Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D01551g8.841ON33133117760.0
SAKL0D01452g8.841ON32732513820.0
Ecym_46128.841ON32632313010.0
KAFR0B00210singletonON32632412881e-179
YPL273W (SAM4)8.841ON32532312821e-178
TPHA0G03760singletonON33132512791e-178
NCAS0D049408.841ON32732512671e-176
Suva_13.515na 1ON32532312621e-175
NDAI0F00250singletonON32932412561e-174
Kwal_27.102558.841ON32932512521e-174
KLTH0C03850g8.841ON32932412421e-172
KNAG0B06970singletonON33231212341e-171
Smik_6.4848.841ON32532312201e-169
TDEL0E05690singletonON32832511841e-163
Suva_16.17singletonON32432311161e-153
TDEL0E00240singletonON32832311031e-151
YLL062C (MHT1)na 2ON32432311001e-151
Suva_64.1singletonON27327110851e-149
Smik_12.1na 2ON32432310901e-149
Skud_12.4na 2ON32532410891e-149
KAFR0F04420singletonON32632410611e-145
ABL125W8.841ON33633010511e-143
KAFR0L00150singletonON32632410271e-140
Suva_16.328.841ON2592499811e-134
TBLA0B032608.841ON3263239051e-121
TPHA0I002608.841ON3233228971e-120
Kpol_1068.78.841ON3233238791e-117
ZYRO0G14212g8.841ON3253158761e-117
Skud_100.1singletonON2002008131e-109
Skud_101.1singletonON2002008131e-109
SAKL0D09306gna 3ON3263346682e-85
KLTH0H12716gna 3ON3483395911e-73
Kwal_0.322na 3ON3323415797e-72
AFR410WsingletonON3703315426e-66
Skud_47.2singletonON96953752e-44
YMR321Cna 1ON1051013701e-43
TPHA0O006301.386ON59458820.099
TPHA0D044601.135ON81251741.2
AAR046C6.335ON54494685.0
CAGL0J03168g7.258ON813121685.4
SAKL0H01980g5.60ON49243677.4
SAKL0H06446g8.680ON30695667.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D01551g
         (331 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D01551g Chr4 complement(137965..138960) [996 bp, 331 aa] {O...   688   0.0  
SAKL0D01452g Chr4 complement(115954..116937) [984 bp, 327 aa] {O...   536   0.0  
Ecym_4612 Chr4 (1193587..1194567) [981 bp, 326 aa] {ON} similar ...   505   0.0  
KAFR0B00210 Chr2 complement(50980..51960) [981 bp, 326 aa] {ON}       500   e-179
YPL273W Chr16 (25087..26064) [978 bp, 325 aa] {ON}  SAM4S-adenos...   498   e-178
TPHA0G03760 Chr7 complement(795934..796929) [996 bp, 331 aa] {ON}     497   e-178
NCAS0D04940 Chr4 (948608..949591) [984 bp, 327 aa] {ON}               492   e-176
Suva_13.515 Chr13 complement(901226..902203) [978 bp, 325 aa] {O...   490   e-175
NDAI0F00250 Chr6 complement(47567..48556) [990 bp, 329 aa] {ON}       488   e-174
Kwal_27.10255 s27 complement(264291..265280) [990 bp, 329 aa] {O...   486   e-174
KLTH0C03850g Chr3 complement(336417..337406) [990 bp, 329 aa] {O...   483   e-172
KNAG0B06970 Chr2 (1387382..1388380) [999 bp, 332 aa] {ON}             479   e-171
Smik_6.484 Chr6 (800680..801657) [978 bp, 325 aa] {ON} YPL273W (...   474   e-169
TDEL0E05690 Chr5 complement(1057559..1058545) [987 bp, 328 aa] {...   460   e-163
Suva_16.17 Chr16 complement(15787..16761) [975 bp, 324 aa] {ON} ...   434   e-153
TDEL0E00240 Chr5 complement(38804..39790) [987 bp, 328 aa] {ON}       429   e-151
YLL062C Chr12 complement(16639..17613) [975 bp, 324 aa] {ON}  MH...   428   e-151
Suva_64.1 Chr64 (76..894) [819 bp, 273 aa] {ON} YPL273W (REAL)        422   e-149
Smik_12.1 Chr12 complement(885..1859) [975 bp, 324 aa] {ON} YLL0...   424   e-149
Skud_12.4 Chr12 complement(4676..5653) [978 bp, 325 aa] {ON} YLL...   424   e-149
KAFR0F04420 Chr6 (867176..868156) [981 bp, 326 aa] {ON}               413   e-145
ABL125W Chr2 (161358..162368) [1011 bp, 336 aa] {ON} Non-synteni...   409   e-143
KAFR0L00150 Chr12 complement(16662..17642) [981 bp, 326 aa] {ON}      400   e-140
Suva_16.32 Chr16 (40969..41748) [780 bp, 259 aa] {ON} YPL273W (R...   382   e-134
TBLA0B03260 Chr2 (760392..761372) [981 bp, 326 aa] {ON} Anc_8.84...   353   e-121
TPHA0I00260 Chr9 (49179..50150) [972 bp, 323 aa] {ON} Anc_8.841 ...   350   e-120
Kpol_1068.7 s1068 complement(11996..12967) [972 bp, 323 aa] {ON}...   343   e-117
ZYRO0G14212g Chr7 (1133202..1134179) [978 bp, 325 aa] {ON} simil...   342   e-117
Skud_100.1 Chr100 complement(3..602) [600 bp, 200 aa] {ON} YPL27...   317   e-109
Skud_101.1 Chr101 complement(3..602) [600 bp, 200 aa] {ON} YPL27...   317   e-109
SAKL0D09306g Chr4 (771565..772545) [981 bp, 326 aa] {ON} similar...   261   2e-85
KLTH0H12716g Chr8 (1079836..1080882) [1047 bp, 348 aa] {ON} simi...   232   1e-73
Kwal_0.322 s0 (152442..153440) [999 bp, 332 aa] {ON} YLL062C (MH...   227   7e-72
AFR410W Chr6 (1171334..1172446) [1113 bp, 370 aa] {ON} Non-synte...   213   6e-66
Skud_47.2 Chr47 (1368..1655) [288 bp, 96 aa] {ON} YPL273W (REAL)      149   2e-44
YMR321C Chr13 complement(917579..917896) [318 bp, 105 aa] {ON} P...   147   1e-43
TPHA0O00630 Chr15 complement(115953..117737) [1785 bp, 594 aa] {...    36   0.099
TPHA0D04460 Chr4 complement(964925..967363) [2439 bp, 812 aa] {O...    33   1.2  
AAR046C Chr1 complement(422667..424301) [1635 bp, 544 aa] {ON} S...    31   5.0  
CAGL0J03168g Chr10 (306171..308612) [2442 bp, 813 aa] {ON} simil...    31   5.4  
SAKL0H01980g Chr8 complement(195237..196715) [1479 bp, 492 aa] {...    30   7.4  
SAKL0H06446g Chr8 (568689..569609) [921 bp, 306 aa] {ON} similar...    30   7.7  

>KLLA0D01551g Chr4 complement(137965..138960) [996 bp, 331 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase,
          Length = 331

 Score =  688 bits (1776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/331 (100%), Positives = 331/331 (100%)

Query: 1   MRVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSDASKDRII 60
           MRVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSDASKDRII
Sbjct: 1   MRVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSDASKDRII 60

Query: 61  VKQMFEDFIEAGADILMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGEDRY 120
           VKQMFEDFIEAGADILMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGEDRY
Sbjct: 61  VKQMFEDFIEAGADILMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGEDRY 120

Query: 121 LIGCIGAWGAHVCSEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIHEL 180
           LIGCIGAWGAHVCSEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIHEL
Sbjct: 121 LIGCIGAWGAHVCSEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIHEL 180

Query: 181 RAILSWDETVLSKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINCCA 240
           RAILSWDETVLSKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINCCA
Sbjct: 181 RAILSWDETVLSKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINCCA 240

Query: 241 FNQSHMILESLHNSCPNMPLIVYPNSGEIYDTVKKIWLKNENQLCTWDDVVKSYIENGAR 300
           FNQSHMILESLHNSCPNMPLIVYPNSGEIYDTVKKIWLKNENQLCTWDDVVKSYIENGAR
Sbjct: 241 FNQSHMILESLHNSCPNMPLIVYPNSGEIYDTVKKIWLKNENQLCTWDDVVKSYIENGAR 300

Query: 301 IIGGCCRTTVDDIKEVRLAVNKYAKQTTSSL 331
           IIGGCCRTTVDDIKEVRLAVNKYAKQTTSSL
Sbjct: 301 IIGGCCRTTVDDIKEVRLAVNKYAKQTTSSL 331

>SAKL0D01452g Chr4 complement(115954..116937) [984 bp, 327 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 327

 Score =  536 bits (1382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 244/325 (75%), Positives = 289/325 (88%)

Query: 2   RVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSDASKDRIIV 61
           R PIK++F+E+PD +LVMDGGQGTELENRGI VANPVWST+PFI+ESFWS+++S+DR IV
Sbjct: 3   RQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWSNESSRDRQIV 62

Query: 62  KQMFEDFIEAGADILMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGEDRYL 121
           K+MF+DFI+ G+ ILMT TYQTSFKSVSENTPI+TL+EYN LL+RIV+FSR CIGED+YL
Sbjct: 63  KEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGEDKYL 122

Query: 122 IGCIGAWGAHVCSEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIHELR 181
           IGCIGAWGAHVC EFTGDYG +P++ID+ EYFRPQL NF  S+ ID+IGFETIPN+HEL+
Sbjct: 123 IGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNVHELK 182

Query: 182 AILSWDETVLSKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINCCAF 241
           AILSWDE+++SKPFYIGLSVHE GVLRDGT+M+++AD+I SLGDKLN NLM +GINC +F
Sbjct: 183 AILSWDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGINCVSF 242

Query: 242 NQSHMILESLHNSCPNMPLIVYPNSGEIYDTVKKIWLKNENQLCTWDDVVKSYIENGARI 301
           N SH+IL SLH   P+MP+IVYPNSGEIYDTVKKIWL NENQ  TWDDVVKSYIENGARI
Sbjct: 243 NHSHLILSSLHKELPDMPMIVYPNSGEIYDTVKKIWLHNENQKVTWDDVVKSYIENGARI 302

