAYSKWRASGQTVLDILATASLKYGHFKEFNGYYIVPD 480

Query: 481 LAITKQVFDAIRSIESPYPKKLGSSFEIIKFRDLTNGYQSDTPDHIPELASDPSSQMITC 540
           LAITKQVFDAIRSIESPYPKKLGSSFEIIKFRDLTNGYQSDTPDHIPELASDPSSQMITC
Sbjct: 481 LAITKQVFDAIRSIESPYPKKLGSSFEIIKFRDLTNGYQSDTPDHIPELASDPSSQMITC 540

Query: 541 EMLLVEQPTSRVRFTIRGSGTEPKLKVYIEARTNTEPNSIALAKFTWDVLRQEWFKPELT 600
           EMLLVEQPTSRVRFTIRGSGTEPKLKVYIEARTNTEPNSIALAKFTWDVLRQEWFKPELT
Sbjct: 541 EMLLVEQPTSRVRFTIRGSGTEPKLKVYIEARTNTEPNSIALAKFTWDVLRQEWFKPELT 600

Query: 601 GLLTPFQ 607
           GLLTPFQ
Sbjct: 601 GLLTPFQ 607

>KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 621

 Score =  744 bits (1920), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/624 (60%), Positives = 446/624 (71%), Gaps = 38/624 (6%)

Query: 10  LPSDLQGKVRNWLKYDKVEETRNEILQLCLKGDITELHKRLDTMIAFGTAGLRGRMEAGF 69
           +P DL+  V  WLKYDK E+TR++I++L      TEL  RL+  I FGTAGLR RMEAGF
Sbjct: 9   VPEDLKLGVEAWLKYDKNEQTRDQIIKLVEDKSWTELRNRLNFRITFGTAGLRSRMEAGF 68

Query: 70  NRMNALTVKQASQGLAKYIKKQFPENLTVVVGHDHRHNSRLFGKVTVDTFLQLGFKVFHL 129
           NRMN LTV QASQGLAKYI   FP+NL+VVVGHDHR NS+ F +VT+  FLQLGFKV+ L
Sbjct: 69  NRMNTLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVTIVAFLQLGFKVYDL 128

Query: 130 NHENEKS---LVHTPLVPFTVNATGASVGIMITASHNPKMDNGYKVYYTNGCQIIPPHDK 186
               + S   +VHTP+VPF ++   AS GIMITASHNPKMDNGYKVYY+NGCQIIPPHD+
Sbjct: 129 GFTEDASQDVVVHTPMVPFGIDHLRASGGIMITASHNPKMDNGYKVYYSNGCQIIPPHDQ 188

Query: 187 LIAESIIHNLEPFS-----------SPQTGTIIDCKEKMTKKYIDAIGSTLIDGAVNKKT 235
            I++SI+ NLEP+            + Q+  +ID K+ +  +Y+D +  +L+   VN  T
Sbjct: 189 RISQSILANLEPWDRAWDCAAVKAEAVQSEMLIDAKKVLVDQYVDTVRRSLVITNVNH-T 247

Query: 236 NEPWFVYTPMHGVGFEIFESISKQLLSLEEGKDYLVVEEQKYPDADFPTVSFPNPEEKGA 295
             PWFVYTP+HGVGFEIFE I      L +G+DYL VEEQKYPD +FPTVSFPNPEEKGA
Sbjct: 248 KAPWFVYTPLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTVSFPNPEEKGA 307

Query: 296 LDLAVEYGRKNDTVDLIIANDPDADRFSVAVRDNDQNTTTAWRQLTGNEIGFLFAYYEWE 355
           LD A+E   K+D +  ++ NDPDADRFSVA + N Q     WRQLTGNEIGFLFA Y+WE
Sbjct: 308 LDKAIELAEKHD-ITFVLGNDPDADRFSVAAKHNGQ-----WRQLTGNEIGFLFAQYKWE 361

Query: 356 RYKHSPID----EPLAMLNSTVSSQMIKRMAEIEGFHYEDTLTGFKWLGNRALELEQEGY 411
            Y+          PLAM+NSTVSSQMIK+MAE+EGFHYEDTLTGFKWLGNRA ELE  GY
Sbjct: 362 TYRLESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGNRARELENAGY 421

Query: 412 YTPFAYEEAIGYMFSSVVHDKDGISAAIVFLQAYSKWRASGQTVLDILATASLKYGHFKE 471
           + PFAYEEAIGYMFS VVHDKDGISAA+VFLQ    W+A   T  D+L  A  KYG FKE
Sbjct: 422 FVPFAYEEAIGYMFSDVVHDKDGISAAVVFLQMLWSWKAQALTPFDVLQRAYQKYGVFKE 481

Query: 472 FNGYYIVPDLAITKQVFDAIRSIESPYPKKLGSSFEIIKFRDLTNGYQSDTPDHIPELAS 531
           +NGYYIVPDL++T +VF  IRS  S  P  +G  F +  + DLT GYQS+TPD  P L  
Sbjct: 482 YNGYYIVPDLSLTDKVFSGIRSGFSLQPTHIGQEFRVESYTDLTTGYQSNTPDSEPRLPV 541

Query: 532 DPSSQMITCEMLLVEQPTS---------RVRFTIRGSGTEPKLKVYIEARTNTEPNSIAL 582
           DPSSQMIT  +     PTS          VRFT RGSGTEPKLKVYIEA +++E  + AL
Sbjct: 542 DPSSQMITATL----TPTSSTGRQGFSESVRFTARGSGTEPKLKVYIEAVSSSEELASAL 597

Query: 583 AKFTWDVLRQEWFKPELTGLLTPF 606
           AK  WDVLR+EWFKPE TGL T F
Sbjct: 598 AKKAWDVLRREWFKPEQTGLATNF 621

>SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 624

 Score =  738 bits (1904), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/625 (60%), Positives = 452/625 (72%), Gaps = 34/625 (5%)

Query: 9   SLPSDLQGKVRNWLKYDKVEETRNEILQLCLKGDITELHKRLDTMIAFGTAGLRGRMEAG 68
           ++P DL+  V  WL YDK  ETR+E+L L       ELH RLD  I+FGTAGLR RMEAG
Sbjct: 7   TVPDDLKESVNLWLTYDKNPETRSELLNLVEGKHWEELHGRLDERISFGTAGLRSRMEAG 66

Query: 69  FNRMNALTVKQASQGLAKYIKKQFPENLTVVVGHDHRHNSRLFGKVTVDTFLQLGFKVFH 128
           F+RMN LTV QASQGLA YIK QFPENL+V+VGHDHR++S  F +VTV  FLQLGFKV++
Sbjct: 67  FSRMNTLTVLQASQGLASYIKSQFPENLSVIVGHDHRYHSNEFARVTVTAFLQLGFKVYY 126

Query: 129 LN---HENEKSLVHTPLVPFTVNATGASVGIMITASHNPKMDNGYKVYYTNGCQIIPPHD 185
           LN    ++ ++ VHTP+VPFT+N   AS GIMITASHNPKMDNGYKVYY+NGCQIIPPHD
Sbjct: 127 LNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHNPKMDNGYKVYYSNGCQIIPPHD 186

Query: 186 KLIAESIIHNLEPF-----------SSPQTGTIIDCKEKMTKKYIDAIGSTLIDGAVNKK 234
           +LI+E+I  NL P+           ++ ++G + D KEK+T KYI  +   L+   +   
Sbjct: 187 RLISETIDQNLVPWNKAWDCDEVIKTAIESGFLFDVKEKVTSKYIKTVSDELVRVPM-LD 245

Query: 235 TNEPWFVYTPMHGVGFEIFESISKQLLSLEEGKDYLVVEEQKYPDADFPTVSFPNPEEKG 294
            ++PWFVYTPMHGVGFEIFE I+   L L+EGK Y+ V EQ+ PD  FPTVSFPNPEEKG
Sbjct: 246 CDKPWFVYTPMHGVGFEIFEQIALLALGLKEGKHYVCVPEQRCPDPAFPTVSFPNPEEKG 305

Query: 295 ALDLAVEYGRKNDTVDLIIANDPDADRFSVAVRDNDQNTTTAWRQLTGNEIGFLFAYYEW 354
           ALDL++    + D + L+IANDPDADRFSVAV++ D+     W QLTGNEIGFLFAYY+W
Sbjct: 306 ALDLSIALAEEQD-IRLVIANDPDADRFSVAVKNGDR-----WSQLTGNEIGFLFAYYQW 359

Query: 355 ERYKH----SPIDEPLAMLNSTVSSQMIKRMAEIEGFHYEDTLTGFKWLGNRALELEQEG 410
           + Y+          PLAM+NSTVSSQMIK +AE E FHYEDTLTGFKWLGNRA ELE +G
Sbjct: 360 QDYQKLGESFKKQHPLAMINSTVSSQMIKSLAEAEKFHYEDTLTGFKWLGNRAFELETQG 419

Query: 411 YYTPFAYEEAIGYMFSSVVHDKDGISAAIVFLQAYSKWRASGQ-TVLDILATASLKYGHF 469
           YY PFAYEEAIGYMF  V HDKDGISAA+VFLQ Y +W +  + T L +L     KYG F
Sbjct: 420 YYVPFAYEEAIGYMFPEVEHDKDGISAAVVFLQMYCEWLSKDRMTPLQVLDEGFGKYGVF 479

Query: 470 KEFNGYYIVPDLAITKQVFDAIRSIESP----YPKKLGSSFEIIKFRDLTNGYQSDTPDH 525
           KE+NGYYIVP L++TK+VFD IR   +P    YP  +GS F +I FRDLT GYQSDT D+
Sbjct: 480 KEYNGYYIVPRLSLTKEVFDYIREDYTPSGHAYPPAIGSEFSVISFRDLTTGYQSDTIDN 539

Query: 526 IPELASDPSSQMITCEMLLVEQPTS----RVRFTIRGSGTEPKLKVYIEARTNTEPNSIA 581
           +P L  D SSQMIT  +       S    +VRFTIRGSGTEPKLKVYIEA++  E  +  
Sbjct: 540 VPNLPVDASSQMITATLRPSNGKESTSGEQVRFTIRGSGTEPKLKVYIEAKSTDEKRAQH 599

Query: 582 LAKFTWDVLRQEWFKPELTGLLTPF 606
           LA+ TW VLR+EWF+PE TGL T F
Sbjct: 600 LARETWQVLRREWFRPERTGLETKF 624

>Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {ON}
           YMR278W - Hypothetical ORF [contig 37] FULL
          Length = 620

 Score =  727 bits (1876), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/620 (57%), Positives = 444/620 (71%), Gaps = 30/620 (4%)

Query: 10  LPSDLQGKVRNWLKYDKVEETRNEILQLCLKGDITELHKRLDTMIAFGTAGLRGRMEAGF 69
           +P+DL+  V +W ++DK EETRNEILQL  + +  ELHKRLD  I+FGTAGLR +MEAGF
Sbjct: 8   IPADLKSSVESWFEHDKNEETRNEILQLVTEQNWNELHKRLDQRISFGTAGLRSKMEAGF 67

Query: 70  NRMNALTVKQASQGLAKYIKKQFPENLTVVVGHDHRHNSRLFGKVTVDTFLQLGFKVFHL 129
           +RMN LTV QASQGLAKYI ++FPEN TV VGHDHR NSR F +VT   FLQL FKV+ L
Sbjct: 68  SRMNTLTVLQASQGLAKYIAEKFPENKTVAVGHDHRFNSRDFAEVTSVAFLQLRFKVYSL 127

Query: 130 --NHENEK-SLVHTPLVPFTVNATGASVGIMITASHNPKMDNGYKVYYTNGCQIIPPHDK 186
             N + +K + VHTP+VPF ++  GAS G+MITASHNPKMDNGYKVYY+NGCQIIPPHD+
Sbjct: 128 GFNADPKKDAFVHTPMVPFAIDRLGASAGVMITASHNPKMDNGYKVYYSNGCQIIPPHDR 187

Query: 187 LIAESIIHNLEPFS-----------SPQTGTIIDCKEKMTKKYIDAIGSTLIDGAVNKKT 235
           LIA+SI+ NL P+            + + G  +D K+ M   Y+  I   L+   +  ++
Sbjct: 188 LIAQSILDNLNPWERAWDCKAVIAEATEKGYFVDMKKPMVDHYVKEISDKLVSSDIGDRS 247

Query: 236 NEPWFVYTPMHGVGFEIFESISKQLLSLEEGKDYLVVEEQKYPDADFPTVSFPNPEEKGA 295
            +PWFVYTP+HGVGFEIFE I+ ++L L EG+DY  V E K PD  FPTVSFPNPEE GA
Sbjct: 248 -KPWFVYTPLHGVGFEIFERIASEVLGLVEGRDYWCVSEHKQPDPAFPTVSFPNPEEAGA 306

Query: 296 LDLAVEYGRKNDTVDLIIANDPDADRFSVAVRDNDQNTTTAWRQLTGNEIGFLFAYYEWE 355
           LDLA+    KN  +  ++ NDPDADRFS AV+   +     WRQLTGNEIGFLFA + WE
Sbjct: 307 LDLAIALADKNG-ISFVLGNDPDADRFSAAVKHQGK-----WRQLTGNEIGFLFAQFVWE 360

Query: 356 RYKHSP----IDEPLAMLNSTVSSQMIKRMAEIEGFHYEDTLTGFKWLGNRALELEQEGY 411
           +Y+       ++ PLA++NSTVSSQMIK++A +E FHYEDTLTGFKWLGNRA +LE  GY
Sbjct: 361 KYQKESSEFKLENPLALINSTVSSQMIKKLAGVEKFHYEDTLTGFKWLGNRARQLESSGY 420

Query: 412 YTPFAYEEAIGYMFSSVVHDKDGISAAIVFLQAYSKWRASGQTVLDILATASLKYGHFKE 471
           Y PFAYEEAIG+MFS +VHDKDG+SAA+VFLQ    W+    + +D+L +A  KYG FKE
Sbjct: 421 YVPFAYEEAIGFMFSDIVHDKDGVSAAVVFLQMLWSWKKQALSPIDVLQSAFGKYGVFKE 480

Query: 472 FNGYYIVPDLAITKQVFDAIRSIESPYPKKLGSSFEIIKFRDLTNGYQSDTPDHIPELAS 531
           +NGYY VPDL++T ++F  IRS    YPK +G+ F+++ F DLT G+QSDT D+ P L  
Sbjct: 481 YNGYYTVPDLSLTDRIFSDIRSSYDSYPKHIGNQFDVVSFTDLTKGFQSDTADNTPRLPV 540

Query: 532 DPSSQMITCEMLLVEQ-----PTSRVRFTIRGSGTEPKLKVYIEARTNTEPNSIALAKFT 586
           DPSSQMI   ++         P   VRFT RGSGTEPKLKVYIEA +  E  +  LA+ T
Sbjct: 541 DPSSQMIQATLVPSTSGGSGAPLEIVRFTARGSGTEPKLKVYIEATSVEETRASDLARTT 600

Query: 587 WDVLRQEWFKPELTGLLTPF 606
           W+VLR EWFKP+ TGL T F
Sbjct: 601 WNVLRDEWFKPKETGLSTKF 620

>TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840
           YMR278W
          Length = 629

 Score =  719 bits (1856), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/625 (57%), Positives = 450/625 (72%), Gaps = 30/625 (4%)

Query: 6   VIESLPSDLQGKVRNWLKYDKVEETRNEILQLCLKGDITELHKRLDTMIAFGTAGLRGRM 65
           ++ S+P DL+ K+R W +YD  +ET +E+ +LC+   + ELHKR D  I FGTAGLR RM
Sbjct: 11  LLSSIPEDLKEKIRVWFRYDDNQETVDEVKELCVNKSLDELHKRFDQRIVFGTAGLRSRM 70

Query: 66  EAGFNRMNALTVKQASQGLAKYIKKQFPENLTVVVGHDHRHNSRLFGKVTVDTFLQLGFK 125
           EAGFNRMNALTV Q++QGLA YIK QFP NLT VVGHDHR++S+ F ++T   FL  GFK
Sbjct: 71  EAGFNRMNALTVLQSTQGLASYIKSQFPSNLTAVVGHDHRYHSKEFAQITAAVFLNAGFK 130

Query: 126 VFHLNHENEKSLVHTPLVPFTVNATGASVGIMITASHNPKMDNGYKVYYTNGCQIIPPHD 185
           V++LN  +E   VHTP+VPF +N   AS+G+MITASHNP+MDNGYKVYY NGCQIIPPHD
Sbjct: 131 VYYLNPNDE--FVHTPMVPFGINLYSASIGVMITASHNPEMDNGYKVYYNNGCQIIPPHD 188

Query: 186 KLIAESIIHNLEPFS-----------SPQTGTIIDCKEKMTKKYIDAIGSTLIDGAVNKK 234
           K IAE I  NLEP S           + +   +I  KE + ++Y+  +   +I   ++  
Sbjct: 189 KNIAECIEKNLEPLSDNWNTEAVISKAIENVKLIYSKEDVLQQYMLNLDKYIIPKNISLG 248

Query: 235 TN----EPWFVYTPMHGVGFEIFESISKQLLSLEEGKDYLVVEEQKYPDADFPTVSFPNP 290
           T     +PWFVYTPMHGVG++IF  IS   L+L E  DY+ V+EQ  PD  FPTVSFPNP
Sbjct: 249 TTIKGKKPWFVYTPMHGVGYQIFHRISSTCLNLVEDIDYVCVKEQIVPDPSFPTVSFPNP 308

Query: 291 EEKGALDLAVEYGRKNDTVDLIIANDPDADRFSVAVRDNDQNTTTAWRQLTGNEIGFLFA 350
           EEKGALDL ++Y +K++ +DL++ANDPDADRFSVAVR+     T  ++QLTGNEIGFLFA
Sbjct: 309 EEKGALDLGIKYAKKHN-IDLVVANDPDADRFSVAVRN---PLTDEFQQLTGNEIGFLFA 364

Query: 351 YYEWERYKHSPID----EPLAMLNSTVSSQMIKRMAEIEGFHYEDTLTGFKWLGNRALEL 406
           Y+ WE+Y   P D     PLAM+NSTVSSQMIK+MAE+EGF+YEDTLTGFKW+GN+A EL
Sbjct: 365 YFLWEQYSMLPADFKDKFPLAMINSTVSSQMIKKMAEVEGFYYEDTLTGFKWIGNKAREL 424

Query: 407 EQEGYYTPFAYEEAIGYMFSSVVHDKDGISAAIVFLQAYSKWRASG-QTVLDILATASLK 465
           E+EGYY PF +EEAIGYMF  +  DKDGI+A +VFLQAY  W  +  Q++ DI+ T   K
Sbjct: 425 EKEGYYVPFGFEEAIGYMFPKMECDKDGITATVVFLQAYYGWCMNNKQSLFDIIETGFKK 484

Query: 466 YGHFKEFNGYYIVPDLAITKQVFDAIR---SIESPYPKKLGSSFEIIKFRDLTNGYQSDT 522
           YG FKE+NGYYIV DL++TK +FD IR   + +  Y   +G+ F++I FRDLT GYQSDT
Sbjct: 485 YGVFKEYNGYYIVNDLSLTKIIFDNIRENKNDKEKYVSHIGTEFKVITFRDLTLGYQSDT 544

Query: 523 PDHIPELASDPSSQMITCEMLLVEQP-TSRVRFTIRGSGTEPKLKVYIEARTNTEPNSIA 581
             ++P L  DPSSQMIT  ++    P    VRFTIRGSGTEPKLKVYIEA   TE  +  
Sbjct: 545 IGNVPTLPVDPSSQMITMTIIPTSLPENGSVRFTIRGSGTEPKLKVYIEANAKTEAEANR 604

Query: 582 LAKFTWDVLRQEWFKPELTGLLTPF 606
           LAK TWDVL++EWF  E TGL T F
Sbjct: 605 LAKLTWDVLKREWFSSEKTGLTTNF 629

>YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}
           PGM3Phosphoglucomutase, catalyzes interconversion of
           glucose-1-phosphate and glucose-6-phospate;
           transcription induced in response to stress; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; non-essential
          Length = 622

 Score =  712 bits (1837), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/630 (56%), Positives = 452/630 (71%), Gaps = 41/630 (6%)

Query: 6   VIESLPSDLQGKVRNWLKYDKVEETRNEILQLCLKGDITELHKRLDTMIAFGTAGLRGRM 65
           ++E++PSDL+  +  W K D+  +T  E+  LC K D  ELHKR D+ I FGTAGLR +M
Sbjct: 5   ILETVPSDLKDPISLWFKQDRNPKTIEEVTALCKKSDWNELHKRFDSRIQFGTAGLRSQM 64

Query: 66  EAGFNRMNALTVKQASQGLAKYIKKQFPENLTVVVGHDHRHNSRLFGKVTVDTFLQLGFK 125
           +AGF+RMN L V QASQGLA Y+++QFP+NL  VVGHDHR +S+ F + T   FL  GFK
Sbjct: 65  QAGFSRMNTLVVIQASQGLATYVRQQFPDNLVAVVGHDHRFHSKEFARATAAAFLLKGFK 124

Query: 126 VFHLNHENEKSLVHTPLVPFTVNATGASVGIMITASHNPKMDNGYKVYYTNGCQIIPPHD 185
           V +LN ++E   VHTPLVPF V+   ASVG+MITASHNPKMDNGYKVYY+NGCQIIPPHD
Sbjct: 125 VHYLNPDHE--FVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHD 182

Query: 186 KLIAESIIHNLEPFS-----------SPQTGTIIDCKEKMTKKYIDAIGSTLIDGAVNKK 234
             I++SI  NLEP++           + + G ++  +E+M K Y++ +   L++  +N  
Sbjct: 183 HAISDSIDANLEPWANVWDFDDVLNKALKQGKLMYSREEMLKLYLEEVSKNLVE--INPL 240

Query: 235 TNE----PWFVYTPMHGVGFEIFESISKQLLSLEEGKDYLVVEEQKYPDADFPTVSFPNP 290
             E    PWFVYTPMHGVGF+IF +I K+ L L EGKDYL V EQ+ PD  FPTV FPNP
Sbjct: 241 KLEVKAKPWFVYTPMHGVGFDIFSTIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVGFPNP 300

Query: 291 EEKGALDLAVEYGRKNDTVDLIIANDPDADRFSVAVRDNDQNTTTAWRQLTGNEIGFLFA 350
           EEKGALD+ +    K+D +DL++ANDPDADRFSVAV+D     +  WRQLTGNEIGFLFA
Sbjct: 301 EEKGALDIGINLAEKHD-IDLLVANDPDADRFSVAVKDMQ---SGEWRQLTGNEIGFLFA 356

Query: 351 YYEWERYKHSPID----EPLAMLNSTVSSQMIKRMAEIEGFHYEDTLTGFKWLGNRALEL 406
           +YE+++YK    +     PLAMLNSTVSSQMIK+MAEIEGFHYEDTLTGFKW+GNRA+ L
Sbjct: 357 FYEYQKYKSMDKEFQHVHPLAMLNSTVSSQMIKKMAEIEGFHYEDTLTGFKWIGNRAILL 416

Query: 407 EQEGYYTPFAYEEAIGYMFSSVVHDKDGISAAIVFLQAYSKWRASGQT-VLDILATASLK 465
           E++GYY PF +EEAIGYMF ++ HDKDGISA+IVFLQAY KW+       L++L     K
Sbjct: 417 EKKGYYVPFGFEEAIGYMFPAMEHDKDGISASIVFLQAYCKWKIDHNLDPLNVLENGFKK 476

Query: 466 YGHFKEFNGYYIVPDLAITKQVFDAIRSIESP----YPKKLGSSFEIIKFRDLTNGYQSD 521
           YG FKE+NGYY+VP+  +TK +FD IR++ +P    YP  +G   E++ +RDLT GYQSD
Sbjct: 477 YGVFKEYNGYYVVPNPTVTKDIFDYIRNVYTPEGASYPSSIGEEIEVLYYRDLTTGYQSD 536

Query: 522 TPDHIPELASDPSSQMITCEMLLVEQPTS-----RVRFTIRGSGTEPKLKVYIEARTNTE 576
           T +H P L  DP+SQMIT       +P++      +RFTIRGSGTEPKLKVYIEA  N E
Sbjct: 537 TINHKPTLPVDPTSQMITVSA----RPSNGSENEHIRFTIRGSGTEPKLKVYIEACANEE 592

Query: 577 PNSIALAKFTWDVLRQEWFKPELTGLLTPF 606
             +  LAK TW+VLR+EWF+P+   ++T F
Sbjct: 593 QRASFLAKLTWNVLRREWFRPDEMNIVTKF 622

>NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON}
           Anc_8.840 YMR278W
          Length = 626

 Score =  710 bits (1833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/625 (57%), Positives = 451/625 (72%), Gaps = 30/625 (4%)

Query: 6   VIESLPSDLQGKVRNWLKYDKVEETRNEILQLCLKGDITELHKRLDTMIAFGTAGLRGRM 65
           + +  P++L+  +  WL+ DK EETRNE++QLC   +  ELHKR D+ I FGTAGLR RM
Sbjct: 8   ICDDCPANLRENIDLWLRQDKCEETRNEVIQLCKDSNWIELHKRFDSRIVFGTAGLRSRM 67

Query: 66  EAGFNRMNALTVKQASQGLAKYIKKQFPENLTVVVGHDHRHNSRLFGKVTVDTFLQLGFK 125
           EAGF+RMN L + QASQGLAKYIK QFP NLT VVGHDHR +S+ F  +T   FL++GFK
Sbjct: 68  EAGFSRMNPLVILQASQGLAKYIKAQFPTNLTAVVGHDHRFHSKQFAMITASVFLRVGFK 127

Query: 126 VFHLNHENEKSLVHTPLVPFTVNATGASVGIMITASHNPKMDNGYKVYYTNGCQIIPPHD 185
           V++LN E+  S VHTPLVPF+VN   AS+G+MITASHNPKMDNGYKVYY+NGCQIIPPHD
Sbjct: 128 VYYLNPED--SFVHTPLVPFSVNHLNASIGVMITASHNPKMDNGYKVYYSNGCQIIPPHD 185

Query: 186 KLIAESIIHNLEPFSSP-----------QTGTIIDCKEKMTKKYIDAIGSTLIDGAVNKK 234
           K IA +I  NLEP+SS            +   ++  +E+MT KY+ A+   L+  ++++ 
Sbjct: 186 KNIAATIDENLEPWSSDWNWDSTFEKNLKEKKLVYVREEMTNKYLQAMKDILVSSSISRP 245

Query: 235 TN---EPWFVYTPMHGVGFEIFESISKQLLSLEEGKDYLVVEEQKYPDADFPTVSFPNPE 291
            N   +PWFVYTPMHGVG+ IF  ISK +L  EE  DY VV+EQ YPD  FPTVSFPNPE
Sbjct: 246 NNNGKKPWFVYTPMHGVGYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSFPNPE 305

Query: 292 EKGALDLAVEYGRKNDTVDLIIANDPDADRFSVAVRDNDQNTTTAWRQLTGNEIGFLFAY 351
           EKGAL LA +   +N+ + L+IANDPDADRFSVA ++     T  W+QL+GNEIGFLFA 
Sbjct: 306 EKGALSLATKLAEENN-ISLVIANDPDADRFSVASKN---EKTGQWQQLSGNEIGFLFAS 361

Query: 352 YEWERYKHSPID----EPLAMLNSTVSSQMIKRMAEIEGFHYEDTLTGFKWLGNRALELE 407
           +E E+Y    I+     PLAM+NSTVSSQMIK+MA++E FHYEDTLTGFKW+GNRAL+L+
Sbjct: 362 FELEKYMSQDIEWRRTHPLAMINSTVSSQMIKKMAQVESFHYEDTLTGFKWIGNRALDLQ 421

Query: 408 QEGYYTPFAYEEAIGYMFSSVVHDKDGISAAIVFLQAYSKW-RASGQTVLDILATASLKY 466
            +GYY PF +EEAIGYMF ++V DKDG+SAA+VFL AYS W    G    DIL     K+
Sbjct: 422 GQGYYVPFGFEEAIGYMFPTMVTDKDGVSAAVVFLLAYSYWLNNDGSYPFDILEKGFKKF 481

Query: 467 GHFKEFNGYYIVPDLAITKQVFDAIR----SIESPYPKKLGSSFEIIKFRDLTNGYQSDT 522
           G FKE+NGYYI  D   TKQ+FD +R    +  +PYPK +G  F+I  FRDLT GYQS+T
Sbjct: 482 GFFKEYNGYYIYDDPKTTKQIFDFVRYQYDTSGNPYPKNIGKEFKIEVFRDLTTGYQSNT 541

Query: 523 PDHIPELASDPSSQMITCEMLLVEQ-PTSRVRFTIRGSGTEPKLKVYIEARTNTEPNSIA 581
            D++P L  DP S+MIT E +  +    S+VRFT+RGSGTEPKLK+YIEA  + E  +I 
Sbjct: 542 IDNLPNLPVDPHSEMITIEAVPKQDIGKSKVRFTMRGSGTEPKLKLYIEAVADNEKCAID 601

Query: 582 LAKFTWDVLRQEWFKPELTGLLTPF 606
           LA   W+VL++EW +P++TGL T F
Sbjct: 602 LAYEMWNVLKKEWIRPDVTGLTTTF 626

>Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  705 bits (1820), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/631 (56%), Positives = 450/631 (71%), Gaps = 41/631 (6%)

Query: 5   EVIESLPSDLQGKVRNWLKYDKVEETRNEILQLCLKGDITELHKRLDTMIAFGTAGLRGR 64
           +++E++PSDL+G +  W   D+  ET  E+  LC   D  ELHKR DT I FGTAGLR  
Sbjct: 4   QLLETVPSDLKGPISLWFDQDRNPETIEEVTTLCKNSDWDELHKRFDTRIQFGTAGLRSE 63