Query: 302 IGGCCRTTVDDIKEVRLAVNKYAKQ 326
           IGGCCRT+  DIK++  A+ KY  Q
Sbjct: 303 IGGCCRTSPQDIKDIVQAIEKYKSQ 327

>Ecym_4612 Chr4 (1193587..1194567) [981 bp, 326 aa] {ON} similar to
           Ashbya gossypii ABL125W
          Length = 326

 Score =  505 bits (1301), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 226/323 (69%), Positives = 276/323 (85%)

Query: 1   MRVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSDASKDRII 60
           +R  +K+  + NPD +L+MDGGQGTELENRGINVANPVWST+PFIN+SFWS  +S+DR I
Sbjct: 2   VRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINDSFWSDRSSRDRQI 61

Query: 61  VKQMFEDFIEAGADILMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGEDRY 120
           V  MFE++I AGA++LMTITYQ+SFKSVSENT I+TLEEYN LLDRIV+FSR+CIG D Y
Sbjct: 62  VAGMFEEYIAAGANLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGADNY 121

Query: 121 LIGCIGAWGAHVCSEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIHEL 180
           L+GCIG+WGAH+C+EF+GDYG HP++I Y +YFRPQL NF   +DID+IGFETIPNIHEL
Sbjct: 122 LVGCIGSWGAHICAEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNIHEL 181

Query: 181 RAILSWDETVLSKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINCCA 240
            AILSWDE+++ KPFYIG+SVHE+G LRDGT+M Q+A L  SLG KLN N + +GINCC+
Sbjct: 182 TAILSWDESIIKKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGINCCS 241

Query: 241 FNQSHMILESLHNSCPNMPLIVYPNSGEIYDTVKKIWLKNENQLCTWDDVVKSYIENGAR 300
           F  SHMILESLH   P +PLI YPNSGE+YDTVKKIWLKNEN + TWD++VKSY+++GAR
Sbjct: 242 FRYSHMILESLHEELPYIPLIAYPNSGELYDTVKKIWLKNENCIVTWDEIVKSYLQSGAR 301

Query: 301 IIGGCCRTTVDDIKEVRLAVNKY 323
           IIGGCCRTT +DI+++  AV KY
Sbjct: 302 IIGGCCRTTPNDIRQIVTAVKKY 324

>KAFR0B00210 Chr2 complement(50980..51960) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  500 bits (1288), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 233/324 (71%), Positives = 274/324 (84%)

Query: 2   RVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSDASKDRIIV 61
           R PIK+Y EENP  VLV+DGGQGTELENRGI+VANPVWST+PFI+ESFWS+ +SKDR IV
Sbjct: 3   RQPIKEYLEENPKKVLVLDGGQGTELENRGIHVANPVWSTIPFISESFWSNASSKDREIV 62

Query: 62  KQMFEDFIEAGADILMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGEDRYL 121
           K MF+DF++AGADILMTITYQTSFKSV+ENTPI+TL+EYN LL+RIVSFSRSCIG+++YL
Sbjct: 63  KGMFQDFLDAGADILMTITYQTSFKSVTENTPIKTLKEYNELLERIVSFSRSCIGDEKYL 122

Query: 122 IGCIGAWGAHVCSEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIHELR 181
           IGCIG WGAHVC+EF GDYG HP+ IDY+ YF+PQL NF Q+KD+D+IGFET+PN HEL+
Sbjct: 123 IGCIGPWGAHVCAEFNGDYGGHPENIDYYAYFKPQLDNFFQNKDLDLIGFETVPNFHELK 182

Query: 182 AILSWDETVLSKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINCCAF 241
           AILSWD+T+LSKPFYIGLSVHE GVLRDGT+M +I   I SLG K+N N + +GINC +F
Sbjct: 183 AILSWDDTILSKPFYIGLSVHENGVLRDGTTMNEIGYYIKSLGSKINPNFLLLGINCVSF 242

Query: 242 NQSHMILESLHNSCPNMPLIVYPNSGEIYDTVKKIWLKNENQLCTWDDVVKSYIENGARI 301
           + S  ILES+H   P+MPLI YPNSGEIYDTVKKIWL N     TW+DVV  YI+ GARI
Sbjct: 243 SDSPDILESIHKELPDMPLIAYPNSGEIYDTVKKIWLPNHYSDITWNDVVNRYIKAGARI 302

Query: 302 IGGCCRTTVDDIKEVRLAVNKYAK 325
           IGGCCRT  DDI++V  AV K  K
Sbjct: 303 IGGCCRTMPDDIEQVSAAVKKSHK 326

>YPL273W Chr16 (25087..26064) [978 bp, 325 aa] {ON}
           SAM4S-adenosylmethionine-homocysteine methyltransferase,
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 325

 Score =  498 bits (1282), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 224/323 (69%), Positives = 274/323 (84%)

Query: 2   RVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSDASKDRIIV 61
           R+P+K++  +NP  VLV+DGGQGTELENRGI VANPVWST+PFI+ESFWS ++S +R IV
Sbjct: 3   RLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRKIV 62

Query: 62  KQMFEDFIEAGADILMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGEDRYL 121
           K+MF DF+ AGA+ILMT TYQTS+KSVSENTPIRTL EYN LL+RIV FSR+CIGED+YL
Sbjct: 63  KEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGEDKYL 122

Query: 122 IGCIGAWGAHVCSEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIHELR 181
           IGCIG WGAH+C EFTGDYG  P+ ID+++YF+PQL NF ++  +D+IGFETIPNIHEL+
Sbjct: 123 IGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNIHELK 182

Query: 182 AILSWDETVLSKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINCCAF 241
           AILSWDE++LS+PFYIGLSVHE+GVLRDGT+M++IA +I  LGDK+N N  F+GINC +F
Sbjct: 183 AILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGINCVSF 242

Query: 242 NQSHMILESLHNSCPNMPLIVYPNSGEIYDTVKKIWLKNENQLCTWDDVVKSYIENGARI 301
           NQS  ILESLH + PNM L+ YPNSGE+YDT KKIWL N ++L +WD VVK YI +GARI
Sbjct: 243 NQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYISSGARI 302

Query: 302 IGGCCRTTVDDIKEVRLAVNKYA 324
           IGGCCRT+  DI+E+  AV KY 
Sbjct: 303 IGGCCRTSPKDIQEISAAVKKYT 325

>TPHA0G03760 Chr7 complement(795934..796929) [996 bp, 331 aa] {ON} 
          Length = 331

 Score =  497 bits (1279), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 226/325 (69%), Positives = 272/325 (83%)

Query: 2   RVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSDASKDRIIV 61
           R  IK Y +ENP+ VLVMDGGQGTELENRGI VANPVWST+PFI+ESFWS  +S+DR IV
Sbjct: 3   RQCIKNYLQENPNKVLVMDGGQGTELENRGIKVANPVWSTIPFISESFWSDQSSEDRKIV 62

Query: 62  KQMFEDFIEAGADILMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGEDRYL 121
           K+MF DFI AGA+ILMT TYQTSFKSVSENTPI+  + YN LL+RI+ FSR CIGE+RYL
Sbjct: 63  KEMFNDFINAGAEILMTTTYQTSFKSVSENTPIKNTKHYNELLNRIIDFSRDCIGEERYL 122

Query: 122 IGCIGAWGAHVCSEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIHELR 181
           IGCIG+WGAH+C+EF GDYG HP+ ID++EYF+PQL NF  +  +D+IGFET+PNIHEL+
Sbjct: 123 IGCIGSWGAHICAEFHGDYGEHPENIDFYEYFKPQLDNFFNNNKLDLIGFETVPNIHELK 182

Query: 182 AILSWDETVLSKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINCCAF 241
           AILSWDE +LSKPFYIGLSVHE G+LRDGTSMQ++A+LI   G+KLN NL  +GINC ++
Sbjct: 183 AILSWDEKILSKPFYIGLSVHENGLLRDGTSMQEVANLIKGFGEKLNPNLTLLGINCVSY 242

Query: 242 NQSHMILESLHNSCPNMPLIVYPNSGEIYDTVKKIWLKNENQLCTWDDVVKSYIENGARI 301
           N S+ I++S+H   PN+PLI YPNSGEIYDT KKIWL N+N + TWDD+VK YIE G RI
Sbjct: 243 NHSNDIIKSIHKELPNLPLIAYPNSGEIYDTTKKIWLPNKNPIFTWDDIVKGYIEAGVRI 302

Query: 302 IGGCCRTTVDDIKEVRLAVNKYAKQ 326
           IGGCCRTT +DIK V +AV + AK+
Sbjct: 303 IGGCCRTTPNDIKAVTIAVKERAKK 327

>NCAS0D04940 Chr4 (948608..949591) [984 bp, 327 aa] {ON} 
          Length = 327

 Score =  492 bits (1267), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 225/325 (69%), Positives = 274/325 (84%), Gaps = 1/325 (0%)

Query: 2   RVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSDASKDRIIV 61
           R  IK+Y ++NPD VLV+DGGQGTELENRGINVANPVWST+PF++ESFWS  +S DR IV
Sbjct: 3   RQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWSDKSSNDRQIV 62

Query: 62  KQMFEDFIEAGADILMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGEDRYL 121
           K+MFEDF+ AGA+ILMT TYQTSFKSVSENT I+TL+EYN LL+RIVSFSR CIGE +YL
Sbjct: 63  KEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGEQKYL 122

Query: 122 IGCIGAWGAHVCSEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIHELR 181
           IGCIG WGAHVC+EF GDYG HP+ IDY++YF+PQL NF  ++++D+IGFET+PN++EL+
Sbjct: 123 IGCIGPWGAHVCAEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNVNELK 182

Query: 182 AILSWDETVLSKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINCCAF 241
           AILSWDE +LSKPFYIGLSVHE GVLRDGT+M++I ++  SLG+K+N NL+ +GINC +F
Sbjct: 183 AILSWDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGINCVSF 242

Query: 242 NQSHMILESLHNSCPNMPLIVYPNSGEIYDTVKKIWL-KNENQLCTWDDVVKSYIENGAR 300
           N S  ILE +H + P+MPLI YPNSGE+YDTVKKIWL +N     TW+ VVK YIE GAR
Sbjct: 243 NHSPSILEDIHKNLPDMPLIAYPNSGEVYDTVKKIWLPQNSENSLTWEQVVKRYIEAGAR 302

Query: 301 IIGGCCRTTVDDIKEVRLAVNKYAK 325
           IIGGCCRTT  DI E+  AV K++K
Sbjct: 303 IIGGCCRTTPKDILEISKAVKKFSK 327

>Suva_13.515 Chr13 complement(901226..902203) [978 bp, 325 aa] {ON}
           YPL273W (REAL)
          Length = 325