Query: 65  MEAGFNRMNALTVKQASQGLAKYIKKQFPENLTVVVGHDHRHNSRLFGKVTVDTFLQLGF 124
           M+AGF+RMN L + QA+QGLA YIK+QFP+NL VVVGHDHR +S+ F + T   FL  GF
Sbjct: 64  MQAGFSRMNTLVIIQATQGLATYIKQQFPDNLVVVVGHDHRFHSKEFARATATAFLLKGF 123

Query: 125 KVFHLNHENEKSLVHTPLVPFTVNATGASVGIMITASHNPKMDNGYKVYYTNGCQIIPPH 184
           KV +LN ++E   VHTPLVPF V+   ASVG+MITASHNPKMDNGYKVYY+NGCQIIPPH
Sbjct: 124 KVHYLNPDHE--FVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPH 181

Query: 185 DKLIAESIIHNLEPFS-----------SPQTGTIIDCKEKMTKKYIDAIGSTLIDGAVNK 233
           D  I++SI  NLEP++           + + G ++  +E+M   Y   +  TL++    K
Sbjct: 182 DHAISDSIDMNLEPWANVWKFSDVLNKALKQGKLMYSREEMLNLYSKEVSKTLVETNPLK 241

Query: 234 K--TNEPWFVYTPMHGVGFEIFESISKQLLSLEEGKDYLVVEEQKYPDADFPTVSFPNPE 291
                +PWFVYTPMHGVGF IF +I K+ +SL EG+DYL V EQ+ PD  FPTV FPNPE
Sbjct: 242 LEIKAKPWFVYTPMHGVGFNIFSTIVKKTMSLVEGEDYLCVPEQQNPDPSFPTVGFPNPE 301

Query: 292 EKGALDLAVEYGRKNDTVDLIIANDPDADRFSVAVRDNDQNTTTAWRQLTGNEIGFLFAY 351
           EKGALD+ +    ++D ++L++ANDPDADRFS+AV+D     ++ WRQLTGNEIGFLFA+
Sbjct: 302 EKGALDIGMRLAEEHD-INLLVANDPDADRFSIAVKDTQ---SSKWRQLTGNEIGFLFAF 357

Query: 352 YEWERYKHSPIDE------PLAMLNSTVSSQMIKRMAEIEGFHYEDTLTGFKWLGNRALE 405
           +E++RYK+   DE      PLAML+STVSSQMIK+MAE+EGF YEDTLTGFKW+GNRA+ 
Sbjct: 358 FEFQRYKNK--DEEFQRSHPLAMLSSTVSSQMIKKMAEVEGFLYEDTLTGFKWIGNRAII 415

Query: 406 LEQEGYYTPFAYEEAIGYMFSSVVHDKDGISAAIVFLQAYSKWRA-SGQTVLDILATASL 464
           LE+EGYY PF +EEAIGYMF ++ HDKDGISAA+V LQAY KW+  S    +DIL     
Sbjct: 416 LEKEGYYVPFGFEEAIGYMFPAMEHDKDGISAAVVLLQAYCKWKIDSNLDPIDILENGFQ 475

Query: 465 KYGHFKEFNGYYIVPDLAITKQVFDAIRSIES----PYPKKLGSSFEIIKFRDLTNGYQS 520
           KYG FKE+NGYY+VP   +T ++F+ IR++ +    PYP  +G   E++ +RDLT GYQS
Sbjct: 476 KYGVFKEYNGYYVVPSPLVTTEIFEYIRNVYTPTGVPYPPSIGEEIEVVYYRDLTTGYQS 535

Query: 521 DTPDHIPELASDPSSQMITCEMLLVEQPTS-----RVRFTIRGSGTEPKLKVYIEARTNT 575
           DTPDH P L  DP+SQMIT    L  +P+       +RFTIRGSGTEPKLKVYIEA  + 
Sbjct: 536 DTPDHKPVLPVDPTSQMIT----LSGKPSDGNGNEHIRFTIRGSGTEPKLKVYIEACADN 591

Query: 576 EPNSIALAKFTWDVLRQEWFKPELTGLLTPF 606
           E  +  LAK TWDVLR+ WF+PE+  + T F
Sbjct: 592 EKRASYLAKLTWDVLRRGWFRPEIMNITTDF 622

>TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {ON}
           Anc_8.840 YMR278W
          Length = 630

 Score =  705 bits (1819), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/627 (57%), Positives = 443/627 (70%), Gaps = 29/627 (4%)

Query: 3   ETEVIESLPSDLQGKVRNWLKYDKVEETRNEILQLCLKGDITELHKRLDTMIAFGTAGLR 62
           E EVI S+P+DL   V +WL  D  ++TR EIL LC   D  ELHKRLDT I FGTAGLR
Sbjct: 10  EKEVINSVPTDLSQLVASWLSQDGNKQTRLEILNLCKAKDWLELHKRLDTRILFGTAGLR 69

Query: 63  GRMEAGFNRMNALTVKQASQGLAKYIKKQFPENLTVVVGHDHRHNSRLFGKVTVDTFLQL 122
            RMEAGF+RMN L V QA+QGLA++IKKQFP+ LT VVGHDHR NS+ F   TV TFLQ 
Sbjct: 70  SRMEAGFSRMNTLVVLQATQGLAQHIKKQFPDALTAVVGHDHRFNSQEFALATVATFLQA 129

Query: 123 GFKVFHLNHENEKSLVHTPLVPFTVNATGASVGIMITASHNPKMDNGYKVYYTNGCQIIP 182
           GFKV  LN  ++   VHTP+VPFTVN  GASVG+MITASHNPKMDNGYKVYY+NGCQIIP
Sbjct: 130 GFKVIFLNDGDK--FVHTPIVPFTVNEVGASVGVMITASHNPKMDNGYKVYYSNGCQIIP 187

Query: 183 PHDKLIAESIIHNLEPFSSP-----------QTGTIIDCKEKMTKKYIDAIGSTLIDGAV 231
           PHD  IA+SI  NL  +               T  ++   E+M ++Y   +G +L+D   
Sbjct: 188 PHDSEIAQSIEENLTLWPKAWKWDELLKEGLDTKCLVYAGEEMIERYTKKMGQSLVDRTT 247

Query: 232 --NKKTNEPWFVYTPMHGVGFEIFESISKQLLSLEEGKDYLVVEEQKYPDADFPTVSFPN 289
              +K  +PWFVYTP+HGVG++IF  I+++ ++L  G+DYL V+EQ+ PD  FPTV FPN
Sbjct: 248 ISAEKEGKPWFVYTPIHGVGYDIFRQIAEETMNLINGRDYLCVKEQQLPDPSFPTVPFPN 307

Query: 290 PEEKGALDLAVEYGRKNDTVDLIIANDPDADRFSVAVRDNDQNTTTAWRQLTGNEIGFLF 349
           PEEKGALD+A+    KN  + L++ANDPDADRFS AV+DN   T   WRQLTGNEIG LF
Sbjct: 308 PEEKGALDMAISVADKNG-ISLVLANDPDADRFSAAVKDNKTGT---WRQLTGNEIGALF 363

Query: 350 AYYEWERYKHSPID----EPLAMLNSTVSSQMIKRMAEIEGFHYEDTLTGFKWLGNRALE 405
           A+YE+++Y+    +     PLAMLNSTVSSQ+I +MAEIE FHY DTLTGFKW+GNR L+
Sbjct: 364 AFYEFQKYQKKNEEYKEKHPLAMLNSTVSSQLIMKMAEIEQFHYIDTLTGFKWIGNRTLD 423

Query: 406 LEQEGYYTPFAYEEAIGYMFSSVVHDKDGISAAIVFLQAYSKWR-ASGQTVLDILATASL 464
           LE   YY PF +EEAIGYMF  + HDKDGISAA VFLQ Y KW   S +T+L +L     
Sbjct: 424 LEAMNYYVPFGFEEAIGYMFPVMEHDKDGISAASVFLQMYRKWLVGSKKTLLTVLEDIFE 483

Query: 465 KYGHFKEFNGYYIVPDLAITKQVFDAIRS----IESPYPKKLGSSFEIIKFRDLTNGYQS 520
           KYG FKE+NGYY V D  + K+VFD IR+       PYP ++G   ++ KFRDLT GYQS
Sbjct: 484 KYGVFKEYNGYYSVNDPKVIKEVFDFIRNDYSETHDPYPSRIGEELKVNKFRDLTLGYQS 543

Query: 521 DTPDHIPELASDPSSQMITCEMLLV-EQPTSRVRFTIRGSGTEPKLKVYIEARTNTEPNS 579
           DT +  P+L  DP+SQMIT    +   +P   VRFTIRGSGTEPKLKVYIEA + +E  +
Sbjct: 544 DTVNQRPDLPVDPNSQMITAWTKVNGAKPYESVRFTIRGSGTEPKLKVYIEACSKSEERA 603

Query: 580 IALAKFTWDVLRQEWFKPELTGLLTPF 606
             LA+ TW VL++EWF+P++TGL T F
Sbjct: 604 SELAQLTWRVLKREWFRPDVTGLTTTF 630

>NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score =  696 bits (1796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/624 (57%), Positives = 440/624 (70%), Gaps = 30/624 (4%)

Query: 7   IESLPSDLQGKVRNWLKYDKVEETRNEILQLCLKGDITELHKRLDTMIAFGTAGLRGRME 66
           + + P +L+  +  WL+ D+ EETR E+LQLC   +  ELH+R DT I FGTAGLR RME
Sbjct: 8   LSNCPENLREPINLWLRLDQNEETRKEVLQLCENKNWPELHQRFDTRIVFGTAGLRSRME 67

Query: 67  AGFNRMNALTVKQASQGLAKYIKKQFPENLTVVVGHDHRHNSRLFGKVTVDTFLQLGFKV 126
           AGF+RMN+L + Q++QGLA YIK+QFP NLT VVGHDHR +S+ F  VT   FL+ GFKV
Sbjct: 68  AGFSRMNSLIILQSTQGLANYIKEQFPNNLTAVVGHDHRFHSKEFAIVTASIFLRAGFKV 127

Query: 127 FHLNHENEKSLVHTPLVPFTVNATGASVGIMITASHNPKMDNGYKVYYTNGCQIIPPHDK 186
           F+L  +++   VHTPLVPF+V    ASVG+MITASHNPKMDNGYKVYY N CQIIPPHDK
Sbjct: 128 FYLTPDDQ--FVHTPLVPFSVLNLKASVGVMITASHNPKMDNGYKVYYDNACQIIPPHDK 185

Query: 187 LIAESIIHNLEPFSSP-----------QTGTIIDCKEKMTKKYIDAIGSTLIDGA--VNK 233
            IAE I  NLEP+S+            +T  ++  K+ MT+KY+  +   LI  +    K
Sbjct: 186 NIAEMIQKNLEPWSTSWDWDATFKKGLETNKLVFIKDLMTEKYLMQMKRVLIHSSHLSLK 245

Query: 234 KTNEPWFVYTPMHGVGFEIFESISKQLLSLEEGKDYLVVEEQKYPDADFPTVSFPNPEEK 293
               P+FVYTPMHGVG EIF  +S +LL+L E  DYLVV EQ+ PD  FPTVSFPNPEEK
Sbjct: 246 DVKTPFFVYTPMHGVGAEIFAKVSSELLNLHENVDYLVVSEQRLPDPSFPTVSFPNPEEK 305

Query: 294 GALDLAVEYGRKNDTVDLIIANDPDADRFSVAVRDNDQNTTTAWRQLTGNEIGFLFAYYE 353
           GAL LA++  ++N  + L+IANDPDADRFS AV +     T  WRQLTGNEIGFL  YYE
Sbjct: 306 GALSLAIKLAQENG-LSLVIANDPDADRFSAAVLNKK---TGKWRQLTGNEIGFLLGYYE 361

Query: 354 WERYKHSPI----DEPLAMLNSTVSSQMIKRMAEIEGFHYEDTLTGFKWLGNRALELEQE 409
           ++ Y+   +      PLAM+NSTVSSQMIKRMA++ GFHYEDTLTGFKW+GN+A++L QE
Sbjct: 362 FQLYEQQDVAFRKTHPLAMINSTVSSQMIKRMADMNGFHYEDTLTGFKWIGNKAIDLRQE 421

Query: 410 GYYTPFAYEEAIGYMFSSVVHDKDGISAAIVFLQAYSKWRASGQ-TVLDILATASLKYGH 468
           GYY PF +EEAIGYMF  +  DKDGISAA VFLQAY  W    Q +  DI+     K+G 
Sbjct: 422 GYYVPFGFEEAIGYMFPDMECDKDGISAATVFLQAYCHWMNQYQMSPFDIMEEGFGKFGV 481

Query: 469 FKEFNGYYIVPDLAITKQVFDAIR----SIESPYPKKLGSSFEIIKFRDLTNGYQSDTPD 524
           FKE+NGYYI+ DL+ITK VFD IR    S    YP ++G+   +  FRDLT GYQS+T D
Sbjct: 482 FKEYNGYYILKDLSITKTVFDFIRHEYPSTNKKYPSEIGNELIVTVFRDLTVGYQSNTKD 541

Query: 525 HIPELASDPSSQMITCEMLLVE--QPTSRVRFTIRGSGTEPKLKVYIEARTNTEPNSIAL 582
           +IP L  DP+SQMIT E    E       VR T+RGSGTEPKLKVYIEA + +E ++  L
Sbjct: 542 NIPNLPVDPTSQMITVEAKPSEFSNLEGTVRLTMRGSGTEPKLKVYIEACSKSEESATNL 601

Query: 583 AKFTWDVLRQEWFKPELTGLLTPF 606
           A+ TWD+L++EWF+PE+TGL T F
Sbjct: 602 ARSTWDILKREWFRPEVTGLTTSF 625

>KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score =  690 bits (1780), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/628 (56%), Positives = 441/628 (70%), Gaps = 37/628 (5%)

Query: 6   VIESLPSDLQGKVRNWLKYDKVEETRNEILQLCLKGDITELHKRLDTMIAFGTAGLRGRM 65
           ++++ P  LQ ++  WL+ DK EETR E+L LC + D +EL+ R    I FGTAGLR RM
Sbjct: 8   ILQNAPEGLQHRILEWLRLDKNEETRREVLDLCQRQDWSELNSRFSQRILFGTAGLRSRM 67

Query: 66  EAGFNRMNALTVKQASQGLAKYIKKQFPENLTVVVGHDHRHNSRLFGKVTVDTFLQLGFK 125
           EAG NR+N+L + QA+QGLA+YI  QFP+N   VVGHDHR +S+ F  VT   FL+ GFK
Sbjct: 68  EAGTNRLNSLVILQATQGLARYIASQFPKNKVAVVGHDHRFHSKEFATVTAAVFLRAGFK 127

Query: 126 VFHLNHENEKSLVHTPLVPFTVNATGASVGIMITASHNPKMDNGYKVYYTNGCQIIPPHD 185
           V +LN  +  +LVHTPLVPFTV+   ASVG+MITASHNPKMDNGYKVY+ NGCQIIPPHD
Sbjct: 128 VLYLNPGD--TLVHTPLVPFTVDHLNASVGVMITASHNPKMDNGYKVYFANGCQIIPPHD 185

Query: 186 KLIAESIIHNLEPF-----------SSPQTGTIIDCKEKMTKKYIDAIGSTLIDG--AVN 232
             IA SI  NLEP+           ++ +   I+  K++MT+ Y       LI G   + 
Sbjct: 186 LNIARSIDQNLEPWEPSWDWPTVIQAAEKEDRIVYVKDQMTQLYTKTAELQLIGGRKVLR 245

Query: 233 KKTNEPWFVYTPMHGVGFEIFESISKQLLSLEEGKDYLVVEEQKYPDADFPTVSFPNPEE 292
              + PWFVYTPMHGVG EIF  IS+ +L ++E +DYL V EQK+PD  FPTVSFPNPEE
Sbjct: 246 NPGSGPWFVYTPMHGVGSEIFSRISEDVLGIKENEDYLCVPEQKHPDPSFPTVSFPNPEE 305

Query: 293 KGALDLAVEYGRKNDTVDLIIANDPDADRFSVAVRDNDQNTTTAWRQLTGNEIGFLFAYY 352
           KGALD A+E   +N  ++L+IANDPDADRFS+AV D   + T  WRQLTGNEIGFLFAY 
Sbjct: 306 KGALDKAIELASQNG-INLVIANDPDADRFSLAVFD---SKTANWRQLTGNEIGFLFAYQ 361

Query: 353 EWERYKHS----PIDEPLAMLNSTVSSQMIKRMAEIEGFHYEDTLTGFKWLGNRALELEQ 408
           ++E YK        + PL +LNSTVSSQMIK+MAE+EGFHYEDTLTGFKW+GNRA +LE+
Sbjct: 362 QFEMYKAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGFHYEDTLTGFKWIGNRARDLEK 421

Query: 409 EGYYTPFAYEEAIGYMFSSVVHDKDGISAAIVFLQAYSKWRASGQTV-LDILATASLKYG 467
           +G++ PF YEEAIGYMF+ + HDKDGISA+++FL +Y  W        LDIL     KYG
Sbjct: 422 KGFFAPFGYEEAIGYMFTQMEHDKDGISASLMFLLSYYHWVYDAHKFPLDILEDGYKKYG 481

Query: 468 HFKEFNGYYIVPDLAITKQVFDAIRSIESP---YPKKLGSSFEIIKFRDLTNGYQSDTPD 524
            FKE+NGYYIV +  I K+ FD IR+   P   YP+ +GS F+++ FRDLT G+QSDT D
Sbjct: 482 VFKEYNGYYIVDNPKIMKETFDYIRNDRKPGTQYPEAIGSEFQVVSFRDLTLGFQSDTSD 541

Query: 525 HIPELASDPSSQMITCEMLLVEQPT------SRVRFTIRGSGTEPKLKVYIEARTNTEPN 578
           HIP L  DP+SQMIT    +  +PT        VRFTIRGSGTEPKLKVYIEA + +E  
Sbjct: 542 HIPTLPVDPNSQMIT----VCAKPTHDNVERDHVRFTIRGSGTEPKLKVYIEACSGSETG 597

Query: 579 SIALAKFTWDVLRQEWFKPELTGLLTPF 606
           +  LAK  WD L++ WF+P+ TGL+T F
Sbjct: 598 AQQLAKQMWDTLQEVWFRPQTTGLVTDF 625

>Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  682 bits (1761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/625 (54%), Positives = 440/625 (70%), Gaps = 29/625 (4%)

Query: 5   EVIESLPSDLQGKVRNWLKYDKVEETRNEILQLCLKGDITELHKRLDTMIAFGTAGLRGR 64
           + +E++PS+L+  +  W + D+  ET  E+  LC K D  ELH+R D+ I FGTAGLR +
Sbjct: 4   QFLEAVPSNLKEAISLWFEQDQNPETIEEVTALCKKSDWNELHRRFDSRIQFGTAGLRSQ 63

Query: 65  MEAGFNRMNALTVKQASQGLAKYIKKQFPENLTVVVGHDHRHNSRLFGKVTVDTFLQLGF 124
           M+AGFNRMN L + QASQGLA Y K+QFP NL  VVGHDHR +S+ F + T   FL  GF
Sbjct: 64  MQAGFNRMNTLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARATATAFLLKGF 123

Query: 125 KVFHLNHENEKSLVHTPLVPFTVNATGASVGIMITASHNPKMDNGYKVYYTNGCQIIPPH 184
           KV +LN ++E   VHTPLVPF V+   ASVG+M+TASHNPKMDNGYKVYY+NGCQIIPPH
Sbjct: 124 KVHYLNPDHE--FVHTPLVPFAVDKLKASVGVMVTASHNPKMDNGYKVYYSNGCQIIPPH 181

Query: 185 DKLIAESIIHNLEPFSSP-----------QTGTIIDCKEKMTKKYIDAIGSTLI--DGAV 231
           D  I++SI  NLEP+++            + G ++  +E++ K Y+  +   L+  D   
Sbjct: 182 DHAISDSIDMNLEPWANVWNFDDVLNKGLKQGKLMYSREEILKLYLGEVSKNLVGTDPLK 241

Query: 232 NKKTNEPWFVYTPMHGVGFEIFESISKQLLSLEEGKDYLVVEEQKYPDADFPTVSFPNPE 291
            +   +PWFVYTPMHGVGF+IF +I K+ +SL EGKDYL V EQ+ PD  FPTV+FPNPE
Sbjct: 242 FEVKAKPWFVYTPMHGVGFDIFSTIVKKTMSLVEGKDYLCVPEQQEPDPSFPTVAFPNPE 301

Query: 292 EKGALDLAVEYGRKNDTVDLIIANDPDADRFSVAVRDNDQNTTTAWRQLTGNEIGFLFAY 351
           EKGALDL +    +N  ++L+IANDPDADRFSVA++D     +  WRQLTGNEIGFLFA 
Sbjct: 302 EKGALDLGINLA-ENHGINLLIANDPDADRFSVAIKDI---RSGEWRQLTGNEIGFLFAI 357

Query: 352 YEWERYKHSPID----EPLAMLNSTVSSQMIKRMAEIEGFHYEDTLTGFKWLGNRALELE 407
           +E++++K          PLAML+STVSSQMIK+MAE+EGFHYE+TLTGFKW+GNRA+ LE
Sbjct: 358 FEFQKFKSMEKQFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYEETLTGFKWIGNRAILLE 417

Query: 408 QEGYYTPFAYEEAIGYMFSSVVHDKDGISAAIVFLQAYSKWRASGQT-VLDILATASLKY 466
           +EGYY PF +EEAIGYMF ++ HDKDG+SA+IVFLQAY +W+       + IL     KY
Sbjct: 418 KEGYYVPFGFEEAIGYMFPAMEHDKDGLSASIVFLQAYCQWKIDHNLDPISILEDGFKKY 477

Query: 467 GHFKEFNGYYIVPDLAITKQVFDAIRSIESP----YPKKLGSSFEIIKFRDLTNGYQSDT 522
           G FKE+NGYYIV    +T ++FD IR+  +P    YP  +G   E++ +RDLT GYQSDT
Sbjct: 478 GVFKEYNGYYIVSSPIVTNEIFDYIRNAYTPKGVSYPSSIGKEIEVLNYRDLTIGYQSDT 537

Query: 523 PDHIPELASDPSSQMITCEMLLVE-QPTSRVRFTIRGSGTEPKLKVYIEARTNTEPNSIA 581
            +H P L  DPSSQMIT      +      +RFTIRGSGTEPK+KVYIEA  + E  +  
Sbjct: 538 SNHKPTLPIDPSSQMITVSAKPSDGNEGEHIRFTIRGSGTEPKIKVYIEACADEEQRATF 597

Query: 582 LAKFTWDVLRQEWFKPELTGLLTPF 606
           LAK TW+VL++EWF+PE   ++T F
Sbjct: 598 LAKLTWNVLKREWFRPEKMDIVTHF 622

>Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  682 bits (1760), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/632 (55%), Positives = 446/632 (70%), Gaps = 43/632 (6%)

Query: 5   EVIESLPSDLQGKVRNWLKYDKVEETRNEILQLCLKGDITELHKRLDTMIAFGTAGLRGR 64
           + + ++PSDL+G +  W   D+  ET  E+  LC K D  ELHKR DT I FGTAGLR +
Sbjct: 4   QFLGTIPSDLKGPISLWFDQDRDPETIEEVTALCKKSDWDELHKRFDTRIQFGTAGLRSQ 63

Query: 65  MEAGFNRMNALTVKQASQGLAKYIKKQFPENLTVVVGHDHRHNSRLFGKVTVDTFLQLGF 124
           M+AGF+RMN L + QASQGLA YI++QFP NL  VVGHDHR +S+ F + T   FL  GF
Sbjct: 64  MQAGFSRMNNLVIIQASQGLATYIRQQFPNNLVAVVGHDHRFHSKKFARATATAFLLKGF 123

Query: 125 KVFHLNHENEKSLVHTPLVPFTVNATGASVGIMITASHNPKMDNGYKVYYTNGCQIIPPH 184
           KV +LN   E   VHTPLVPF V+   ASVG+MITASHNPKMDNGYKVYY+NGCQIIPPH
Sbjct: 124 KVHYLNPGQE--FVHTPLVPFAVDELNASVGVMITASHNPKMDNGYKVYYSNGCQIIPPH 181

Query: 185 DKLIAESIIHNLEPFSSP-----------QTGTIIDCKEKMTKKYIDAIGSTLIDGAVNK 233
           D+ I+ +I  NLEP+++            + G ++  +E+M K Y++ I   L++    K
Sbjct: 182 DQAISNAIDMNLEPWANAWNFDDILSKNLKQGKLMYSREEMLKLYLEKISDNLVETTPLK 241

Query: 234 --KTNEPWFVYTPMHGVGFEIFESISKQLLSLEEGKDYLVVEEQKYPDADFPTVSFPNPE 291
               ++PWFVYTPMHGVGF+IF +I K+ + L EGKDYL V EQ+ PD  FPTV FPNPE
Sbjct: 242 LEVRSKPWFVYTPMHGVGFDIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNPE 301

Query: 292 EKGALDLAVEYGRKNDTVDLIIANDPDADRFSVAVRDNDQNTTTAWRQLTGNEIGFLFAY 351
           EKGAL++ +    K+D + L+IANDPDADRFSVA++D     +  W+QLTGNEIGFLFA+
Sbjct: 302 EKGALNIGMRLAEKHD-ISLLIANDPDADRFSVAIKDMQ---SGMWQQLTGNEIGFLFAF 357

Query: 352 YEW-------ERYKHSPIDEPLAMLNSTVSSQMIKRMAEIEGFHYEDTLTGFKWLGNRAL 404
           +E+       E+++ +    PLAML+STVSSQMIKRMAE+EGFHYEDTLTGFKW+GNRA+
Sbjct: 358 FEFEKFKSMDEQFQQT---HPLAMLSSTVSSQMIKRMAEVEGFHYEDTLTGFKWIGNRAI 414

Query: 405 ELEQEGYYTPFAYEEAIGYMFSSVVHDKDGISAAIVFLQAYSKWR-ASGQTVLDILATAS 463
            LE+EGYY PF +EEAIGYMF ++ HDKDGISA++VFLQAY KW+ A+    +++L    
Sbjct: 415 ILEKEGYYVPFGFEEAIGYMFPAMEHDKDGISASVVFLQAYCKWKLANNLDPINVLENGF 474

Query: 464 LKYGHFKEFNGYYIVPDLAITKQVFDAIRSIES----PYPKKLGSSFEIIKFRDLTNGYQ 519
            KYG FKE+NGYYIVP+  +TK++F  IR + +    PYP  +G    ++ +RDLT GYQ
Sbjct: 475 KKYGVFKEYNGYYIVPNPIVTKEIFKYIRDVYTPRNVPYPPYIGEEIRVLCYRDLTTGYQ 534

Query: 520 SDTPDHIPELASDPSSQMITCEMLLVEQPTS-----RVRFTIRGSGTEPKLKVYIEARTN 574
           SDT DH P L  DP+SQMIT    +  +P        +RFTIRGSGTEPKLKVYIE R N
Sbjct: 535 SDTLDHKPTLPVDPTSQMIT----VFARPNDSNGNEHIRFTIRGSGTEPKLKVYIETRAN 590

Query: 575 TEPNSIALAKFTWDVLRQEWFKPELTGLLTPF 606
            E  +  LAK TWDVLR+EWF+PE T + T F
Sbjct: 591 EERRASFLAKLTWDVLRREWFRPEKTNITTNF 622

>ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278W
           Hypothetical ORF
          Length = 610

 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/617 (55%), Positives = 437/617 (70%), Gaps = 38/617 (6%)

Query: 9   SLPSDLQGKVRNWLKYDKVEETRNEILQLCLKGDITELHKRLDTMIAFGTAGLRGRMEAG 68
           ++P +L+  +  WL  D+ E+T  EI +LC   + +ELH+RL++ + FGTAGLR RMEAG
Sbjct: 4   NIPENLKQPISLWLAQDRNEKTCKEIAELCDAENWSELHERLNSRLQFGTAGLRARMEAG 63

Query: 69  FNRMNALTVKQASQGLAKYIKKQFPENLTVVVGHDHRHNSRLFGKVTVDTFLQLGFKVFH 128
           F+RMN L V QA+QGLA+YIKKQFP++L  VVGHDHR NS  F K T    L+ GF+V +
Sbjct: 64  FSRMNTLVVIQATQGLAQYIKKQFPDHLVAVVGHDHRFNSMDFAKATATVLLKAGFEVHY 123

Query: 129 LNHENEKSLVHTPLVPFTVNATGASVGIMITASHNPKMDNGYKVYYTNGCQIIPPHDKLI 188
           LN  +  S VHTP+VPFTV+   ASVG+MITASHNPK+DNGYKVYY NGCQIIPPHD  I
Sbjct: 124 LNQGD--SYVHTPMVPFTVDRVKASVGVMITASHNPKLDNGYKVYYANGCQIIPPHDSAI 181

Query: 189 AESIIHNLEPFS-----------SPQTGTIIDCKEKMTKKYIDAIGSTLIDGAVNKKTNE 237
           A SI  NLEP +           +   G +I  ++KM ++YI  +  + +    +    +
Sbjct: 182 ARSIESNLEPGNGVWDWDQTMQQAADEGKLIYGRDKMLEQYISCVKDSFVTELDSLPKGK 241

Query: 238 PWFVYTPMHGVGFEIFESISKQLLSLEEGKDYLVVEEQKYPDADFPTVSFPNPEEKGALD 297
           PWFVYTPMHGVG+++F+ I+ ++L LE  +D+LVV EQ  PD +FPTV FPNPEEKGALD
Sbjct: 242 PWFVYTPMHGVGYQVFDQIASKILQLEVNRDFLVVSEQLNPDPEFPTVQFPNPEEKGALD 301