 Score =  490 bits (1262), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 221/323 (68%), Positives = 273/323 (84%)

Query: 2   RVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSDASKDRIIV 61
           R+P+K+   ++P  VLV+DGGQGTELENRGI VANPVWST+PFI+ESFWS ++S +R IV
Sbjct: 3   RIPLKQLLADDPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRKIV 62

Query: 62  KQMFEDFIEAGADILMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGEDRYL 121
           K+MF DF+ AGA+ILMTITYQTSFKSVSENTPI+TL  Y+ LL RIV FSR CIGE+++L
Sbjct: 63  KEMFNDFLAAGAEILMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHL 122

Query: 122 IGCIGAWGAHVCSEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIHELR 181
           IGCIG WGAHVC EFTG+YGP+P+ ID+++YF+PQL NF ++  +D++GFETIPNIHEL+
Sbjct: 123 IGCIGPWGAHVCCEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELK 182

Query: 182 AILSWDETVLSKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINCCAF 241
           AILSWDE++LSKPFYIGLSVHE+GVLRDGT+M+ +A +I  LGDK+N N + +GINC +F
Sbjct: 183 AILSWDESILSKPFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSF 242

Query: 242 NQSHMILESLHNSCPNMPLIVYPNSGEIYDTVKKIWLKNENQLCTWDDVVKSYIENGARI 301
           NQS  ILESLH + PNMPL+ YPNSGE+YDT KKIW+ N ++L +WD VVK YI +GARI
Sbjct: 243 NQSPDILESLHRALPNMPLLAYPNSGEVYDTEKKIWMPNSDKLNSWDTVVKQYIGSGARI 302

Query: 302 IGGCCRTTVDDIKEVRLAVNKYA 324
           IGGCCRTT  DI+EV  AV KY 
Sbjct: 303 IGGCCRTTPKDIQEVSAAVKKYT 325

>NDAI0F00250 Chr6 complement(47567..48556) [990 bp, 329 aa] {ON} 
          Length = 329

 Score =  488 bits (1256), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 225/324 (69%), Positives = 276/324 (85%), Gaps = 1/324 (0%)

Query: 2   RVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSDASKDRIIV 61
           R PIK Y  ENP  +L++DGGQGTELENRGINVANPVWST+PF+N+SFWS  +SKDR IV
Sbjct: 3   RQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWSGQSSKDREIV 62

Query: 62  KQMFEDFIEAGADILMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGEDRYL 121
           KQMF DF+EAGA+ILMT TYQTSFKSVSENT I+TL+EY+ LL RIV+FSR CIGE++YL
Sbjct: 63  KQMFNDFLEAGAEILMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGENKYL 122

Query: 122 IGCIGAWGAHVCSEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIHELR 181
           IGCIG WGAH+CSEFTG+YG HP+ IDY+EYF+PQL NFVQ+ D+DIIGFETIPN++EL+
Sbjct: 123 IGCIGPWGAHICSEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNVYELK 182

Query: 182 AILSWDETVLSKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINCCAF 241
            ILSW   +L KPFYIGLSVHE GVLRDGT+M Q+AD+I+SL DKLN NL+ +GINC + 
Sbjct: 183 TILSWGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGINCVSL 242

Query: 242 NQSHMILESLHNSCPNMPLIVYPNSGEIYDTVKKIWL-KNENQLCTWDDVVKSYIENGAR 300
             S  IL+S+H++ P++PLIVYPNSGE+YDTVKKIWL  N+    +WD+VV+ Y++ GAR
Sbjct: 243 AHSPDILDSIHSNLPDLPLIVYPNSGEVYDTVKKIWLPPNDETYMSWDEVVERYLKAGAR 302

Query: 301 IIGGCCRTTVDDIKEVRLAVNKYA 324
           IIGGCCRTT +DIK++  AV+KY+
Sbjct: 303 IIGGCCRTTPNDIKQISDAVHKYS 326

>Kwal_27.10255 s27 complement(264291..265280) [990 bp, 329 aa] {ON}
           YPL273W (SAM4) - S-adenosylmethionine:homocysteine
           S-methyltransferase [contig 37] FULL
          Length = 329

 Score =  486 bits (1252), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 219/325 (67%), Positives = 274/325 (84%), Gaps = 2/325 (0%)

Query: 1   MRVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSD--ASKDR 58
           +R  IK++ E+NP  VLV+DGGQGTELENRGI VANPVWST+PFI+ESFWS++  +SKDR
Sbjct: 2   VRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKDR 61

Query: 59  IIVKQMFEDFIEAGADILMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGED 118
            IVK+M+ DF++AGA +LMT+TYQ SFKSVSENT I+TLEEY+ LL+RIV+FSR CIG+D
Sbjct: 62  QIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGDD 121

Query: 119 RYLIGCIGAWGAHVCSEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIH 178
           ++L+GCIGAWGAH CSEFTGDYG  P++ID+ +YF+PQL NF  +++ID+IGFETIPNIH
Sbjct: 122 KFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNIH 181

Query: 179 ELRAILSWDETVLSKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINC 238
           ELRAILSWDE++++KPFYIGLSVHE G+LRDGT+M Q+A+LI S GD+LN N   +GINC
Sbjct: 182 ELRAILSWDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGINC 241

Query: 239 CAFNQSHMILESLHNSCPNMPLIVYPNSGEIYDTVKKIWLKNENQLCTWDDVVKSYIENG 298
            ++NQSH IL SLH   P MPLI YPNSGE+YDTVKKIW    +Q  +W+ +VKSYI++G
Sbjct: 242 VSYNQSHDILRSLHEELPEMPLIAYPNSGEVYDTVKKIWNPKNSQTLSWEQIVKSYIDSG 301

Query: 299 ARIIGGCCRTTVDDIKEVRLAVNKY 323
           ARIIGGCCRT+  DI+ +  AV KY
Sbjct: 302 ARIIGGCCRTSPKDIEAIHEAVQKY 326

>KLTH0C03850g Chr3 complement(336417..337406) [990 bp, 329 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 329

 Score =  483 bits (1242), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 221/324 (68%), Positives = 268/324 (82%), Gaps = 2/324 (0%)

Query: 2   RVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSD--ASKDRI 59
           R  +K+Y   NP+ VLV+DGGQGTELENRGI VANPVWST+PFI++SFW+++  +SKDR 
Sbjct: 3   RPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKDRQ 62

Query: 60  IVKQMFEDFIEAGADILMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGEDR 119
           IVK+M+EDF++AGA +LMT+TYQ SFKSVSENT I TLEEY+ LL RIVSFSRSCIG+D+
Sbjct: 63  IVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGDDK 122

Query: 120 YLIGCIGAWGAHVCSEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIHE 179
           +L+GCIG WGAH CSEFTGDYG  P++IDY +YF+PQL NF  + D+D+IGFETIPNIHE
Sbjct: 123 WLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNIHE 182

Query: 180 LRAILSWDETVLSKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINCC 239
           LRAILSWD T+L KPFYIGLSVHE+GVLRDGT+M ++A+LI SLGDK+N N + +GINC 
Sbjct: 183 LRAILSWDTTILPKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGINCV 242

Query: 240 AFNQSHMILESLHNSCPNMPLIVYPNSGEIYDTVKKIWLKNENQLCTWDDVVKSYIENGA 299
           ++N S  IL SLH   P +PLI YPNSGE+YDTVKKIW    +   TWD VVKSYI++GA
Sbjct: 243 SYNHSPEILRSLHQEIPELPLIAYPNSGEVYDTVKKIWNPKGDHTLTWDQVVKSYIDSGA 302

Query: 300 RIIGGCCRTTVDDIKEVRLAVNKY 323
           RIIGGCCRT+  DI  +  AVNKY
Sbjct: 303 RIIGGCCRTSPKDIAAINAAVNKY 326

>KNAG0B06970 Chr2 (1387382..1388380) [999 bp, 332 aa] {ON} 
          Length = 332

 Score =  479 bits (1234), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 220/312 (70%), Positives = 262/312 (83%)

Query: 2   RVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSDASKDRIIV 61
           R PI++Y + NP  VLV+DGGQGTELENRGINVANPVWSTVPFI+ SFWS+ +SKDR+IV
Sbjct: 3   RQPIQEYLKVNPRKVLVLDGGQGTELENRGINVANPVWSTVPFIDSSFWSNKSSKDRVIV 62

Query: 62  KQMFEDFIEAGADILMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGEDRYL 121
           K MF+ F++AGA+ILMT TYQTSFKSVSENTPI+ LEEY+ LLDRIV FSR CIG D+YL
Sbjct: 63  KGMFDAFLDAGAEILMTTTYQTSFKSVSENTPIQNLEEYSSLLDRIVQFSRDCIGPDKYL 122

Query: 122 IGCIGAWGAHVCSEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIHELR 181
           IGCIG WGAHVC+EF GDYGP+P +IDY  YF+PQL NF  + ++D+IGFETIPNIHELR
Sbjct: 123 IGCIGPWGAHVCAEFNGDYGPNPAEIDYLSYFKPQLDNFFHNDNLDLIGFETIPNIHELR 182

Query: 182 AILSWDETVLSKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINCCAF 241
           AILSWDET+LSKPFYIGLSVH  G+LRDG++M+ +ADLI S G KLN NL  +GINC +F
Sbjct: 183 AILSWDETILSKPFYIGLSVHNNGLLRDGSTMKDVADLIKSFGGKLNKNLTLLGINCVSF 242

Query: 242 NQSHMILESLHNSCPNMPLIVYPNSGEIYDTVKKIWLKNENQLCTWDDVVKSYIENGARI 301
           + S  ILES+H   P+MPLI YPNSGE+YDTVKKIWL N + + TW++VV  YI+ GARI
Sbjct: 243 SDSPDILESIHKELPDMPLIAYPNSGEVYDTVKKIWLPNRDMVMTWEEVVDRYIKAGARI 302

Query: 302 IGGCCRTTVDDI 313
           +GGCCRT+  DI
Sbjct: 303 VGGCCRTSPKDI 314

>Smik_6.484 Chr6 (800680..801657) [978 bp, 325 aa] {ON} YPL273W
           (REAL)
          Length = 325

 Score =  474 bits (1220), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 223/323 (69%), Positives = 272/323 (84%)

Query: 2   RVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSDASKDRIIV 61
           R+P+K+   +NP  VLV+DGGQGTELENRGI VANPVWST+PFI+ESFWS ++S  R IV
Sbjct: 3   RLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSSSRKIV 62

Query: 62  KQMFEDFIEAGADILMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGEDRYL 121
           K+MF DF++AGA+ILMT TYQTS+KSVSENTPI+TL EYN LL RIV FSR CIGED+YL
Sbjct: 63  KEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGEDKYL 122

Query: 122 IGCIGAWGAHVCSEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIHELR 181
           IGCIG WGAH+C EFTGDYG +P+ ID+++YF+PQL NF ++ ++D+IGFETIPNIHEL+
Sbjct: 123 IGCIGPWGAHICREFTGDYGANPESIDFYQYFKPQLDNFNKNDNLDLIGFETIPNIHELK 182

Query: 182 AILSWDETVLSKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINCCAF 241
           AILSWDE+VLSKPFYIGLSVHE+GVLRDGT+MQ++A +I  LGDK+N N   +GINC +F
Sbjct: 183 AILSWDESVLSKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGINCVSF 242

Query: 242 NQSHMILESLHNSCPNMPLIVYPNSGEIYDTVKKIWLKNENQLCTWDDVVKSYIENGARI 301
           NQS  ILESLH + P+M L+ YPNSGE+YDT KKIWL N ++L +WD VVK YI +GARI
Sbjct: 243 NQSPDILESLHQALPDMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDAVVKRYISSGARI 302

Query: 302 IGGCCRTTVDDIKEVRLAVNKYA 324
           IGGCCRT+  DI+E+  AV KY 
Sbjct: 303 IGGCCRTSPKDIQEIFTAVKKYT 325

>TDEL0E05690 Chr5 complement(1057559..1058545) [987 bp, 328 aa] {ON}
           
          Length = 328

 Score =  460 bits (1184), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 208/325 (64%), Positives = 268/325 (82%), Gaps = 1/325 (0%)

Query: 1   MRVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSDASKDRII 60
           +R+PIKK   E+ ++ LV+DGGQGTELENRGI VANPVWST+PF++ESFW+  +SK+R I
Sbjct: 2   VRIPIKKLVIESKEI-LVLDGGQGTELENRGIEVANPVWSTIPFLSESFWTDSSSKERKI 60

Query: 61  VKQMFEDFIEAGADILMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGEDRY 120
           V+ +F+DF ++G++ILMTITYQTSF S+ ENT  +TL EYN LLDRIV FSRSCIG++RY
Sbjct: 61  VESVFDDFKKSGSNILMTITYQTSFTSIVENTQFKTLAEYNTLLDRIVKFSRSCIGDERY 120

Query: 121 LIGCIGAWGAHVCSEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIHEL 180
           LIG +G WGAHVC EFTG+YG HP+ IDY+EYF+PQL NF    +ID+IGFET+PN HEL
Sbjct: 121 LIGSVGPWGAHVCCEFTGNYGLHPESIDYYEYFKPQLDNFNGQDEIDLIGFETVPNFHEL 180

Query: 181 RAILSWDETVLSKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINCCA 240
           +AILSWDET ++KPFYIGLSVH  GVLRDGT+M++I + I  LG+K++SN + +G+NC +
Sbjct: 181 KAILSWDETKIAKPFYIGLSVHNNGVLRDGTTMEEIGEYIKGLGEKISSNFLLLGVNCVS 240

Query: 241 FNQSHMILESLHNSCPNMPLIVYPNSGEIYDTVKKIWLKNENQLCTWDDVVKSYIENGAR 300
           FN S  +++S+H + P+MPL+ YPNSGE+YDT KKIW  N+++L +WD VV+SYI+NGAR
Sbjct: 241 FNDSSDMVKSIHKALPDMPLLAYPNSGEVYDTEKKIWFDNKDKLDSWDSVVRSYIDNGAR 300

Query: 301 IIGGCCRTTVDDIKEVRLAVNKYAK 325
           IIGGCCRT+  DI EV  AV KY K
Sbjct: 301 IIGGCCRTSPRDIAEVSAAVKKYNK 325

>Suva_16.17 Chr16 complement(15787..16761) [975 bp, 324 aa] {ON}
           YLL062C (REAL)
          Length = 324

 Score =  434 bits (1116), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 190/323 (58%), Positives = 258/323 (79%), Gaps = 1/323 (0%)

Query: 2   RVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSDASKDRIIV 61
           R+ I+K   E+P  VLV+DGGQGTELENRGI++ +PVWS  PFI++SFW S +S DR +V
Sbjct: 3   RIAIEKLILEHPQKVLVLDGGQGTELENRGIDINSPVWSAAPFISDSFWESTSS-DRTLV 61

Query: 62  KQMFEDFIEAGADILMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGEDRYL 121
           ++M+ DF++AGA++LMT+TYQ +F S+SENT I+TL +YN  LDR+VSF+R  IGEDRYL
Sbjct: 62  EEMYRDFMDAGANVLMTVTYQANFSSISENTSIKTLSDYNRFLDRVVSFTRRVIGEDRYL 121

Query: 122 IGCIGAWGAHVCSEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIHELR 181
           IG IG W AHV SE+TGDYG HP+ IDY ++F+ QL NF +  +ID+IGFET+PN HEL+
Sbjct: 122 IGSIGPWAAHVSSEYTGDYGSHPEDIDYLQHFKAQLDNFNKHTEIDLIGFETVPNFHELK 181

Query: 182 AILSWDETVLSKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINCCAF 241
           AILSWDE ++SKPFY+GLSVH+ G+LRDGT+M++IA  + SLG K+N + + +G+NC +F
Sbjct: 182 AILSWDENIISKPFYVGLSVHDNGLLRDGTTMEEIAAYVKSLGRKINRHFLLLGVNCISF 241

Query: 242 NQSHMILESLHNSCPNMPLIVYPNSGEIYDTVKKIWLKNENQLCTWDDVVKSYIENGARI 301
           NQS  IL+SLH + P+MPL+ YPNSGE+YDT  K W + + +  +W+ VV+ +I+NGARI
Sbjct: 242 NQSTSILKSLHQALPDMPLLAYPNSGEVYDTKTKTWHQAKGKQNSWEVVVEEFIDNGARI 301

Query: 302 IGGCCRTTVDDIKEVRLAVNKYA 324
           IGGCCRT+  DI E+  AV+K++
Sbjct: 302 IGGCCRTSAKDISEIASAVDKHS 324

>TDEL0E00240 Chr5 complement(38804..39790) [987 bp, 328 aa] {ON} 
          Length = 328

 Score =  429 bits (1103), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 189/323 (58%), Positives = 257/323 (79%), Gaps = 1/323 (0%)

Query: 2   RVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSDASKDRIIV 61
           RVP++K   ++  + LV+DGGQGTE+ENRGI VANPVWS++PF++ESFW+ + SK+R IV
Sbjct: 3   RVPLRKVLTDSRKI-LVLDGGQGTEMENRGIEVANPVWSSIPFVSESFWTDEWSKERKIV 61

Query: 62  KQMFEDFIEAGADILMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGEDRYL 121
           +++++DF+ +G+D+LMT+TYQ SFK+++ENT ++TL EYN LLDRIV+FSR CIG++RYL
Sbjct: 62  EEIYKDFMSSGSDMLMTVTYQASFKAIAENTELQTLSEYNSLLDRIVAFSRRCIGDERYL 121

Query: 122 IGCIGAWGAHVCSEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIHELR 181
           +G +G W A+  SE+TGDYG H D IDY+ Y++PQL NF + ++ID+IG ET+PN HEL+
Sbjct: 122 VGSVGPWAAYNASEYTGDYGLHADSIDYYGYYKPQLDNFNKQEEIDMIGIETVPNFHELK 181

Query: 182 AILSWDETVLSKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINCCAF 241
           AILSWDE  ++KPFY+ L+ H+ GVLRDGT+M+ IA  I  LG+ LN N M +GINC +F
Sbjct: 182 AILSWDEKKIAKPFYVSLTTHDSGVLRDGTAMEDIAQYIKCLGNNLNPNFMLLGINCVSF 241

Query: 242 NQSHMILESLHNSCPNMPLIVYPNSGEIYDTVKKIWLKNENQLCTWDDVVKSYIENGARI 301
           N S  ILE LHN+ P M L+ YPNSGE+Y+  KKIWL N+ +  +WD VVKS+I +GARI
Sbjct: 242 NDSRDILELLHNALPEMLLLAYPNSGEVYEPKKKIWLANKCKTTSWDSVVKSFINSGARI 301

Query: 302 IGGCCRTTVDDIKEVRLAVNKYA 324
           IGGCCRT+  DI +V +AV KY+
Sbjct: 302 IGGCCRTSPQDIADVSIAVKKYS 324

>YLL062C Chr12 complement(16639..17613) [975 bp, 324 aa] {ON}
           MHT1S-methylmethionine-homocysteine methyltransferase,
           functions along with Sam4p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 324

 Score =  428 bits (1100), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 193/323 (59%), Positives = 256/323 (79%), Gaps = 1/323 (0%)

Query: 2   RVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSDASKDRIIV 61
           R+PIK+   E+P  VL++DGGQGTELENRGIN+ +PVWS  PF +ESFW   +S++R +V
Sbjct: 3   RIPIKELIVEHPGKVLILDGGQGTELENRGININSPVWSAAPFTSESFWEP-SSQERKVV 61

Query: 62  KQMFEDFIEAGADILMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGEDRYL 121
           ++M+ DF+ AGA+ILMTITYQ +F+S+SENT I+TL  Y   LD+IVSF+R  IGE+RYL
Sbjct: 62  EEMYRDFMIAGANILMTITYQANFQSISENTSIKTLAAYKRFLDKIVSFTREFIGEERYL 121

Query: 122 IGCIGAWGAHVCSEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIHELR 181
           IG IG W AHV  E+TGDYGPHP+ IDY+ +F+PQL NF Q++DID+IGFETIPN HEL+
Sbjct: 122 IGSIGPWAAHVSCEYTGDYGPHPENIDYYGFFKPQLENFNQNRDIDLIGFETIPNFHELK 181

Query: 182 AILSWDETVLSKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINCCAF 241
           AILSWDE ++SKPFYIGLSV +  +LRDGT++++I+  I  LG+K+N NL+ +G+NC +F
Sbjct: 182 AILSWDEDIISKPFYIGLSVDDNSLLRDGTTLEEISVHIKGLGNKINKNLLLMGVNCVSF 241