Query: 298 LAVEYGRKNDTVDLIIANDPDADRFSVAVRDNDQNTTTAWRQLTGNEIGFLFAYYEWERY 357
           LA++   +N  + L+IA+DPDADRFSVA +         W+QL+GN+IGFLFAYYE ++Y
Sbjct: 302 LAIKLA-ENHGIKLVIASDPDADRFSVAFKG-----PHGWQQLSGNDIGFLFAYYELQKY 355

Query: 358 KHSPID----EPLAMLNSTVSSQMIKRMAEIEGFHYEDTLTGFKWLGNRALELEQEGYYT 413
           +    +     PLAMLNSTVSSQMI  MA +EGFH+EDTLTGFKW+GNRALELE  GYY 
Sbjct: 356 RGFDAEYQKSHPLAMLNSTVSSQMINSMAALEGFHHEDTLTGFKWIGNRALELEARGYYV 415

Query: 414 PFAYEEAIGYMFSSVVHDKDGISAAIVFLQAYSKWRASGQTVLDILATASLKYGHFKEFN 473
           PF +EEAIGYMF +  HDKDGISAA+VFLQAY  W + G++ LDIL  AS KYG F+E+N
Sbjct: 416 PFGFEEAIGYMFPATEHDKDGISAAVVFLQAYHSWISQGKSPLDILDEASAKYGVFREYN 475

Query: 474 GYYIVPDLAITKQVFDAIRSIESP----YPKKLGSSFEIIKFRDLTNGYQSDTPDHIPEL 529
           GYY+V + ++T + F  IR   +P    YP+ +G   ++  FRDLT GYQSDTP++IP L
Sbjct: 476 GYYLVDEPSLTNKTFAYIREDYTPKGENYPRTIG-DLQVKTFRDLTTGYQSDTPNNIPNL 534

Query: 530 ASDPSSQMITCEMLLVEQPTS-----RVRFTIRGSGTEPKLKVYIEARTNTEPNSIALAK 584
             DPSSQMIT    +V QP        VRFT+RGSGTEPKLKVYIEA   ++P +  LA+
Sbjct: 535 HVDPSSQMIT----IVAQPKGGGSGEHVRFTLRGSGTEPKLKVYIEAGAQSDPRARELAR 590

Query: 585 FTWDVLRQEWF-KPELT 600
            TWD+LR+EWF +P LT
Sbjct: 591 QTWDILREEWFNRPGLT 607

>Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar to
           Ashbya gossypii ABL126W
          Length = 630

 Score =  676 bits (1745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/626 (54%), Positives = 436/626 (69%), Gaps = 33/626 (5%)

Query: 8   ESLPSDLQGKVRNWLKYDKVEETRNEILQLCLKGDITELHKRLDTMIAFGTAGLRGRMEA 67
           E +P DL+ K+  W KYDK  +T  EI  L    +  EL  RL   I+FGTAGLR RMEA
Sbjct: 11  ELIPDDLRDKIDKWFKYDKNPQTTAEIRSLVDSQNWNELRGRLCQRISFGTAGLRARMEA 70

Query: 68  GFNRMNALTVKQASQGLAKYIKKQFPENLTVVVGHDHRHNSRLFGKVTVDTFLQLGFKVF 127
           GF RMN LTV QASQGLA YIK QFP NL VVVGHDHR+NS+ F +V +  FLQLGF+V+
Sbjct: 71  GFARMNTLTVIQASQGLATYIKSQFPNNLKVVVGHDHRYNSKSFAEVAIAAFLQLGFEVY 130

Query: 128 HLNH----ENEKSLVHTPLVPFTVNAT--GASVGIMITASHNPKMDNGYKVYYTNGCQII 181
           +LN+    ++ +S VHTP+VPFTV+    GAS GIMITASHNPKMDNGYKVYY+NGCQI 
Sbjct: 131 YLNYVPSNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHNPKMDNGYKVYYSNGCQIT 190

Query: 182 PPHDKLIAESIIHNLEPFS-----------SPQTGTIIDCKEKMTKKYIDAIGSTLIDGA 230
           PPHDK IA  I  NL P+            +     + D K+++ K Y+  I S+L+   
Sbjct: 191 PPHDKKIASEIDANLVPWDQAWDAQKLIEDARNNNRLHDVKQELIKNYVQRIQSSLVTTN 250

Query: 231 VNKKTNEPWFVYTPMHGVGFEIFESISKQLLSLEEGKDYLVVEEQKYPDADFPTVSFPNP 290
                 + WFVYTPMHGVG+EIF +I    L L+E + YLVV  QK+PD +F TVSFPNP
Sbjct: 251 SLADCGKNWFVYTPMHGVGYEIFNNIVTNTLHLKEDEHYLVVGAQKFPDPEFTTVSFPNP 310

Query: 291 EEKGALDLAVEYGRKNDTVDLIIANDPDADRFSVAVRDNDQNTTTAWRQLTGNEIGFLFA 350
           EE+GAL+LA+E   ++   +L++ANDPDADRFS AV+D ++     W+QLTGN++G+LFA
Sbjct: 311 EEEGALNLAIELAARSG-AELVLANDPDADRFSAAVKDGNK-----WKQLTGNQLGYLFA 364

Query: 351 YYEWERYKHSPIDE-PLAMLNSTVSSQMIKRMAEIEGFHYEDTLTGFKWLGNRALELEQE 409
             + E++ +   ++ PLAML STVSSQMI +MA++EGF + +TLTGFKWL NRA++LE +
Sbjct: 365 VGQLEKFSNQNENKKPLAMLGSTVSSQMIAKMADVEGFTFVETLTGFKWLANRAIDLEND 424

Query: 410 GYYTPFAYEEAIGYMFSSVVHDKDGISAAIVFLQAYSKWRASGQTVLDILATASLKYGHF 469
           G+Y PFAYEEAIGYMFSSV HDKDG+SAA  FLQ  ++W+  G+T LD+L     KYG+F
Sbjct: 425 GFYVPFAYEEAIGYMFSSVTHDKDGVSAATEFLQMAARWKKEGKTPLDVLNAGYEKYGNF 484

Query: 470 KEFNGYYIVPDLAITKQVFDAIRSI----ESPYPKKLGSSFEIIKFRDLTNGYQSDTPDH 525
            E+NGYY V DL+I   VF  IR+     + PYP  +G+ F +  FRDLT GYQSDT +H
Sbjct: 485 VEYNGYYSVQDLSIIGDVFKYIRNACNGNDVPYPSTIGNEFAVASFRDLTVGYQSDTGNH 544

Query: 526 IPELASDPSSQMITCEMLLVEQPTSR-----VRFTIRGSGTEPKLKVYIEARTNTEPNSI 580
           IP L   P S MITC +  + + T++     VRFTIRGSGTEPKLKVYIE+    +  + 
Sbjct: 545 IPNLPVSPGSHMITCVLKPLIKETAQTSSDYVRFTIRGSGTEPKLKVYIESNALDKEYAT 604

Query: 581 ALAKFTWDVLRQEWFKPELTGLLTPF 606
            LAK TWDVL++EWF+PE+TGL T F
Sbjct: 605 KLAKLTWDVLKREWFRPEVTGLQTKF 630

>Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON}
           complement(13542..15440) [1899 nt, 633 aa]
          Length = 632

 Score =  673 bits (1736), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/629 (53%), Positives = 441/629 (70%), Gaps = 35/629 (5%)

Query: 6   VIESLPSDLQGKVRNWLKYDKVEETRNEILQLCLKGDITELHKRLDTMIAFGTAGLRGRM 65
           V+E+LP DL+ KV  WL  DK  ET NE+++LC    + ELHKR D  I FGTAGLR +M
Sbjct: 11  VLETLPVDLRDKVGTWLAQDKNPETINEVIRLCKANSLNELHKRFDNRILFGTAGLRSKM 70

Query: 66  EAGFNRMNALTVKQASQGLAKYIKKQFPENLTVVVGHDHRHNSRLFGKVTVDTFLQLGFK 125
           EAGF+RMN L V QA+QGLA YIK+QFP NL  V+GHDHR++S+ F ++    FL  GF 
Sbjct: 71  EAGFSRMNTLVVLQATQGLATYIKQQFPSNLKAVIGHDHRYHSKEFAEIATSVFLSAGFT 130

Query: 126 VFHLNHENEKSLVHTPLVPFTVNATGASVGIMITASHNPKMDNGYKVYYTNGCQIIPPHD 185
           V++LN     + VHTPLVPFTV+  GASVG+MITASHNPKMDNGYKVYY+NGCQIIPP D
Sbjct: 131 VYNLNPPG--TFVHTPLVPFTVDQIGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPVD 188

Query: 186 KLIAESIIHNLEPFSSPQTGT-----------IIDCKEKMTKKYIDAIGSTLIDGAVNKK 234
             IA+ I  NLEP+S+    +           +I  + +M   Y D + + +ID    ++
Sbjct: 189 ASIAKCIDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLLAYSDKVDNNIIDKKTIRE 248

Query: 235 TNE---PWFVYTPMHGVGFEIFESISKQLLSLEEGKDYLVVEEQKYPDADFPTVSFPNPE 291
            +E   PWFVYTPMHGVG+EIF S+  + ++L+E +DYL V+EQ  PD  FPT+SFPNPE
Sbjct: 249 FDEHRKPWFVYTPMHGVGYEIFTSLVLEKVNLKENRDYLTVKEQIVPDPAFPTISFPNPE 308

Query: 292 EKGALDLAVEYGRKNDTVDLIIANDPDADRFSVAVRDNDQNTTTAWRQLTGNEIGFLFAY 351
           EKGALD+A+   ++ND + L+IANDPDADRFS A+ ++    +  W+QLTGNEIGFLF Y
Sbjct: 309 EKGALDMAIALAKEND-ISLVIANDPDADRFSAAIYNSH---SGEWQQLTGNEIGFLFGY 364

Query: 352 YEWERYKHS----PIDEPLAMLNSTVSSQMIKRMAEIEGFHYEDTLTGFKWLGNRALELE 407
           Y + +Y +       + PLAMLNSTVSS+M+K MA+ E F + DTLTGFKW+GN+A++L+
Sbjct: 365 YLFNKYTNMDPEFKKNHPLAMLNSTVSSRMLKSMADTENFKFIDTLTGFKWIGNKAIDLK 424

Query: 408 QEGYYTPFAYEEAIGYMFSSVVHDKDGISAAIVFLQAYSKW-RASGQTVLDILATASLKY 466
           +EGY+  F YEEAIGYMF ++ HDKDGI+A++VFLQAY +W   S  TV+DIL     KY
Sbjct: 425 KEGYHVVFGYEEAIGYMFPAMEHDKDGITASVVFLQAYFEWDNLSKVTVIDILEQGIEKY 484

Query: 467 GHFKEFNGYYIVPDLAITKQVFDAIRSIESP-----YPKKLGSSFEIIKFRDLTNGYQSD 521
           G FKE+NGYY+V +  +T  +F  IR+ E P     YPK +G+  E+  FRDLT G+QSD
Sbjct: 485 GAFKEYNGYYVVSNPQVTNDIFHYIRN-EYPKNGNQYPKMIGTLLEVCSFRDLTTGFQSD 543

Query: 522 TPDHIPELASDPSSQMITCEMLLV----EQPTSRVRFTIRGSGTEPKLKVYIEARTNTEP 577
           T D+IP L  DPSSQMIT    +     ++  S VRFT+RGSGTEPKLK+YIE  +    
Sbjct: 544 TVDNIPSLPVDPSSQMITITAKICDDEYQKSDSIVRFTMRGSGTEPKLKLYIEGHSKDPI 603

Query: 578 NSIALAKFTWDVLRQEWFKPELTGLLTPF 606
            +  +AK TWDVL++EW +PE+TG+ T +
Sbjct: 604 AASKIAKLTWDVLKKEWIRPEVTGVTTSY 632

>CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278w
          Length = 617

 Score =  671 bits (1732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/627 (54%), Positives = 440/627 (70%), Gaps = 31/627 (4%)

Query: 1   MSETEVIESLPSDLQGKVRNWLKYDKVEETRNEILQLCLKGDITELHKRLDTMIAFGTAG 60
           MS T++    P +L+  + +WL+ DK EETRNE+++LC   +  ELHKR D+ I FGTAG
Sbjct: 1   MSTTDI----PVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHKRFDSRIVFGTAG 56

Query: 61  LRGRMEAGFNRMNALTVKQASQGLAKYIKKQFPENLTVVVGHDHRHNSRLFGKVTVDTFL 120
           LR RMEAG NR+N L + QASQGLA YIK +FP+NLT VVGHDHR++S+ F +VT  TF+
Sbjct: 57  LRARMEAGTNRLNKLVILQASQGLATYIKDKFPQNLTAVVGHDHRYHSQEFAQVTAATFI 116

Query: 121 QLGFKVFHLNHENEKSLVHTPLVPFTVNATGASVGIMITASHNPKMDNGYKVYYTNGCQI 180
           + GFKV++LN  +E   VHTP+VP++V+   ASVG+MITASHNPKMDNGYKVYYTNGCQI
Sbjct: 117 RAGFKVYYLNPHDE--FVHTPMVPYSVDHLNASVGVMITASHNPKMDNGYKVYYTNGCQI 174

Query: 181 IPPHDKLIAESIIHNLEPFSSPQT-----------GTIIDCKEKMTKKYIDAIGSTLIDG 229
           IPPHD  IAE+I +NLEP+S+              G I   +++M   Y++++ + LI  
Sbjct: 175 IPPHDHGIAETINNNLEPWSTDWNFTKILSNAETDGKIEYVRKRMLTSYLNSVVNQLIQR 234

Query: 230 AVNKKTNEPWFVYTPMHGVGFEIFESISKQLLSLEEGKDYLVVEEQKYPDADFPTVSFPN 289
                  +PWFVYTPMHGVG +IF +I  + L+L++  DY+ V EQK PD  F TVSFPN
Sbjct: 235 DFAAPDEKPWFVYTPMHGVGHQIFSTILNESLNLKDNIDYITVPEQKDPDPSFRTVSFPN 294

Query: 290 PEEKGALDLAVEYGRKNDTVDLIIANDPDADRFSVAVRDNDQNTTTAWRQLTGNEIGFLF 349
           PEEKGAL+LA+     N  + L++ANDP+ADRFSVAVRD+ +N    W+QLTGNEIG LF
Sbjct: 295 PEEKGALNLAITLAEANG-IKLVLANDPNADRFSVAVRDDSKN---EWKQLTGNEIGLLF 350

Query: 350 AYYEWERYKHSP----IDEPLAMLNSTVSSQMIKRMAEIEGFHYEDTLTGFKWLGNRALE 405
           A+YE++ Y+ +      ++PLAMLNSTVS+Q+IKRMAE EGF Y+DTLTGFKW+GN A +
Sbjct: 351 AFYEFKMYQKAADKGIKNKPLAMLNSTVSAQVIKRMAEKEGFLYKDTLTGFKWIGNEAAK 410

Query: 406 LEQEGYYTPFAYEEAIGYMFSSVVHDKDGISAAIVFLQAYSKWRASGQTVLDILATASLK 465
           LE++GY+ PF YEEAIGYMF ++ HDKDG+SAAIVFLQAY+ W  S    +DI+     K
Sbjct: 411 LEEKGYFVPFGYEEAIGYMFPAMEHDKDGVSAAIVFLQAYANWLQSSSNPIDIIHECYDK 470

Query: 466 YGHFKEFNGYYIVPDLAITKQVFDAIR----SIESPYPKKLGSSFEIIKFRDLTNGYQSD 521
           YG   E+NGYYIV D + T +VF++IR    S+   +P+ +G  F + +FRDLT G+ S 
Sbjct: 471 YGVSAEYNGYYIVSDPSKTDKVFESIRSSYTSMGLSFPESIGEHFRVTEFRDLTIGFDST 530

Query: 522 TPDHIPELASDPSSQMITCEMLL--VEQPTSRVRFTIRGSGTEPKLKVYIEARTNTEPNS 579
           T D  P L  D +SQMIT   +          VRFTIRGSGTEPKLKVYIE  ++TE  +
Sbjct: 531 TADKKPLLPVDKNSQMITITAVPSGASNTGESVRFTIRGSGTEPKLKVYIEGISSTEGRA 590

Query: 580 IALAKFTWDVLRQEWFKPELTGLLTPF 606
             LAK  W+ L+ EWFKP   GL T F
Sbjct: 591 RILAKSLWETLKHEWFKPSSNGLSTDF 617

>KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.840
           YMR278W
          Length = 624

 Score =  661 bits (1706), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/619 (56%), Positives = 426/619 (68%), Gaps = 27/619 (4%)

Query: 8   ESLPSDLQGKVRNWLKYDKVEETRNEILQLCLKGDITELHKRLDTMIAFGTAGLRGRMEA 67
           E +P  L+     WL+YD+ EETR+EIL +  + D  EL  RL+  I FGTAGLRGRMEA
Sbjct: 13  EYVPERLKVSCDRWLRYDQNEETRSEILTIIGRKDWKELGNRLEGRIPFGTAGLRGRMEA 72

Query: 68  GFNRMNALTVKQASQGLAKYIKKQFPENLTVVVGHDHRHNSRLFGKVTVDTFLQLGFKVF 127
           GF RMN+L + Q SQGLA+YI ++FP+NL+VVVGHDHR++S+ F  +TV TFL  GFKVF
Sbjct: 73  GFTRMNSLVILQTSQGLAQYIMEKFPQNLSVVVGHDHRYHSKEFADITVATFLNAGFKVF 132

Query: 128 HLNHENEKSLVHTPLVPFTVNATGASVGIMITASHNPKMDNGYKVYYTNGCQIIPPHDKL 187
           +LN ENE   VHTPLVP++V+   ++ G+MITASHNPK DNGYKVYY+NGCQIIPPHDK 
Sbjct: 133 YLNTENE--FVHTPLVPYSVDKLRSACGVMITASHNPKDDNGYKVYYSNGCQIIPPHDKN 190

Query: 188 IAESIIHNLEPFSS-----------PQTGTIIDCKEKMTKKYI-DAIGSTLIDGAVNKKT 235
           IA +I  NL P+S             + G +     KM   Y+ D       +G+   KT
Sbjct: 191 IALTIEKNLTPWSKDWNWKDLFSTEERNGNLEFNGNKMFLAYVQDITRYVFTNGSPMLKT 250

Query: 236 NEPWFVYTPMHGVGFEIFESISKQLLSLEEGKDYLVVEEQKYPDADFPTVSFPNPEEKGA 295
            +PWFVYTPMHGVG +IF  I+KQ+L L E  DY  V EQ  PD  FPTVSFPNPEEKGA
Sbjct: 251 GKPWFVYTPMHGVGHKIFGQIAKQVLGLSENVDYFSVPEQIKPDPSFPTVSFPNPEEKGA 310

Query: 296 LDLAVEYGRKNDTVDLIIANDPDADRFSVAVRDNDQNTTTAWRQLTGNEIGFLFAYYEWE 355
           LD+A++   + + + LIIANDPDADRFS AV+D   +    WRQL+GNEIG LFA ++ +
Sbjct: 311 LDMAIQLAER-EGLTLIIANDPDADRFSAAVKDKRSH---EWRQLSGNEIGSLFAIFKLQ 366

Query: 356 RYKHSPID-EPLAMLNSTVSSQMIKRMAEIEGFHYEDTLTGFKWLGNRALELEQEGYYTP 414
            +K      +PLAMLNSTVSSQM+K+MA++EGFHYE+TLTGFKW+GNRAL+LEQ+GY   
Sbjct: 367 EHKEKAASRKPLAMLNSTVSSQMLKKMAQVEGFHYEETLTGFKWIGNRALQLEQQGYDVC 426

Query: 415 FAYEEAIGYMFSSVVHDKDGISAAIVFLQAYSKW-RASGQTVLDILATASLKYGHFKEFN 473
           F YEEAIGYMF  + HDKDGI A++VFL  YSKW    G   LD+L     KYG F E+N
Sbjct: 427 FGYEEAIGYMFPCMEHDKDGIIASVVFLHMYSKWLELEGLGPLDVLDLCFEKYGVFSEYN 486

Query: 474 GYYIVPDLAITKQVFDAIRS----IESPYPKKLGSSFEIIKFRDLTNGYQSDTPDHIPEL 529
           GYY V + A+ + VF  IR        PYP+KLG  F +  FRDLT GYQSDT D  P L
Sbjct: 487 GYYTVEEPALIESVFSYIRDEYCPKARPYPEKLGREFFLTSFRDLTLGYQSDTIDFKPTL 546

Query: 530 ASDPSSQMITCEMLLVEQPTSR--VRFTIRGSGTEPKLKVYIEARTNTEPNSIALAKFTW 587
             D SSQMIT   L  E+      +RFTIRGSGTEPKLKVYIE+    +  +  LA  TW
Sbjct: 547 PVDASSQMITA-TLKPERTVGHEEIRFTIRGSGTEPKLKVYIESHAANKEAAANLAHLTW 605

Query: 588 DVLRQEWFKPELTGLLTPF 606
           +VLR+EWF+PE+TGL T F
Sbjct: 606 NVLRREWFRPEITGLKTSF 624

>TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.840
           YMR278W
          Length = 643

 Score =  657 bits (1695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/637 (52%), Positives = 435/637 (68%), Gaps = 39/637 (6%)

Query: 6   VIESLPSDLQGKVRNWLKYDKVEETRNEILQLCLKGDITELHKRLDTMIAFGTAGLRGRM 65
           +I+  P DLQ KV  WL+ DK + TR EI+ LC   ++ ELH+R D+ I FGTAGLR  M
Sbjct: 10  LIKDYPEDLQKKVLLWLEQDKDDSTRKEIIDLCKSANVKELHERFDSRITFGTAGLRSTM 69

Query: 66  EAGFNRMNALTVKQASQGLAKYIK---KQFPENLTVVVGHDHRHNSRLFGKVTVDTFLQL 122
           EAGF+RMN LTV QASQGLA Y+K   K   + L  V+GHDHR++S+ F K+    FL  
Sbjct: 70  EAGFSRMNTLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKEFAKIAATVFLIA 129

Query: 123 GFKVFHLNHEN-----EKSLVHTPLVPFTVNATGASVGIMITASHNPKMDNGYKVYYTNG 177
           GFKV++LN ++     +   VHTP+VPFTV    ASVG+M+TASHNPKMDNGYKVYY+NG
Sbjct: 130 GFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNLKASVGVMVTASHNPKMDNGYKVYYSNG 189

Query: 178 CQIIPPHDKLIAESIIHNLEPF-----------SSPQTGTIIDCKEKMTKKYIDAIGSTL 226
           CQIIPPHD  I++ I  NLEP+           ++   G +I  ++ M   YI  +   L
Sbjct: 190 CQIIPPHDSGISQCIDANLEPWENSWNYKEIMANAESKGDLIYHRDVMLNDYITQLEEKL 249

Query: 227 IDGAV---NKKTN---EPWFVYTPMHGVGFEIFESISKQLLSLEEGKDYLVVEEQKYPDA 280
               +   +KK +   +PWFVYTPMHGVG+EIF  IS ++L ++EG+D++VVEEQK+PD 
Sbjct: 250 TSKDIIHLSKKIDVKSKPWFVYTPMHGVGYEIFTKISNEILHMKEGEDFIVVEEQKHPDP 309

Query: 281 DFPTVSFPNPEEKGALDLAVEYGRKNDTVDLIIANDPDADRFSVAVRDNDQNTTTAWRQL 340
            FPTVSFPNPEEKGA+D+ ++    N  + L+IANDPDADRFS+AV+      T  W Q 
Sbjct: 310 GFPTVSFPNPEEKGAIDMGIKLAEDN-GISLVIANDPDADRFSIAVKSKGSQGT--WHQF 366

Query: 341 TGNEIGFLFAYYEWERYKHSPID-EPLAMLNSTVSSQMIKRMAEIEGFHYEDTLTGFKWL 399
           TGNEIG+LFAY+E+++YK S  D   L M+NSTVSSQMIK+MAEIEGF+YE+TLTGFKW+
Sbjct: 367 TGNEIGYLFAYFEFQKYKISKQDLHRLYMVNSTVSSQMIKKMAEIEGFNYEETLTGFKWI 426

Query: 400 GNRALELEQEGYYTPFAYEEAIGYMFSSVVHDKDGISAAIVFLQAYSKW-RASGQTVLDI 458
           GNRA++L  +G   PF YEEAIGYMF ++  DKDGI+A ++F+QA+  W +       +I
Sbjct: 427 GNRAIDLINKGNIVPFGYEEAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQIDKMDPYEI 486

Query: 459 LATASLKYGHFKEFNGYYIVPDLAITKQVFDAIR--------SIESPYPKKLGSSFEIIK 510
           +     KYG F E+NGYY   DL ITK++FD +R             YP  +G  F+IIK
Sbjct: 487 IQLGFKKYGVFIEYNGYYRYTDLGITKKIFDYVRYDYDKGVSEGNKKYPDHIGEEFKIIK 546

Query: 511 FRDLTNGYQSDTPDHIPELASDPSSQMITCEMLLVEQPT-SRVRFTIRGSGTEPKLKVYI 569
           +RDLT GYQSDTPD+ P L  DPSSQMIT EM+  +  +   +R TIRGSGTEPKLKVYI
Sbjct: 547 YRDLTTGYQSDTPDNKPLLPVDPSSQMITVEMIPTDNESDGSIRLTIRGSGTEPKLKVYI 606

Query: 570 EARTNTEPNSIALAKFTWDVLRQEWFKPELTGLLTPF 606
           EA + +   +  LAK  W+VL++EW +PE TG+ T F
Sbjct: 607 EACSRSATEASFLAKQAWNVLKREWMRPEQTGITTAF 643

>ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR278W
          Length = 624

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/628 (53%), Positives = 428/628 (68%), Gaps = 32/628 (5%)

Query: 5   EVIESLPSDLQGKVRNWLKYDKVEETRNEILQLCLKGDITELHKRLDTMIAFGTAGLRGR 64
           E  +++PS L+  +  WL +DK  ET++EI +L       EL KRL   I FGTAGLR R
Sbjct: 3   ENTDAVPSSLKDSLMEWLTFDKNSETQHEICELVSNHQWDELRKRLLPRITFGTAGLRAR 62

Query: 65  MEAGFNRMNALTVKQASQGLAKYIKKQFPENLTVVVGHDHRHNSRLFGKVTVDTFLQLGF 124
           MEAGF+RMN LTV QASQGLA+YIK QFP++L VV+GHDHR +SR F + T+  FLQL +
Sbjct: 63  MEAGFSRMNTLTVIQASQGLARYIKSQFPDDLKVVIGHDHRFHSREFAEATIAAFLQLDY 122

Query: 125 KVFHLNH----ENEKSLVHTPLVPFTVNATGA---SVGIMITASHNPKMDNGYKVYYTNG 177
            +++LN+     +E   VHTP+VPF +N       S G+MITASHNPKMDNGYKVYY NG
Sbjct: 123 DIYYLNYVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYANG 182

Query: 178 CQIIPPHDKLIAESIIHNLEPFSSP-----------QTGTIIDCKEKMTKKYIDAIGSTL 226
           CQIIPPHD+LI   I  NLEP++             ++G + D +++M +KY D+I + L
Sbjct: 183 CQIIPPHDELIGRHIDANLEPWTRAWDSKALIEEAIKSGKLHDVRKEMLQKYKDSIQTML 242

Query: 227 IDGAVNKKTNEPWFVYTPMHGVGFEIFESISKQLLSLEEGKDYLVVEEQKYPDADFPTVS 286
           +  +  K    PWFVYTPMHGVG+E F+     +L +EE KDY+VV EQKYPD +FPTVS
Sbjct: 243 VKQSNLKFAGGPWFVYTPMHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPTVS 302

Query: 287 FPNPEEKGALDLAVEYGRKNDTVDLIIANDPDADRFSVAVRDNDQNTTTAWRQLTGNEIG 346
           FPNPEE+GALD+A++    N  + +++ANDPDADRFSVAV+ + +     W QLTGN+IG
Sbjct: 303 FPNPEERGALDMAMKVADANG-ITVVLANDPDADRFSVAVKYHGE-----WNQLTGNQIG 356

Query: 347 FLFAYYEWERYKHSP-ID-EPLAMLNSTVSSQMIKRMAEIEGFHYEDTLTGFKWLGNRAL 404
            LFA  E + Y   P +D + LAML S VSSQ++++MAE EGF   +TLTGFKWLGNRA 
Sbjct: 357 ILFAQAEMQSYFKEPKLDRKQLAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLGNRAR 416

Query: 405 ELEQEGYYTPFAYEEAIGYMFSSVVHDKDGISAAIVFLQAYSKWRASGQTVLDILATASL 464
           ELE EGYY PFAYEEAIGYMFS VVHDKDGI+AA VFLQ   +W+   ++  ++L     
Sbjct: 417 ELELEGYYVPFAYEEAIGYMFSQVVHDKDGIAAAAVFLQMCYEWKKVAKSSQEVLQECYE 476

Query: 465 KYGHFKEFNGYYIVPDLAITKQVFDAIRS----IESPYPKKLGSSFEIIKFRDLTNGYQS 520
           KYG+F ++NGYYI    A+TK+VFD  R+       PYP  +G  FE+   RDLT GYQS
Sbjct: 477 KYGYFVDYNGYYISSAPAVTKEVFDYFRNEYTPAGKPYPSHIGCEFEVEYLRDLTVGYQS 536

Query: 521 DTPDHIPELASDPSSQMITCEM--LLVEQPTSRVRFTIRGSGTEPKLKVYIEARTNTEPN 578
           DT  +IP+L  D +SQMITC +  + +E     VRFT RGSGTEPKLKVYIE+       
Sbjct: 537 DTATNIPDLPVDHNSQMITCVLKPVKMETDCESVRFTARGSGTEPKLKVYIESCAANHQR 596

Query: 579 SIALAKFTWDVLRQEWFKPELTGLLTPF 606
           +  L+   WDVL++EWF+P  TGL T F
Sbjct: 597 ASHLSHLAWDVLKREWFRPTETGLQTNF 624

>NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}
           Anc_6.11 YEL058W
          Length = 549