Query: 242 NQSHMILESLHNSCPNMPLIVYPNSGEIYDTVKKIWLKNENQLCTWDDVVKSYIENGARI 301
           NQS +IL+ LH   P MPL+VYPNSGEIY+  +K W +  N+L  W+  VK +++NGARI
Sbjct: 242 NQSALILKMLHEHLPGMPLLVYPNSGEIYNPKEKTWHRPTNKLDDWETTVKKFVDNGARI 301

Query: 302 IGGCCRTTVDDIKEVRLAVNKYA 324
           IGGCCRT+  DI E+  AV+KY+
Sbjct: 302 IGGCCRTSPKDIAEIASAVDKYS 324

>Suva_64.1 Chr64 (76..894) [819 bp, 273 aa] {ON} YPL273W (REAL)
          Length = 273

 Score =  422 bits (1085), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 188/271 (69%), Positives = 234/271 (86%)

Query: 2   RVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSDASKDRIIV 61
           R+P+K+   ++P  VLV+DGGQGTELENRGI VANPVWST+PFI+ESFWS ++S +R IV
Sbjct: 3   RIPLKQLLADDPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRKIV 62

Query: 62  KQMFEDFIEAGADILMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGEDRYL 121
           K+MF DF+ AGA+ILMTITYQTSFKSVSENTPI+TL  Y+ LL RIV FSR CIGE+++L
Sbjct: 63  KEMFNDFLAAGAEILMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHL 122

Query: 122 IGCIGAWGAHVCSEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIHELR 181
           IGCIG WGAHVC EFTG+YGP+P+ ID+++YF+PQL NF ++  +D++GFETIPNIHEL+
Sbjct: 123 IGCIGPWGAHVCCEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELK 182

Query: 182 AILSWDETVLSKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINCCAF 241
           AILSWDE++LSKPFYIGLSVHE+GVLRDGT+M+ +A +I  LGDK+N N + +GINC +F
Sbjct: 183 AILSWDESILSKPFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSF 242

Query: 242 NQSHMILESLHNSCPNMPLIVYPNSGEIYDT 272
           NQS  ILESLH + PNMPL+ YPNSGE+YDT
Sbjct: 243 NQSPDILESLHRALPNMPLLAYPNSGEVYDT 273

>Smik_12.1 Chr12 complement(885..1859) [975 bp, 324 aa] {ON} YLL062C
           (REAL)
          Length = 324

 Score =  424 bits (1090), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 187/323 (57%), Positives = 256/323 (79%), Gaps = 1/323 (0%)

Query: 2   RVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSDASKDRIIV 61
           R+PI+K   E+P  VLV+DGGQGTELENRGIN+ +PVWS  PF+++SFW   +S++R +V
Sbjct: 3   RIPIEKLLIEHPQKVLVLDGGQGTELENRGININSPVWSAAPFVSDSFWEK-SSRERKVV 61

Query: 62  KQMFEDFIEAGADILMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGEDRYL 121
           ++M+ DF+ AGA++LMTITYQ +FKS+S+NT I+TL  Y   LD+IV FSR  IGE+RYL
Sbjct: 62  EEMYRDFMNAGANVLMTITYQANFKSISKNTTIKTLPAYRRFLDQIVCFSRRLIGEERYL 121

Query: 122 IGCIGAWGAHVCSEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIHELR 181
           IG IG W AHV SE+TG+YGPHP+ IDY+E+FRPQL  F +++DID+IGFETIPN HEL+
Sbjct: 122 IGSIGPWAAHVSSEYTGNYGPHPEDIDYYEFFRPQLDTFNENEDIDLIGFETIPNFHELK 181

Query: 182 AILSWDETVLSKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINCCAF 241
           AILSW E ++S+PFY+GLSVH+ G+LRDGT++++I+  I  LG K+N N + +G+NC +F
Sbjct: 182 AILSWGEDIISRPFYVGLSVHDNGLLRDGTTLEEISAHIKGLGSKINKNFLLLGVNCISF 241

Query: 242 NQSHMILESLHNSCPNMPLIVYPNSGEIYDTVKKIWLKNENQLCTWDDVVKSYIENGARI 301
           NQS +IL++LH   P+ PL+VYPNSGEIYD  +K W    ++L +WD  V+ +I++GARI
Sbjct: 242 NQSTLILKALHEVLPDFPLLVYPNSGEIYDPKEKTWYHPTDKLDSWDVTVRKFIDSGARI 301

Query: 302 IGGCCRTTVDDIKEVRLAVNKYA 324
           IGGCCRT+  DI E+  +V+ Y+
Sbjct: 302 IGGCCRTSPKDIAEIAASVDTYS 324

>Skud_12.4 Chr12 complement(4676..5653) [978 bp, 325 aa] {ON}
           YLL062C (REAL)
          Length = 325

 Score =  424 bits (1089), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 188/324 (58%), Positives = 255/324 (78%), Gaps = 1/324 (0%)

Query: 2   RVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSDASKDRIIV 61
           R+ I+K   E P  VLV+DGGQGTELENRGIN+  PVWS  PF ++SFW   +S DR +V
Sbjct: 3   RISIEKLILEYPTRVLVLDGGQGTELENRGINIGGPVWSATPFTSDSFWEQ-SSHDREVV 61

Query: 62  KQMFEDFIEAGADILMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGEDRYL 121
           ++M+ DF+ AGA++LMTITYQ +FKS+SENT I+TL  YNG LDRIVSF+R  IGE+RYL
Sbjct: 62  EEMYRDFMNAGANVLMTITYQANFKSISENTSIQTLSAYNGFLDRIVSFTRRFIGEERYL 121

Query: 122 IGCIGAWGAHVCSEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIHELR 181
           +G IG W AHV SE+TG+YGPHP+ IDY+ +F+PQL +F ++KDID+IGFET+PN HEL+
Sbjct: 122 VGSIGPWAAHVSSEYTGNYGPHPEDIDYYNFFKPQLDSFNENKDIDLIGFETVPNFHELK 181

Query: 182 AILSWDETVLSKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINCCAF 241
           AILSW E ++SKPFY+GLSVH+ G+LRDGT+M++++  I  LG ++N +L+ +G+NC +F
Sbjct: 182 AILSWGEDIISKPFYVGLSVHDNGLLRDGTTMEEVSAHIKGLGSRINKHLLLMGVNCISF 241

Query: 242 NQSHMILESLHNSCPNMPLIVYPNSGEIYDTVKKIWLKNENQLCTWDDVVKSYIENGARI 301
           N+S +IL +LH S P+ PL+VYPNSGE+YD  +K W    ++  +WD  VK++I++GARI
Sbjct: 242 NRSTLILRTLHESLPDTPLLVYPNSGEVYDVKEKTWHWPTDKPESWDITVKTFIDSGARI 301

Query: 302 IGGCCRTTVDDIKEVRLAVNKYAK 325
           IGGCCRT+  DI E+  AV +Y +
Sbjct: 302 IGGCCRTSPKDIAEIATAVRRYCE 325

>KAFR0F04420 Chr6 (867176..868156) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  413 bits (1061), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 190/324 (58%), Positives = 244/324 (75%)

Query: 2   RVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSDASKDRIIV 61
           RVPIK+Y   N D +LV+DGGQGTELE RGIN+++PVWST+PFINESFWS+ +S DR I+
Sbjct: 3   RVPIKEYLLRNSDKILVLDGGQGTELEKRGINISSPVWSTLPFINESFWSNSSSNDRKII 62

Query: 62  KQMFEDFIEAGADILMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGEDRYL 121
           K M+ DFI AGAD+L T TYQTSF S+SENT I+TL++Y+ LL+RI  F+R CIG+ +YL
Sbjct: 63  KDMYSDFISAGADVLSTTTYQTSFASISENTNIQTLKDYHELLNRITKFTRECIGDSKYL 122

Query: 122 IGCIGAWGAHVCSEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIHELR 181
           +G IG + A++ +E+TGD+G   D IDY  YF+PQL NF +S +IDIIGFETIPNIHELR
Sbjct: 123 VGSIGTYAAYLSAEYTGDFGDAADTIDYHGYFKPQLDNFNRSTEIDIIGFETIPNIHELR 182

Query: 182 AILSWDETVLSKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINCCAF 241
           AILS ++  LSKPFYI LS +    LRDGTS++ + D+I S    LN NL+ +GINC   
Sbjct: 183 AILSLNKKDLSKPFYISLSTNSKAQLRDGTSLKGVVDVIKSFESTLNPNLILLGINCIGL 242

Query: 242 NQSHMILESLHNSCPNMPLIVYPNSGEIYDTVKKIWLKNENQLCTWDDVVKSYIENGARI 301
           N SH+ +E L+N  P  PLIVYPNSGE YD V+KIWL +E+   TW+ +V  Y++ GARI
Sbjct: 243 NSSHLTMEYLNNHLPQFPLIVYPNSGEKYDPVRKIWLADEDPAFTWEYIVHRYLDAGARI 302

Query: 302 IGGCCRTTVDDIKEVRLAVNKYAK 325
           +GGCCRTT  DI+ +  A+  Y K
Sbjct: 303 VGGCCRTTPSDIRSISEAIKCYTK 326

>ABL125W Chr2 (161358..162368) [1011 bp, 336 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL273W (SAM4)
          Length = 336

 Score =  409 bits (1051), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 186/330 (56%), Positives = 244/330 (73%), Gaps = 2/330 (0%)

Query: 2   RVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSDASKDRIIV 61
           R+PI++Y EE+P  VLVMDGGQGTELENRGI VA+PVWS  PF++ + W    S++R IV
Sbjct: 3   RIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERAIV 62

Query: 62  KQMFEDFIEAGADILMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGEDRYL 121
             +  DF+ AGA+++MTITYQ SF SV+ NT I TL++YN LLDRIV F R  +G+D+YL
Sbjct: 63  ASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDKYL 122

Query: 122 IGCIGAWGAHVCSEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIHELR 181
           +G IGAWGAHVC+EFTGDYGP PD IDY  YF+PQL NF     +D+IGFETIPN HELR
Sbjct: 123 VGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHELR 182

Query: 182 AILSWDETVLSKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINCCAF 241
           AILSWDE+V++KPFY+ LSVH+ G LRDGT M  +A ++++    LN N + +GINC + 
Sbjct: 183 AILSWDESVIAKPFYVALSVHDAGTLRDGTPMADVAAIVAAA-APLNPNFLGLGINCSSL 241

Query: 242 NQSHMILESLHNSCPNMPLIVYPNSGEIYDTVKKIWLKNENQLCTWDDVVKSYIENGARI 301
           +++  IL  LH   P +P+ +YPNSGEIYD VKK+W      +  W  VV SYI +GARI
Sbjct: 242 SRTPAILAELHALLPALPMTIYPNSGEIYDPVKKVW-NASPHVVDWGAVVASYIRSGARI 300