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 21/31 (67%)

Query: 151 GASVGIMITASHNPKMDNGYKVYYTNGCQII 181
           G  VG+M+TASHNP +DNG KV    G  +I
Sbjct: 57  GTPVGVMVTASHNPPLDNGVKVVEPTGAMLI 87

>TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {ON}
           Anc_6.11 YEL058W
          Length = 558

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 22/30 (73%)

Query: 151 GASVGIMITASHNPKMDNGYKVYYTNGCQI 180
           G +VG+M+TASHNP +DNG K+   NG  +
Sbjct: 59  GKAVGVMVTASHNPPVDNGVKIVEPNGSML 88

>Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON}
           complement(1049..2668) [1620 nt, 540 aa]
          Length = 539

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 24/35 (68%)

Query: 146 TVNATGASVGIMITASHNPKMDNGYKVYYTNGCQI 180
           +++  G +VG+MITASHNP  DNG K+   NG  +
Sbjct: 46  SISLGGKAVGVMITASHNPPEDNGVKIVEPNGAML 80

>CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058w PCM1 phosphoacetylglucosamine mutase
          Length = 540

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 25/36 (69%)

Query: 146 TVNATGASVGIMITASHNPKMDNGYKVYYTNGCQII 181
           +++   A VG+MITASHNP  DNG K+  ++G  ++
Sbjct: 46  SISCQCAPVGVMITASHNPPRDNGVKIVESDGSMLL 81

>TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.11
           YEL058W
          Length = 528

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 21/31 (67%)

Query: 151 GASVGIMITASHNPKMDNGYKVYYTNGCQII 181
           G  VG+MITASHNP  DNG KV   +G  +I
Sbjct: 54  GKPVGVMITASHNPSGDNGVKVVEPDGSMLI 84

>Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)
          Length = 555

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 32/62 (51%), Gaps = 5/62 (8%)

Query: 151 GASVGIMITASHNPKMDNGYKVYYTNGCQIIP---PHDKLIAE--SIIHNLEPFSSPQTG 205
           G  VG+MITASHNP  DNG K+   +G  ++    P+   +A   S   N E F +  T 
Sbjct: 57  GQYVGVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTR 116

Query: 206 TI 207
            I
Sbjct: 117 LI 118

>ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL058W (PCM1)
          Length = 552

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 25/39 (64%), Gaps = 8/39 (20%)

Query: 151 GASVGIMITASHNPKMDNGYKVYYTNGCQIIPPHDKLIA 189
           GA VG+M+TASHNP  DNG K        ++ PH +++A
Sbjct: 55  GAYVGVMLTASHNPPEDNGVK--------LVDPHGEMLA 85

>KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON}
           Anc_6.11 YEL058W
          Length = 540

 Score = 39.3 bits (90), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 21/31 (67%)

Query: 151 GASVGIMITASHNPKMDNGYKVYYTNGCQII 181
           G  +G+MITASHNP  DNG K+   +G  +I
Sbjct: 56  GKYIGVMITASHNPPQDNGVKIVEPSGAMLI 86

>KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.11
           YEL058W
          Length = 538

 Score = 38.9 bits (89), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 16/22 (72%), Positives = 18/22 (81%)

Query: 151 GASVGIMITASHNPKMDNGYKV 172
           GA VG+M+TASHNP  DNG KV
Sbjct: 55  GAQVGVMVTASHNPPEDNGVKV 76

>YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essential
           N-acetylglucosamine-phosphate mutase; converts
           GlcNAc-6-P to GlcNAc-1-P, which is a precursor for the
           biosynthesis of chitin and for the formation of
           N-glycosylated mannoproteins and
           glycosylphosphatidylinositol anchors
          Length = 557

 Score = 38.5 bits (88), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 21/31 (67%)

Query: 151 GASVGIMITASHNPKMDNGYKVYYTNGCQII 181
           G  VG+MITASHNP  DNG K+   +G  ++
Sbjct: 57  GQYVGVMITASHNPYQDNGVKIVEPDGSMLL 87

>Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)
          Length = 557

 Score = 38.5 bits (88), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 21/31 (67%)

Query: 151 GASVGIMITASHNPKMDNGYKVYYTNGCQII 181
           G  VG+MITASHNP  DNG K+   +G  ++
Sbjct: 57  GQYVGVMITASHNPYQDNGVKIVEPDGSMLL 87

>Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)
          Length = 553

 Score = 38.5 bits (88), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 21/31 (67%)

Query: 151 GASVGIMITASHNPKMDNGYKVYYTNGCQII 181
           G  VG+MITASHNP  DNG K+   +G  ++
Sbjct: 57  GQYVGVMITASHNPYQDNGVKIVEPDGSMLL 87

>SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 544

 Score = 38.5 bits (88), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 35/66 (53%), Gaps = 12/66 (18%)

Query: 151 GASVGIMITASHNPKMDNGYKVYYTNGCQIIPPHDKLIAESIIHNLEPFSSPQTGTIIDC 210
           G  VG+MITASHNP  DNG K        I+ P  +++ ++     EPF++    +    
Sbjct: 55  GQYVGVMITASHNPPQDNGVK--------IVDPKGEMLDQA----WEPFATELANSASKG 102

Query: 211 KEKMTK 216
           K+++ K
Sbjct: 103 KQELIK 108

>NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6.11
           YEL058W
          Length = 561

 Score = 38.5 bits (88), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 22/30 (73%)

Query: 152 ASVGIMITASHNPKMDNGYKVYYTNGCQII 181
           +++G+M+TASHNP  DNG K+   NG  ++
Sbjct: 66  SAIGVMVTASHNPPEDNGVKIIEPNGSMLL 95

>ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 550

 Score = 37.7 bits (86), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 20/27 (74%)

Query: 151 GASVGIMITASHNPKMDNGYKVYYTNG 177
           G  +G+M+TASHNP +DNG KV   +G
Sbjct: 56  GDVIGVMVTASHNPPVDNGVKVVEPDG 82

>KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 541

 Score = 37.7 bits (86), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 27/48 (56%), Gaps = 12/48 (25%)

Query: 154 VGIMITASHNPKMDNGYKVYYTNGCQIIPPHDKLIAESIIHNLEPFSS 201
           VG+MITASHNP  DNG KV        + P+     E ++ N EP ++
Sbjct: 54  VGVMITASHNPPEDNGVKV--------VEPY----GEMLVQNWEPIAT 89

>Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON}
           YEL058W (PCM1) - Phosphoacetylglucosamine Mutase [contig
           186] FULL
          Length = 541

 Score = 37.7 bits (86), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 18/22 (81%)

Query: 151 GASVGIMITASHNPKMDNGYKV 172
           G +VG+MITASHNP  DNG K+
Sbjct: 55  GKTVGVMITASHNPPEDNGVKI 76

>KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} similar
           to uniprot|P38628 Saccharomyces cerevisiae YEL058W PCM1
           Essential N-acetylglucosamine- phosphate mutase a
           hexosephosphate mutase involved in the biosynthesis of
           chitin
          Length = 544

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 18/22 (81%)

Query: 151 GASVGIMITASHNPKMDNGYKV 172
           G +VG+MITASHNP  DNG K+
Sbjct: 55  GRTVGVMITASHNPPEDNGVKI 76

>AGR322W Chr7 (1333129..1334631) [1503 bp, 500 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJR010W (MET3)
          Length = 500

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 64/139 (46%), Gaps = 18/139 (12%)

Query: 43  ITELHKRLDTMIAFGTAGLRGRMEAGFNRMNALTVKQASQGLAKYIKKQFPENLTVVVGH 102
           + E+   + T+   GT  LR R+  G +  +  T  +  + L +Y   ++ +   +VV H
Sbjct: 341 VDEIDGSVKTLTISGTE-LRKRLREGTDIPDWFTYPEIVEILRQYNPPRYRQGFVIVVNH 399

Query: 103 DHRHNSRLFGKVTVDTFLQLG----FKVFHLNHENEKSLVHTPLVP-FTVNATGASVGIM 157
           +   N +      + TFLQ+G    +K+F  +H+ +  L+   L+P F  + TG     +
Sbjct: 400 E---NPKRIANALLSTFLQVGGGRQYKIF--DHQGQPQLLE--LIPDFVKSGTG-----L 447

Query: 158 ITASHNPKMDNGYKVYYTN 176
           I  S  P   + + +Y  N
Sbjct: 448 IVTSPLPSSVDAHNIYELN 466

>TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON}
           Anc_6.11 YEL058W
          Length = 545

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (66%)

Query: 151 GASVGIMITASHNPKMDNGYKVYYTNGCQI 180
           G +VG+MITASHN   DNG K+   +G  +
Sbjct: 55  GKAVGVMITASHNQPCDNGVKIVEPDGSML 84

>Kpol_1033.54 s1033 (136243..137955) [1713 bp, 570 aa] {ON}
           (136243..137955) [1713 nt, 571 aa]
          Length = 570

 Score = 35.8 bits (81), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 60/134 (44%), Gaps = 26/134 (19%)

Query: 57  GTAGLRGRMEAGFNRMNALTVKQASQGLAKYIKKQFP---ENLTVVVGHDHRHNSRLFGK 113
           GT+GLR + +        ++ K  ++   + I    P   +N T+VVG D     R +  
Sbjct: 19  GTSGLRKKTKI------FMSEKNYTENFIQSILNSIPNGVKNSTIVVGGD----GRFYND 68

Query: 114 VTVDTFLQL----GFKVFHLNHENEKSLVHTPLVPFTVNATGASV---GIMITASHN--- 163
           + +D  +Q+    G +   +    +  ++ TP   + +     S    GI++TASHN   
Sbjct: 69  IILDKIMQISAANGVRKLVIG---QNGILSTPAASYIIRNYKESCNGGGIILTASHNPGG 125

Query: 164 PKMDNGYKVYYTNG 177
           P+ D G K   +NG
Sbjct: 126 PENDIGIKYNLSNG 139

>Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON}
           similar to Ashbya gossypii ACR015W
          Length = 551

 Score = 34.7 bits (78), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 16/22 (72%)

Query: 151 GASVGIMITASHNPKMDNGYKV 172
           G  VG MITASHNP  DNG K+
Sbjct: 55  GQYVGAMITASHNPPQDNGVKL 76

>KNAG0E02390 Chr5 (475467..477176) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 34.7 bits (78), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 111/493 (22%), Positives = 191/493 (38%), Gaps = 86/493 (17%)

Query: 57  GTAGLRGRMEAGFNRMNALTVKQASQGLAKYIKKQFPENL---TVVVGHDHRHNSRLFGK 113
           GT+GLR +     N          ++   + + +  PE     T+VVG D R+ + +   
Sbjct: 19  GTSGLRKKTAVFTNE------PHYTENFIQAVMEAIPEGCKGATLVVGGDGRYYNDVILH 72

Query: 114 VTVDTFLQLGFKVFHLNHENEKSLVHTPLVPFTVNA--TGASVGIMITASHN---PKMDN 168
                    G +   +    +  L+ TP     +       + GI++TASHN   PK D 
Sbjct: 73  KIAAIGAANGVRKLVIG---QNGLLSTPAASHIMRTYKEKCTGGIILTASHNPGGPKNDM 129

Query: 169 GYKVYYTNGC--------------------QIIPPHDKLIAESIIHNLEPFSSPQTGTII 208
           G K   +NG                     +IIP   +L  +++  N++    P    ++
Sbjct: 130 GIKYNLSNGGPAPEPVTNKIWEVSKQLDHYKIIPDLPELALDTLAENVQ--YGPLLVDVV 187

Query: 209 DCKEKMTKKYIDAIGSTLIDGAVNK-KTNEPW-FVYTPMHGV----GFEIFESISKQLLS 262
           D      +   +     LI   ++K ++ + W  ++  M+GV    G  IF  + +  L 
Sbjct: 188 DTTRDYVEFLKEIFDFPLIKSFIHKQRSQKHWKLLFDGMNGVTGPYGKAIF--VDEFELP 245

Query: 263 LEEGKDYLVVEEQKYPDADFPTVSFPNPEEKGALDLAVEYGRKNDTVDLIIANDPDADRF 322
            EE      V +  +P  DF  +  P+P    A  L     R+N  ++   A+D D DR 
Sbjct: 246 AEE------VLQNWHPQPDFGGIH-PDPNLTYARSLVDRVDREN--IEFGAASDGDGDRN 296

Query: 323 SVAVRDNDQNTTTAWRQLTGNEIGFLFAY-YEWERYKHSPIDEPLAMLNSTVSSQMIKRM 381
            +           A+    G+ +  +  Y  E   +    I     +  S  ++  I R+
Sbjct: 297 MI------YGAGPAFVS-PGDSVAIIAEYAAEIPYFAKQGI---YGLARSFPTASAIDRV 346

Query: 382 AEIEGFHYEDTLTGFKWLGN--RALELEQEGYYTPFAYEEAIGYMFSSVVHDKDGISAAI 439
           AE  G    +  TG+K+      A +L   G       EE+ G   S+ V +KDG+ A I
Sbjct: 347 AEKHGLKCYEVPTGWKFFCALFDAKKLSICG-------EESFG-TGSNHVREKDGVWAII 398

Query: 440 VFLQ---AYSKWRASGQTVLDILATASL-KYGH--FKEFNGYYIVPDLAITKQVFDAIRS 493
            +L     Y++        + I+      KYG   F  ++  ++  D    K+V D +RS
Sbjct: 399 AWLNLLAIYNRRHPDRDVSIKIIQEEFWKKYGRVFFTRYDYEHV--DSNSAKKVIDNLRS 456

Query: 494 IESPYPKKLGSSF 506
             +  P  +GS F
Sbjct: 457 Y-TEKPGVVGSKF 468

>SAKL0E03630g Chr5 complement(294321..296036) [1716 bp, 571 aa] {ON}
           highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105C PGM2 Phosphoglucomutase catalyzes the
           conversion from glucose-1-phosphate to
           glucose-6-phosphate which is a key step in hexose
           metabolism functions as the acceptor for a
           Glc-phosphotransferase and to YKL127W uniprot|P33401
           Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 571

 Score = 34.7 bits (78), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 77/304 (25%), Positives = 116/304 (38%), Gaps = 65/304 (21%)

Query: 57  GTAGLRGRMEAGFNRMNALTVKQASQGLAKYIKKQFPE---NLTVVVGHDHRHNSRLFGK 113
           GT+GLR + +      N       ++   + +    PE   + T+VVG D     R +  
Sbjct: 19  GTSGLRKKTKVFMEEPNY------TENFIQAVMDAIPEGSQDATLVVGGD----GRFYND 68

Query: 114 VTVDTFLQLGF-KVFHLNHENEKSLVHTPLVPFTVNA---TGASVGIMITASHNP---KM 166
           V V     +G     H     +  ++ TP     +        + GI++TASHNP   K 
Sbjct: 69  VVVQKIAAIGAANGVHKLVIGQNGILSTPAASHIIRTYPHAKITGGIILTASHNPGGAKN 128