Query: 302 IGGCCRTTVDDIKEVRLAVNKYAKQTTSSL 331
           IGGCCRT  +DI+++  AV  +A+ +++ +
Sbjct: 301 IGGCCRTIPNDIRQIADAVRTHARASSTDV 330

>KAFR0L00150 Chr12 complement(16662..17642) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  400 bits (1027), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 180/324 (55%), Positives = 245/324 (75%)

Query: 1   MRVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSDASKDRII 60
           +RVP+KKY +ENP+ VLV DGGQG ELE RG+++ + +WST PF+++SFWS  +S D  I
Sbjct: 2   VRVPLKKYLKENPEKVLVSDGGQGLELERRGLDIKHRLWSTRPFLSKSFWSDPSSNDIRI 61

Query: 61  VKQMFEDFIEAGADILMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGEDRY 120
           VK MFEDF+ AGA+ILMT TYQTSFK+VSE+T +++L EYN LLD+IV F+R+CIG++RY
Sbjct: 62  VKGMFEDFVNAGAEILMTTTYQTSFKAVSESTELKSLREYNELLDKIVGFTRACIGDNRY 121

Query: 121 LIGCIGAWGAHVCSEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIHEL 180
           LIG IG++GA V  E++GDYG  P+ +D++ YF+PQL NF+ + +IDI+GFETI N  EL
Sbjct: 122 LIGSIGSYGALVGGEYSGDYGDSPETVDFYSYFKPQLDNFLNNDEIDIVGFETIANFTEL 181

Query: 181 RAILSWDETVLSKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINCCA 240
           +++LSWDE  +SKPFYI LSVH+ G LRDGT M  I D I SL   +N NL F+G+NC  
Sbjct: 182 KSLLSWDEKKVSKPFYISLSVHDNGNLRDGTPMHLITDYIKSLATAINPNLTFLGVNCVN 241

Query: 241 FNQSHMILESLHNSCPNMPLIVYPNSGEIYDTVKKIWLKNENQLCTWDDVVKSYIENGAR 300
           +N++  I++S+HN  P MPL V+PNSGE+++  K IW  N     +W+ VVK +I +G R
Sbjct: 242 YNKATEIIDSIHNGLPTMPLSVFPNSGEVFNVEKGIWTANPEAAASWEAVVKRFISSGVR 301

Query: 301 IIGGCCRTTVDDIKEVRLAVNKYA 324
           I+GGCCRT   DI+++  AV K +
Sbjct: 302 IVGGCCRTRPHDIEQISKAVKKLS 325

>Suva_16.32 Chr16 (40969..41748) [780 bp, 259 aa] {ON} YPL273W
           (REAL)
          Length = 259

 Score =  382 bits (981), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 173/249 (69%), Positives = 210/249 (84%)

Query: 76  LMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGEDRYLIGCIGAWGAHVCSE 135
           LMTITYQTSFKSVSENTPI+TL  Y+ LL RIV FSR CIGE+++LIGCIG WGAHVC E
Sbjct: 11  LMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVCCE 70

Query: 136 FTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIHELRAILSWDETVLSKPF 195
           FTG+YGP+P+ ID+++YF+PQL NF ++  +D++GFETIPNIHEL+AILSWDE++LSKPF
Sbjct: 71  FTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSKPF 130

Query: 196 YIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINCCAFNQSHMILESLHNSC 255
           YIGLSVHE+GVLRDGT+M+ +A +I  LGDK+N N + +GINC +FNQS  ILESLH + 
Sbjct: 131 YIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHRAL 190

Query: 256 PNMPLIVYPNSGEIYDTVKKIWLKNENQLCTWDDVVKSYIENGARIIGGCCRTTVDDIKE 315
           PNMPL+ YPNSGE+YDT KKIWL N ++L +WD VVK YI +GARIIGGCCRTT  DI+E
Sbjct: 191 PNMPLLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYIGSGARIIGGCCRTTPKDIQE 250

Query: 316 VRLAVNKYA 324
           V  AV KY 
Sbjct: 251 VSAAVKKYT 259

>TBLA0B03260 Chr2 (760392..761372) [981 bp, 326 aa] {ON} Anc_8.841
           YPL273W
          Length = 326

 Score =  353 bits (905), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 168/323 (52%), Positives = 231/323 (71%), Gaps = 3/323 (0%)

Query: 1   MRVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSDASKDRI- 59
           MR   K+YF  +P+ V+VMDGGQGTELE RG++V++ VWSTVPFI   FW  D     I 
Sbjct: 1   MRQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNIS 60

Query: 60  IVKQMFEDFIEAGADILMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGEDR 119
           IVK MF+ F+ AG+  LM+ITYQ SF ++S NT I+ LEEYN LL++IV F R CIG  +
Sbjct: 61  IVKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSK 120

Query: 120 YLIGCIGAWGAHVCSEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIHE 179
           YLIG IG + +HV +E+TGDYG HP+ +DY  YF+PQL NF  + DID+I  ET+PN +E
Sbjct: 121 YLIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQLDNFNDNDDIDLIAMETVPNKYE 180

Query: 180 LRAILSWDETVLSKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINCC 239
           L+A+LSWD T + KPFYI LSV + G LRDGTSM  I+ +  +   K N NLM +G+NC 
Sbjct: 181 LKALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCV 239

Query: 240 AFNQSHMILESLHNSCPNMPLIVYPNSGEIYDTVKKIWLKNEN-QLCTWDDVVKSYIENG 298
           +++++ MI++ L  + P++PL+ YPNSGE+YD + + W  N + +L +W+ +VK  + NG
Sbjct: 240 SYDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANG 299

Query: 299 ARIIGGCCRTTVDDIKEVRLAVN 321
            R++GGCCRTT DDI ++  AV+
Sbjct: 300 VRMVGGCCRTTPDDIHKIAQAVS 322

>TPHA0I00260 Chr9 (49179..50150) [972 bp, 323 aa] {ON} Anc_8.841
           YPL273W
          Length = 323

 Score =  350 bits (897), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 160/322 (49%), Positives = 230/322 (71%), Gaps = 2/322 (0%)

Query: 1   MRVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSD-ASKDRI 59
           MRVP +K+ +E+P+ +LV+DGGQGTELENRG+N+ +P+WST+ F+N+ FW  +  + +R 
Sbjct: 1   MRVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFWDENIENTERK 60

Query: 60  IVKQMFEDFIEAGADILMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGEDR 119
            +++MF DF +AGA++  T+TYQTSF SVSENT I++L+EY+ LL +I  F R CI +D 
Sbjct: 61  CIREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDDD 120

Query: 120 YLIGCIGAWGAHVCSEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIHE 179
           YL+GCIGA+ A + +E+ G+YG    +IDY +YF+PQL  F    +IDIIGFETIPN HE
Sbjct: 121 YLLGCIGAYAASIGAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHE 180

Query: 180 LRAILSWDETVLSKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINCC 239
           L AILSWDE ++++PF+I LS+ +   LRDGTS +++  L +    + N NL+++G NC 
Sbjct: 181 LEAILSWDEDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAKYKGR-NKNLVYVGGNCI 239

Query: 240 AFNQSHMILESLHNSCPNMPLIVYPNSGEIYDTVKKIWLKNENQLCTWDDVVKSYIENGA 299
           ++  S   +  LH+  P++ LI YPNSGEIYD   K W        +W++VV  Y + G 
Sbjct: 240 SYAYSIDNIRKLHDIVPHLNLIAYPNSGEIYDQKSKQWSSTSAIKISWEEVVNEYADAGV 299

Query: 300 RIIGGCCRTTVDDIKEVRLAVN 321
           +IIGGCCRTT DDIK+++ AV+
Sbjct: 300 KIIGGCCRTTPDDIKQIKKAVD 321

>Kpol_1068.7 s1068 complement(11996..12967) [972 bp, 323 aa] {ON}
           complement(11996..12967) [972 nt, 324 aa]
          Length = 323

 Score =  343 bits (879), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 163/323 (50%), Positives = 225/323 (69%), Gaps = 3/323 (0%)

Query: 1   MRVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSDA-SKDRI 59
           MRVPI++     PD VLV DGG GT LE+RGINV++P+WSTVPF+ + FW S+  + DR 
Sbjct: 1   MRVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTSDRN 60

Query: 60  IVKQMFEDFIEAGADILMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGEDR 119
           I++ ++ D+I +G+ IL TITYQTSF  +S +T ++T+E Y  L+  I SF RS IGED 
Sbjct: 61  IIEGIYRDYITSGSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDN 120

Query: 120 YLIGCIGAWGAHVCSEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIHE 179
           YLIG IG +GA + +E+TG+YG  P  I+Y EYF+PQL  F  + DIDIIGFET+PN +E
Sbjct: 121 YLIGSIGPFGARLGAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYE 180

Query: 180 LRAILSWDETVLSKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINCC 239
           L AILSWD++V+SKP+Y+ LS+ + G LRDGTS ++IA +     +  N NL+  G NC 
Sbjct: 181 LEAILSWDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFKKYSN--NDNLILTGANCI 238

Query: 240 AFNQSHMILESLHNSCPNMPLIVYPNSGEIYDTVKKIWLKNENQLCTWDDVVKSYIENGA 299
           +F  +   +  LH + P +PLIVYPNSGEIYD + K W  ++    TW+D++K    +  
Sbjct: 239 SFKYASENISKLHQAIPTLPLIVYPNSGEIYDPLTKKWTIDQTFGLTWEDLIKELRTSNV 298

Query: 300 RIIGGCCRTTVDDIKEVRLAVNK 322
           RI+GGCCRTT DDI +++  + K
Sbjct: 299 RIVGGCCRTTPDDINKIKDMITK 321

>ZYRO0G14212g Chr7 (1133202..1134179) [978 bp, 325 aa] {ON} similar
           to uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 325

 Score =  342 bits (876), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 162/315 (51%), Positives = 225/315 (71%), Gaps = 9/315 (2%)

Query: 14  DVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSDAS-KDRIIVKQMFEDFIEAG 72
           D VLVMDGGQGTELENRG+N++ P+WSTVPF  E FW+ D    DR +V  MF+ +++AG
Sbjct: 13  DRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNFDQPYTDRDVVNSMFKAYVDAG 72

Query: 73  ADILMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGEDRYLIGCIGAWGAHV 132
           A +L T+TYQTS+K++  +T I T  +Y+ LLDRIV F R CIG+D YL+G IG + AHV
Sbjct: 73  AQLLSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDHYLVGSIGPYAAHV 132

Query: 133 CSEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIHELRAILSWDETVLS 192
            +E+TGDYGP P++IDY++YF PQ+ NF +++ IDIIG ET+PN+HEL++ILSWDET +S
Sbjct: 133 GAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHELKSILSWDETKIS 192

Query: 193 KPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINCCAFNQSHMILESLH 252
           KPFY+ L V + G LRDGT ++Q+  L +   ++ N NL+ +GINCC+ + S   L  L+
Sbjct: 193 KPFYVSLCVGDDGNLRDGTPLEQLVPLFA---NRSNKNLLLVGINCCSLSVSSQALSHLN 249

Query: 253 NSCPNMP--LIVYPNSGEIYDTVKKIWLKN---ENQLCTWDDVVKSYIENGARIIGGCCR 307
               + P  L+VYPNSGEIYD   + W +    ++   +W  +V+ Y + GAR IGGCCR
Sbjct: 250 EILASTPMGLLVYPNSGEIYDHKTQTWSRPTGLDSHRLSWPSLVQEYRKFGARAIGGCCR 309

Query: 308 TTVDDIKEVRLAVNK 322
           TT  DI+E+   V++
Sbjct: 310 TTPLDIQEICKVVDR 324

>Skud_100.1 Chr100 complement(3..602) [600 bp, 200 aa] {ON} YPL273W
           (REAL)
          Length = 200

 Score =  317 bits (813), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 144/200 (72%), Positives = 169/200 (84%)

Query: 77  MTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGEDRYLIGCIGAWGAHVCSEF 136
           MT TYQTS+KSVSENTPI+TL EYN LL RIV FSR CIGED+YLIGCIG WGAH+C EF
Sbjct: 1   MTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRVCIGEDKYLIGCIGPWGAHICCEF 60

Query: 137 TGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIHELRAILSWDETVLSKPFY 196
           TGDYGP P  ID+++YF+PQL NF +S  +D+IGFETIPN+HELRAILSWDE++LSKPFY
Sbjct: 61  TGDYGPDPQSIDFYKYFKPQLDNFNKSDKLDLIGFETIPNVHELRAILSWDESILSKPFY 120

Query: 197 IGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINCCAFNQSHMILESLHNSCP 256
           IGLSVHE+GVLRDGT+M+++A +I  LGDK+N N   +GINC +FNQS  ILESLH   P
Sbjct: 121 IGLSVHEHGVLRDGTTMEEVAKVIKGLGDKINPNFSLLGINCVSFNQSPDILESLHQVLP 180

Query: 257 NMPLIVYPNSGEIYDTVKKI 276
           NM L+ YPNSGE+YDT KKI
Sbjct: 181 NMALLAYPNSGEVYDTEKKI 200

>Skud_101.1 Chr101 complement(3..602) [600 bp, 200 aa] {ON} YPL273W
           (REAL)
          Length = 200

 Score =  317 bits (813), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 142/200 (71%), Positives = 171/200 (85%)

Query: 77  MTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGEDRYLIGCIGAWGAHVCSEF 136
           MT TYQTS+KSVSENTPI+TL EYN LL RIV FSR CIGE++YLIGCIG WGAH+C EF
Sbjct: 1   MTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRDCIGENKYLIGCIGPWGAHICREF 60

Query: 137 TGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIHELRAILSWDETVLSKPFY 196
           TGDYGP P+ ID++EYF+PQL NF ++  +D+IGFETIPN+HELRAILSWDE++LSKPFY
Sbjct: 61  TGDYGPDPESIDFYEYFKPQLDNFNKNDKLDLIGFETIPNVHELRAILSWDESILSKPFY 120

Query: 197 IGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINCCAFNQSHMILESLHNSCP 256
           IGLSVHE+GVLRDGT+M+++A +I  LGDK+N N   +GINC +FNQS  ILESLH + P
Sbjct: 121 IGLSVHEHGVLRDGTTMEEVAKVIKGLGDKINPNFSLLGINCVSFNQSPDILESLHQALP 180

Query: 257 NMPLIVYPNSGEIYDTVKKI 276
           +M L+ YPNSGE+YDT KKI
Sbjct: 181 DMALLAYPNSGEVYDTEKKI 200

>SAKL0D09306g Chr4 (771565..772545) [981 bp, 326 aa] {ON} similar to
           uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 326

 Score =  261 bits (668), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 143/334 (42%), Positives = 208/334 (62%), Gaps = 24/334 (7%)

Query: 2   RVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSDASKDRIIV 61
           R PI +Y E +   +LV+DGGQGTE+E RGI+V +P+WST+PFI ++    +       +
Sbjct: 3   RQPIAEYLESS---ILVLDGGQGTEMERRGIDVIHPLWSTLPFIKKNPTHLNH------I 53

Query: 62  KQMFEDFIEAGADILMTITYQTSFKSVSE--NTPIRTLEEYNGLLDRIVSFSR-SCIGED 118
           K M+ DF  +GA  L TITYQ SF ++ +  +  + T ++Y   L+ I+ F+R  CI + 
Sbjct: 54  KGMYHDFSTSGARALSTITYQASFATLKQYSDGQVVTEQQYQQFLNDIIGFTRDQCISDS 113

Query: 119 RYLIGCIGAWGAHVC--SEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPN 176
           +YLIGC+G + A++C  +E++GDYG   ++ID+ +YF+PQL  F +   ID++GFETIPN
Sbjct: 114 QYLIGCVGPYAAYLCNGAEYSGDYG--SEKIDFKQYFKPQLDVFSRDDRIDMVGFETIPN 171

Query: 177 IHELRAILSWDETVL--SKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFI 234
           I EL+ +LS D T +  +KPFYI +S    G LRDGT + +I + I         NL+F+
Sbjct: 172 IEELKTLLSKDFTSMLGTKPFYISISTDSNGNLRDGTPVAKICETIKDADKSTPPNLLFL 231

Query: 235 GINCCAFNQSHMILESLH----NSCPNMPLIVYPNSGEIYDTVKKIWLKNEN--QLCTWD 288
           GINC  ++ S+ IL  L+    + C  +   VYPNSGEIYD     W  N       TW+
Sbjct: 232 GINCVDYHHSYNILSRLNGGLGDDCSLLFKAVYPNSGEIYDGNTHTWHTNSEIAPELTWN 291

Query: 289 DVVKSYIENGARIIGGCCRTTVDDIKEVRLAVNK 322
            +V  + E   ++IGGCCRTT DDIK++  AVNK
Sbjct: 292 YLVSKFAEQKCQLIGGCCRTTPDDIKQIADAVNK 325

>KLTH0H12716g Chr8 (1079836..1080882) [1047 bp, 348 aa] {ON} similar
           to uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 348

 Score =  232 bits (591), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 129/339 (38%), Positives = 198/339 (58%), Gaps = 29/339 (8%)

Query: 1   MRVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSDASKDRII 60
           MR P+K++F+ N   +L++DGGQGTELE +G+++++P+WST+PFI ++    +A      
Sbjct: 1   MRKPLKEFFKNN---ILLLDGGQGTELEKKGVSISHPLWSTLPFIIKNKTHLEA------ 51

Query: 61  VKQMFEDFIEAGADILMTITYQTSFKSVSENTP--IRTLEEYNGLLDRIVSFS-RSCIGE 117
           +K+M+ DF EAG++ LMTITYQ SF S+ + +   + + E+Y   LD ++ F+ R CI  
Sbjct: 52  IKEMYRDFAEAGSNALMTITYQASFSSMKKYSEGLVNSEEDYAAFLDYVIGFTDRECITP 111

Query: 118 DRYLIGCIGAWGAHVC--SEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIP 175
           D+YL+G +G +   +   +E++G YG    +ID+ +Y+ PQ+ +F  S  ID+IG ETIP
Sbjct: 112 DKYLVGSVGPYAGLLSNGAEYSGYYG--EGKIDFIDYYSPQVKHFALSPRIDLIGIETIP 169

Query: 176 NIHELRAILS--WDETVLSKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMF 233
           NI E +A+LS  +     SKP+YI ++    G LRDGTS+ +I   I      L  N +F
Sbjct: 170 NIDEFKALLSPEFSRLSFSKPYYISVTTDNNGCLRDGTSLNEICRAIKQSASLLPDNFVF 229

Query: 234 IGINCCAFNQSHMILESLHNSCPNMPLI--------VYPNSGEIYDTVKKIWLKN--ENQ 283
             INC  F     IL+SL N C  M  +         YPNSGEIY      W  N     
Sbjct: 230 FAINCVEFLHCVEILQSL-NDCLEMQGVDRRFRFRGAYPNSGEIYHGGTHSWSSNPYAGP 288

Query: 284 LCTWDDVVKSYIENGARIIGGCCRTTVDDIKEVRLAVNK 322
             TW+++    +     ++GGCCRT  ++I+++ L   K
Sbjct: 289 EDTWENLTLGLLSQECLMLGGCCRTGSEEIRQMALTTKK 327

>Kwal_0.322 s0 (152442..153440) [999 bp, 332 aa] {ON} YLL062C (MHT1)
           - S-methylmethionine:homocysteine S-methyltransferase
           [contig 86] FULL
          Length = 332

 Score =  227 bits (579), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 127/341 (37%), Positives = 199/341 (58%), Gaps = 27/341 (7%)

Query: 1   MRVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSDASKDRII 60
           MR+ +++Y +     +L++DGGQGTELE RGIN+A+P+WST+P++ +        K   I
Sbjct: 1   MRLQLEEYLKHE---ILLLDGGQGTELEKRGINIAHPLWSTLPYVTKD------KKHLKI 51

Query: 61  VKQMFEDFIEAGADILMTITYQTSFKSVSENTP--IRTLEEYNGLLDRIVSFSRS-CIGE 117
           +K+M+  F  AG + LMTITYQ SF S+  ++   I   +EY   LD ++ ++ + CI  
Sbjct: 52  IKEMYSAFESAGCNALMTITYQASFLSMKNHSDGLINNEKEYTRFLDYVIDYTENQCISP 111

Query: 118 DRYLIGCIGAWGAHVC--SEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIP 175
           + YL+G +G + A++   +E++G Y    D ID+ E+FRPQ+ +F  S  ID+IG ETIP
Sbjct: 112 NSYLVGSVGPYAAYLSNGAEYSGHY--IEDNIDFIEFFRPQVQHFAVSSRIDLIGIETIP 169