Query: 167 DNGYKVYYTNGC--------QIIPPHDKLIAESIIHNLEPFSSPQTGT----------II 208
           D G K   +NG         +I     +L +  I+ N       + GT          II
Sbjct: 129 DFGIKYNLSNGGPAPESVTNKIFEKSKQLTSYKIVANFPQLDLSKKGTDQRYGPLLVDII 188

Query: 209 DCKEKMTKKYIDAIGSTLIDGAVNKKTNEPWFVYTPMHGVGFE-IFESIS-------KQL 260
           D  E   K     +  ++ D  + KK     F+ T    VGF+ +F+S++       K L
Sbjct: 189 DSTEAYVK-----LMKSIFDFDLIKK-----FIKTQKETVGFKLLFDSLNGVTGPYGKAL 238

Query: 261 LSLEEGKDYLVVEE--QKY-PDADFPTVSFPNPEEKGALDLAVEYGRKNDTVDLIIANDP 317
              E G   L  EE  Q Y P  DF  +  P+P    A  L     +  D +    A+D 
Sbjct: 239 FVDELG---LSAEESLQNYVPKPDFGGLH-PDPNLTYAHTLVERVDK--DKIAFGAASDG 292

Query: 318 DADR 321
           D DR
Sbjct: 293 DGDR 296

>TPHA0O00450 Chr15 complement(80090..81247) [1158 bp, 385 aa] {ON}
           Anc_1.484 YJR049C
          Length = 385

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 42/86 (48%), Gaps = 5/86 (5%)

Query: 29  ETRNEILQLCLKGDITELHKRLDTMIAFGTAGLRGRMEAGFNRMNALTVKQASQG----L 84
           +TR+E LQ    G I E+H+ +D +I  G  G      AG  +M A  +   + G    L
Sbjct: 86  KTRHERLQYWSVGSIKEVHENIDLVITLGGDGTV-LFVAGLFQMKAPPIMSFALGSLGFL 144

Query: 85  AKYIKKQFPENLTVVVGHDHRHNSRL 110
             +  + F ++L  V+  ++R N R+
Sbjct: 145 TTFNFENFKKDLKTVLNGENRLNVRM 170

>NCAS0A04350 Chr1 (878688..880397) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 75/188 (39%), Gaps = 35/188 (18%)

Query: 57  GTAGLRGRMEAGFNRMNALTVKQASQGLAKYIKKQFPE---NLTVVVGHDHR-HNSRLFG 112
           GT+GLR +     N  N       ++   + +    PE   + T+VVG D R +N  +  
Sbjct: 19  GTSGLRKKTAIFMNEPNY------TENFIQAMLDAIPEGSQDATLVVGGDGRFYNDVIMN 72

Query: 113 KVTVDTFLQLGFKVFHLNHENEKSLVHTPLVPFTVNATGASV--GIMITASHN---PKMD 167
           K+   +    G K   +    +  L+ TP     + +    V  GI++TASHN   P+ D
Sbjct: 73  KIAAISAAN-GVKKLIIG---QNGLLSTPAASHIIRSYEEKVTGGIILTASHNPGGPEND 128

Query: 168 NGYKVYYTNGC--------QIIPPHDKLIAESIIHNLEPFSSPQTGT-------IIDCKE 212
            G K    NG          I     KL    II N  P    + G        ++D  +
Sbjct: 129 LGIKYNLANGGPAPESVTNAIWEVSKKLTHYKIIKNFPPLDLSKMGKDQKYGPLLVDIID 188

Query: 213 KMTKKYID 220
            +TK Y+D
Sbjct: 189 -VTKDYVD 195

>TPHA0G02900 Chr7 (622303..624012) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 55/129 (42%), Gaps = 17/129 (13%)

Query: 57  GTAGLRGRMEAGFNRMNALTVKQASQGLAKYIKKQFPE---NLTVVVGHDHRHNSRLFGK 113
           GT+GLR + +   N  N       ++   + I    PE   N T+VVG D R  + +  +
Sbjct: 19  GTSGLRKKSKVFMNEPNY------TENFIQAILDAIPEGSENSTLVVGGDGRFYNDVILQ 72

Query: 114 VTVDTFLQLGFKVFHLNHENEKSLVHTPLVPFTVNATGASV--GIMITASHN---PKMDN 168
           +  +     G +   +    +  ++ TP     +      V  GI++TASHN   P+ D 
Sbjct: 73  LIAEIGAANGVRKLIIG---QAGILSTPAASHIIRTYHEEVTGGIILTASHNPGGPENDI 129

Query: 169 GYKVYYTNG 177
           G K    NG
Sbjct: 130 GIKYNLANG 138

>KNAG0K00340 Chr11 (55186..55983) [798 bp, 265 aa] {ON} Anc_5.43
           YGR262C
          Length = 265

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 21/93 (22%), Positives = 42/93 (45%), Gaps = 8/93 (8%)

Query: 347 FLFAYYEWERYKHSPIDEPLAMLNSTVSSQMIKRMAEIEGFHYE-----DTLTGFKWLGN 401
           ++  Y   +RY+H  ID+ L    +   ++++ ++++IEG         D   G  WL  
Sbjct: 50  YIIKYRPHKRYRHPSIDQALTKHRTVGEARLLSKLSQIEGLQVPKLIACDVYNGCLWLEF 109

Query: 402 RALELEQEGYYT---PFAYEEAIGYMFSSVVHD 431
              +L Q   ++    F +  A    +S+VV +
Sbjct: 110 LGQDLPQGAGFSNLKNFLWMHAANDPYSNVVRE 142

>NCAS0F01470 Chr6 complement(293218..294927) [1710 bp, 569 aa] {ON}
           Anc_2.445 YKL127W
          Length = 569

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 99/419 (23%), Positives = 164/419 (39%), Gaps = 67/419 (15%)

Query: 57  GTAGLRGRMEAGFNRMNALTVKQASQGLAKYIKKQFPEN---LTVVVGHDHRHNSRLFGK 113
           GT+GLR + +   +  N       ++   + I    PE     T+VVG D R+ + +   
Sbjct: 19  GTSGLRKKTKIFKDTPNY------TENFIQAIMDAIPEGSKGATLVVGGDGRYYNDVILH 72

Query: 114 VTVDTFLQLGFKVFHLNHENEKSLVHTPLVPFTVNATGASV--GIMITASHNP---KMDN 168
                    G K   +    ++ L+ TP     +         GI++TASHNP   K D 
Sbjct: 73  KIAAIGAANGVKKLVIG---QRGLLSTPAASHIMRTYEEKTQGGIILTASHNPGGIKNDM 129

Query: 169 GYKVYYTNGCQIIPP--------HDKLIAESIIHNLEPFSSPQTGT-------IIDCKEK 213
           G K   +NG     P          K+ +  II +         G        ++D  + 
Sbjct: 130 GIKFNLSNGGPAPEPVTNKIWEISKKMTSFKIIKDFPELELETLGKNKKYGPLLVDVID- 188

Query: 214 MTKKYIDAIGST----LIDGAVNKKTN-EPW-FVYTPMHGVGFEIFESISKQLLSLEEGK 267
            TK Y++ +       LI   V+K+ + + W  ++  M+GV     ++I    L L   +
Sbjct: 189 TTKAYVEFVKQIFDFDLIKKFVHKQRDTKHWKLLFDGMNGVTGPYGKAIFVDELGLPADE 248

Query: 268 DYLVVEEQKYPDADFPTVSFPNPEEKGALDLAVEYGRKNDTVDLIIANDPDADRFSVAVR 327
               V +Q +P  DF  V  P+P    A  L     R+N  ++   A+D D DR  +   
Sbjct: 249 ----VLQQWHPSPDFGGVH-PDPNLTYAKALVDRVDREN--IEFGAASDGDGDRNMI--- 298

Query: 328 DNDQNTTTAWRQLTGNEIGFLFAY-YEWERYKHSPIDEPLAMLNSTVSSQMIKRMAEIEG 386
                   A+    G+ +  +  Y  E   +    I     +  S  +S  I R+A+  G
Sbjct: 299 ---YGAGPAFVS-PGDSVAIIAEYAAEIPYFAKQGI---YGLARSFPTSSAIDRVAKAHG 351

Query: 387 FHYEDTLTGFKWLGN--RALELEQEGYYTPFAYEEAIGYMFSSVVHDKDGISAAIVFLQ 443
            +  +  TG+K+      A +L   G       EE+ G   S+ V +KDGI A + +L 
Sbjct: 352 LNCYEVPTGWKFFCALFDAKKLSICG-------EESFG-TGSNHVREKDGIWAILAWLN 402

>CAGL0F08415g Chr6 complement(840334..841134) [801 bp, 266 aa] {ON}
           highly similar to uniprot|P53323 Saccharomyces
           cerevisiae YGR262c
          Length = 266

 Score = 31.2 bits (69), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 28/58 (48%), Gaps = 5/58 (8%)

Query: 347 FLFAYYEWERYKHSPIDEPLAMLNSTVSSQMIKRMAEIEGFHYE-----DTLTGFKWL 399
           ++  Y   +RY+H  ID+ L    +   ++++ ++  IEG H       D   G+ WL
Sbjct: 49  YIIKYRSPKRYRHPVIDKSLTKHRTLGEARLLSKLYTIEGLHVPKLIACDAYNGYLWL 106

>KLLA0C03300g Chr3 complement(296848..299328) [2481 bp, 826 aa] {ON}
           similar to uniprot|P39531 Saccharomyces cerevisiae
           YJL204C RCY1 ReCYcling 1
          Length = 826

 Score = 31.6 bits (70), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%)

Query: 1   MSETEVIESLPSDLQGKVRNWLKYDKVEETRNEILQLCLKGDITELHKRLD 51
           +S+ ++IESL   ++    +W  Y KVEE  N   +L     I EL  R D
Sbjct: 171 VSQAKIIESLQKYIKSNDNDWSYYKKVEENLNTFKELFTTSIIRELDIRFD 221

>KAFR0D03010 Chr4 (594118..595827) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 31.6 bits (70), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 68/294 (23%), Positives = 118/294 (40%), Gaps = 46/294 (15%)

Query: 57  GTAGLRGRMEAGFNRMNALTVKQASQGLAKYIKKQFPEN---LTVVVGHDHRHNSRLFGK 113
           GT+GLR +     +  N       ++   + I +  PE     T+VVG D R+ + +  +
Sbjct: 19  GTSGLRKKTVIFKDEPNY------TENFIQAIMESIPEGSDGATLVVGGDGRYYNDVILE 72

Query: 114 VTVDTFLQLGFKVFHLNHENEKSLVHTPLVPFTVNATGASV--GIMITASHN---PKMDN 168
                    G K   +    +  L+ TP     + +    V  GI++TASHN   PK D 
Sbjct: 73  KIAKIGAANGVKKLVVG---QNGLLSTPAASHIIRSYHEKVTGGIILTASHNPGGPKNDM 129

Query: 169 GYKVYYTNGC--------QIIPPHDKLIAESIIHNLEPFSSPQTG-------TIIDCKEK 213
           G K    NG         +I     KL +  II +L    + + G        +ID  + 
Sbjct: 130 GIKYNLANGGPAPESVTDKIWENSKKLTSYKIIKDLPTLDTSKIGENQKYGPILIDVID- 188

Query: 214 MTKKYIDAIGST----LIDGAVN--KKTNEPWFVYTPMHGVGFEIFESISKQLLSLEEGK 267
           +TK Y++ +       LI   ++  +KT     ++  ++G+     ++I      L E +
Sbjct: 189 VTKAYVEFLKEIFDFELIKKFIHTQRKTKNWKLLFDGLNGITGPYGKAIFVDEFELPENE 248

Query: 268 DYLVVEEQKYPDADFPTVSFPNPEEKGALDLAVEYGRKNDTVDLIIANDPDADR 321
               V +  +P  DF  +  P+P    A  L     +  + ++   A+D D DR
Sbjct: 249 ----VLQNYHPQPDFGGLH-PDPNLTYARSLVDRVDK--EKIEFGAASDGDGDR 295

>KNAG0A06280 Chr1 (955994..957706) [1713 bp, 570 aa] {ON} 
          Length = 570

 Score = 31.2 bits (69), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 62/132 (46%), Gaps = 23/132 (17%)

Query: 57  GTAGLRGRMEAGFNRMNALTVKQA--SQGLAKYIKKQFPE---NLTVVVGHDHR-HNSRL 110
           GT+GLR        +  A+ +K+   ++   + I +  PE   + T+V+G D R +N  +
Sbjct: 20  GTSGLR--------KKTAVFMKEPHYTENFIQAILEAIPEGCKDATLVIGGDGRFYNDVV 71

Query: 111 FGKVTVDTFLQLGFKVFHLNHENEKSLVHTPLVPFTVNA--TGASVGIMITASHN---PK 165
             K+   +    G +   +    +  L+ TP   + + +    A+ GI++TASHN   P+
Sbjct: 72  INKIAAISAAN-GVRKLVIG---QNGLLSTPATSYIIRSYKDKATGGIILTASHNPGGPE 127

Query: 166 MDNGYKVYYTNG 177
            D G K    NG
Sbjct: 128 NDMGIKYNLANG 139

>Suva_7.335 Chr7 complement(570219..571064) [846 bp, 281 aa] {ON}
           YGR053C (REAL)
          Length = 281

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 32/72 (44%)

Query: 69  FNRMNALTVKQASQGLAKYIKKQFPENLTVVVGHDHRHNSRLFGKVTVDTFLQLGFKVFH 128
            N +N   V +     A+   + F EN  +  G   + ++   GKV   + L  G  +F 
Sbjct: 189 LNSLNQRVVTEYIDNAAEKYVQNFNENGDIKGGKTGKDDTIKKGKVKRLSRLIRGTFIFE 248

Query: 129 LNHENEKSLVHT 140
            N EN K LVHT
Sbjct: 249 FNEENSKILVHT 260

>TPHA0G02470 Chr7 (507445..509154) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 31.2 bits (69), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 55/130 (42%), Gaps = 17/130 (13%)

Query: 57  GTAGLRGRMEAGFNRMNALTVKQASQGLAKYIKKQFPE---NLTVVVGHDHRHNSRLFGK 113
           GT+GLR + +   N  N       ++   + I    PE   + T+VVG D R  + +  +
Sbjct: 19  GTSGLRKKTKIFMNEPNY------TENFIQAILDAIPEGSEDSTLVVGGDGRFYNDVILQ 72

Query: 114 VTVDTFLQLGFKVFHLNHENEKSLVHTPLVPFTVNATGASV--GIMITASHN---PKMDN 168
           +  +     G +   +    +  ++ TP     +      V  GI++TASHN   P+ D 
Sbjct: 73  LIAEIGAANGVRKLIIG---QAGILSTPATSHVIRTYHEEVTGGIILTASHNPGGPENDI 129

Query: 169 GYKVYYTNGC 178
           G K    NG 
Sbjct: 130 GIKYNLANGA 139

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 67,287,799
Number of extensions: 2997719
Number of successful extensions: 7657
Number of sequences better than 10.0: 59
Number of HSP's gapped: 7682
Number of HSP's successfully gapped: 59
Length of query: 607
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 492
Effective length of database: 40,294,809
Effective search space: 19825046028
Effective search space used: 19825046028
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)