Query: 176 NIHELRAILSWDETVLS--KPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMF 233
           N  E +A+L  + + L   KP+YI ++    G LRDGT+ Q I + I      L  NL+F
Sbjct: 170 NFEEFKALLRPEFSRLCALKPYYISITTDNEGNLRDGTARQDICETIKRSAQDLPPNLVF 229

Query: 234 IGINCCAFNQSHMILESLHNSCPNMPL-------IVYPNSGEIYDTVKKIWLKNE--NQL 284
            GINC +F     IL+ L++S  ++ +        VYPNSGE+Y      W  N      
Sbjct: 230 FGINCVSFAHCADILKLLNDSLDDIGVENRLRFRAVYPNSGEVYHGDTHSWGPNPEIGPA 289

Query: 285 CTWDDVVKSYIENGARIIGGCCRTTVDDIKEVRLAVNKYAK 325
            TW+++    ++ G  +IGGCCRT+  D++++   V+   K
Sbjct: 290 DTWENLASKVVQQGCLMIGGCCRTSPADLRQIASVVSDIKK 330

>AFR410W Chr6 (1171334..1172446) [1113 bp, 370 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL273W (SAM4)
          Length = 370

 Score =  213 bits (542), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 120/331 (36%), Positives = 186/331 (56%), Gaps = 22/331 (6%)

Query: 2   RVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSDASKDRIIV 61
           +  I ++ E N   VLVMDGG G ELE RG++V +P+WST PF+     + D       +
Sbjct: 48  KCAITEFLERN---VLVMDGGMGVELERRGMDVKSPLWSTAPFLRGDRAALDT------I 98

Query: 62  KQMFEDFIEAGADILMTITYQTSFKS-VSENTPIRTLEEYNGLLDRIVSFS-RSCIGEDR 119
           + ++ +F  AG+  + T+TYQ SF S V  +  + +  +Y   L+++V F+ R C+   R
Sbjct: 99  RGLYREFRAAGSRGISTLTYQASFHSMVKYSGSVSSRADYEKFLEQVVDFTYRECVDPAR 158

Query: 120 -YLIGCIGAWGAHVC--SEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPN 176
            Y+IG +G + A +C  +E+TGDYG   + I++F YF PQ+  F     ID I FET+PN
Sbjct: 159 DYIIGSVGPYAAFLCNGAEYTGDYGF--ETINFFNYFEPQVSKFATDPRIDAIAFETVPN 216

Query: 177 IHELRAILSWDETVL--SKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFI 234
           + EL A+L  +   L  +KPFYI +S  +  VLRDGT +  +  LI    D L  NL+  
Sbjct: 217 VVELMAMLQPEFHALLKNKPFYISISAKDEHVLRDGTPLAVVGQLIRERMDDLPPNLLCF 276

Query: 235 GINCCAFNQSHMILESLH---NSCPNMPLIVYPNSGEIYDTVKKIWLKNEN-QLCTWDDV 290
           G+NC    +S  +L  L+     CP     +YPN   ++D     W  +++ +  TW + 
Sbjct: 277 GLNCVDLTRSAAMLAELNMQLQDCPIKFQAIYPNGTSVFDESLSAWRPSKDAESLTWAEA 336

Query: 291 VKSYIENGARIIGGCCRTTVDDIKEVRLAVN 321
           VK Y+    R+IGGCC TT  D++++  A++
Sbjct: 337 VKLYLNQDCRMIGGCCGTTPQDMRQIAEALD 367

>Skud_47.2 Chr47 (1368..1655) [288 bp, 96 aa] {ON} YPL273W (REAL)
          Length = 96

 Score =  149 bits (375), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 67/95 (70%), Positives = 83/95 (87%)

Query: 1  MRVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSDASKDRII 60
          +R+P+K+  E+NP  VLV+DGGQGTELENRGI VANPVWST+PFI++SFWS ++S +R I
Sbjct: 2  VRLPLKQLLEDNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWSDESSANRKI 61

Query: 61 VKQMFEDFIEAGADILMTITYQTSFKSVSENTPIR 95
          VK MF DF+ AGA+ILMT TYQTS+KSVSENTPI+
Sbjct: 62 VKGMFNDFLNAGAEILMTTTYQTSYKSVSENTPIK 96

>YMR321C Chr13 complement(917579..917896) [318 bp, 105 aa] {ON}
           Putative protein of unknown function; proposed to be a
           palmitoylated membrane protein
          Length = 105

 Score =  147 bits (370), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 80/101 (79%)

Query: 223 LGDKLNSNLMFIGINCCAFNQSHMILESLHNSCPNMPLIVYPNSGEIYDTVKKIWLKNEN 282
           LGDK+N NL F+GINC +FNQS  ILESLH + PNM L+ YPNSGE+YDT KKIWL N +
Sbjct: 4   LGDKINPNLSFLGINCVSFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSD 63

Query: 283 QLCTWDDVVKSYIENGARIIGGCCRTTVDDIKEVRLAVNKY 323
           +L +WD VVK YI +GARIIGGCCRT+  DI+E+  AV KY
Sbjct: 64  KLNSWDTVVKQYISSGARIIGGCCRTSPKDIQEISAAVKKY 104

>TPHA0O00630 Chr15 complement(115953..117737) [1785 bp, 594 aa] {ON}
           Anc_1.386 YLR173W
          Length = 594

 Score = 36.2 bits (82), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 258 MPLIVYPNSGEIYDTVKKIWLKNENQLCTWDDVVKSYIENGARIIGGCCR-TTVDDIK 314
           + L++ PN+  I D +KKIW K+ + L  W D+     +    + G   R  T+D+IK
Sbjct: 186 ITLLLKPNTKNIVDVLKKIWKKDYDHLNIWSDMSLKLSKKSYLLFGANLRFYTLDNIK 243

>TPHA0D04460 Chr4 complement(964925..967363) [2439 bp, 812 aa] {ON}
           Anc_1.135 YJL200C
          Length = 812

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 25/51 (49%), Gaps = 12/51 (23%)

Query: 256 PNMPLIVYPNSGEIYDTVKKIWLKNENQLCTWDDVVKSYIENGARIIGGCC 306
           P +P  V P S +I  T+ +            DD++K++ ENGA ++   C
Sbjct: 434 PKIPFFVTPGSEQIRATLDR------------DDIIKTFAENGATVLSNAC 472

>AAR046C Chr1 complement(422667..424301) [1635 bp, 544 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR068W
           (CVT17)
          Length = 544

 Score = 30.8 bits (68), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 40/94 (42%), Gaps = 20/94 (21%)

Query: 170 GFETIPNIHELRAILSWDETVLSKPFYIG-----LSVHEYG--------VLRDGTSMQQI 216
            +  +PN    R + SW+ +V     ++G     L  H +         +   GTS Q +
Sbjct: 217 AYVRLPNTGNWRNVTSWNSSVEGDQIHLGWDENGLRAHVFANEDRSVVVLALKGTSSQVL 276

Query: 217 A----DLISSLGDKLNSNLMFIGINCCAFNQSHM 246
                D  +S  DKLN NL+F   +CC    S++
Sbjct: 277 PGSGDDDETSANDKLNDNLLF---SCCCARVSYL 307

>CAGL0J03168g Chr10 (306171..308612) [2442 bp, 813 aa] {ON} similar
           to uniprot|P32844 Saccharomyces cerevisiae YIL068c SEC6
          Length = 813

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 25/121 (20%), Positives = 53/121 (43%), Gaps = 16/121 (13%)

Query: 200 SVHEYGVLRDGTSMQQIADLISSLGDK--------------LNSNLMFIGIN--CCAFNQ 243
           S+  Y ++ D T M +  D+ S + DK              L++ L   G+   C    Q
Sbjct: 84  SISRYDIIFDATRMYEKVDMTSEIYDKIVAFSDTVEQVNRMLDTELAQDGLETGCPYLIQ 143

Query: 244 SHMILESLHNSCPNMPLIVYPNSGEIYDTVKKIWLKNENQLCTWDDVVKSYIENGARIIG 303
            H +L ++ N    M ++   ++ ++  T +K++ K    +  +D +++S I +   +I 
Sbjct: 144 IHYLLTTIRNFQDQMTIMANVSTDDVQRTCQKLFSKVSGLVDKFDQLLESLIYDIVEMIR 203

Query: 304 G 304
            
Sbjct: 204 A 204

>SAKL0H01980g Chr8 complement(195237..196715) [1479 bp, 492 aa] {ON}
           similar to uniprot|Q756H4 Ashbya gossypii AER292C
           AER292Cp and some similarities with YHR176W
           uniprot|P38866 Saccharomyces cerevisiae YHR176W FMO1
           Flavin-containing monooxygenase localized to the
           cytoplasmic face of the ER membrane catalyzes oxidation
           of biological thiols to maintain the ER redox buffer
           ratio for correct folding of disulfide-bonded proteins
          Length = 492

 Score = 30.4 bits (67), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 26/43 (60%)

Query: 9   FEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWS 51
           F     VV+V +G  GT++ N+   VAN V+ +V  ++++ WS
Sbjct: 244 FAAGKTVVVVGNGSSGTDIANQLSTVANKVFHSVTDVSKTDWS 286

>SAKL0H06446g Chr8 (568689..569609) [921 bp, 306 aa] {ON} similar to
           uniprot|Q12052 Saccharomyces cerevisiae YPL157W TGS1
           TrimethylGuanosine Synthase
          Length = 306

 Score = 30.0 bits (66), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 19/95 (20%), Positives = 40/95 (42%), Gaps = 8/95 (8%)

Query: 35  ANPVWSTVPFINESFWSSDASKDRIIVKQMFEDFIEAGADILMTITYQTSFKSVSENTPI 94
           A+P W    ++ +  +  +   + + +K+M E F+E   +++M +   +  + VS  T  
Sbjct: 174 ASPPWGGPNYLRQDVFDLERGLEPMGLKEMLESFLEISDNVIMFLPRNSDLRQVSRVT-- 231

Query: 95  RTLEEYNGLLDRIVSFSRSCIGEDRYLIGCIGAWG 129
                   LL          + +D +L G +  WG
Sbjct: 232 ------RELLGSQAKCKVLYVNQDAHLKGILCFWG 260

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.138    0.423 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 37,441,951
Number of extensions: 1684847
Number of successful extensions: 4150
Number of sequences better than 10.0: 45
Number of HSP's gapped: 4247
Number of HSP's successfully gapped: 45
Length of query: 331
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 221
Effective length of database: 40,868,139
Effective search space: 9031858719
Effective search space used: 9031858719
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)