Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D01529g8.842ON50150126120.0
SAKL0D01430g8.842ON44744816750.0
KAFR0A028308.842ON50748916480.0
Kpol_541.158.842ON49841916200.0
YML115C (VAN1)8.842ON53551116210.0
Suva_13.288.842ON53049916190.0
ZYRO0G14234g8.842ON50946316050.0
Skud_13.268.842ON53945216050.0
NDAI0E002908.842ON52251315960.0
KNAG0G034208.842ON51144115930.0
TDEL0B005608.842ON50947015780.0
Smik_13.198.842ON53649415750.0
NCAS0B003008.842ON52349315690.0
KLTH0C03828g8.842ON40440315130.0
TPHA0C047808.842ON52551015230.0
Ecym_46138.842ON52442915210.0
ABL124W8.842ON48548515110.0
CAGL0B02321g8.842ON51242015000.0
TBLA0B032708.842ON52041814920.0
Kwal_27.102468.842ON33933813340.0
NCAS0G041101.479ON4943609761e-127
Ecym_35731.479ON4473609711e-127
CAGL0L01331g1.479ON4473609701e-127
KNAG0I003001.479ON4573639631e-125
Kwal_27.101571.479ON4763609631e-125
NDAI0B012501.479ON4463699601e-125
AFR357W1.479ON4343619551e-124
KLTH0C03432g1.479ON4893579561e-124
YEL036C (ANP1)1.479ON5003559531e-123
NDAI0G003401.479ON5043529521e-123
Skud_5.541.479ON4913529481e-123
SAKL0D11792g1.479ON4833609461e-122
Smik_5.571.479ON4913529431e-122
KAFR0I027701.479ON4553609401e-122
Suva_5.331.479ON4953529421e-122
KLLA0E22155g1.479ON4503609341e-121
TBLA0B021701.479ON5723589421e-121
TDEL0C026001.479ON4623619221e-119
Kpol_370.51.479ON6453529381e-119
TPHA0O004301.479ON5483529291e-119
ZYRO0F05170g1.479ON6083549011e-114
KLLA0E12849g8.500ON3923424014e-43
Smik_16.1868.500ON3953424006e-43
Kwal_27.118648.500ON4533473992e-42
TDEL0B013708.500ON3963593935e-42
TBLA0H033408.500ON3933453892e-41
SAKL0H11110g8.500ON3933523865e-41
YPL050C (MNN9)8.500ON3953463866e-41
NDAI0E030208.500ON3963423841e-40
KNAG0A021508.500ON3963423841e-40
Kpol_1031.788.500ON3923633831e-40
NCAS0C023308.500ON3933473803e-40
KLTH0E11616g8.500ON3943523804e-40
KAFR0H013908.500ON3983433804e-40
TPHA0L013708.500ON3923423795e-40
Skud_16.2328.500ON3953463787e-40
AGL259C8.500ON3893383724e-39
Ecym_25508.500ON3903413664e-38
ZYRO0F08492g8.500ON3963613647e-38
Suva_16.2658.500ON3953473584e-37
CAGL0L12804g8.500ON3933533523e-36
NCAS0B024408.500ON4003533463e-35
NDAI0C052508.500ON4023373374e-34
KNAG0A039908.500ON3571752022e-16
SAKL0H20438gsingletonON5652071082e-04
Kwal_55.198187.489ON20273770.39
TBLA0B054602.503ON27443770.64
TPHA0H015105.377ON676136714.8
CAGL0D02574g3.9ON1017116706.4
Suva_6.558.71ON826117689.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D01529g
         (501 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D01529g Chr4 complement(135998..137503) [1506 bp, 501 aa] {...  1010   0.0  
SAKL0D01430g Chr4 complement(113921..115264) [1344 bp, 447 aa] {...   649   0.0  
KAFR0A02830 Chr1 (586557..588080) [1524 bp, 507 aa] {ON} Anc_8.8...   639   0.0  
Kpol_541.15 s541 (41403..42899) [1497 bp, 498 aa] {ON} (41403..4...   628   0.0  
YML115C Chr13 complement(40187..41794) [1608 bp, 535 aa] {ON}  V...   629   0.0  
Suva_13.28 Chr13 complement(39946..41538) [1593 bp, 530 aa] {ON}...   628   0.0  
ZYRO0G14234g Chr7 (1134555..1136084) [1530 bp, 509 aa] {ON} simi...   622   0.0  
Skud_13.26 Chr13 complement(39821..41440) [1620 bp, 539 aa] {ON}...   622   0.0  
NDAI0E00290 Chr5 complement(39735..41238,41371..41435) [1569 bp,...   619   0.0  
KNAG0G03420 Chr7 (733195..734730) [1536 bp, 511 aa] {ON} Anc_8.8...   618   0.0  
TDEL0B00560 Chr2 complement(107343..108872) [1530 bp, 509 aa] {O...   612   0.0  
Smik_13.19 Chr13 complement(36444..38054) [1611 bp, 536 aa] {ON}...   611   0.0  
NCAS0B00300 Chr2 complement(35915..37418,37529..37596) [1572 bp,...   608   0.0  
KLTH0C03828g Chr3 complement(334500..335714) [1215 bp, 404 aa] {...   587   0.0  
TPHA0C04780 Chr3 (1031751..1033328) [1578 bp, 525 aa] {ON} Anc_1...   591   0.0  
Ecym_4613 Chr4 (1195057..1196631) [1575 bp, 524 aa] {ON} similar...   590   0.0  
ABL124W Chr2 (162889..164346) [1458 bp, 485 aa] {ON} Syntenic ho...   586   0.0  
CAGL0B02321g Chr2 (220222..221760) [1539 bp, 512 aa] {ON} simila...   582   0.0  
TBLA0B03270 Chr2 (762231..763793) [1563 bp, 520 aa] {ON} Anc_8.8...   579   0.0  
Kwal_27.10246 s27 complement(260882..261901) [1020 bp, 339 aa] {...   518   0.0  
NCAS0G04110 Chr7 (766896..768380) [1485 bp, 494 aa] {ON} Anc_1.479    380   e-127
Ecym_3573 Chr3 complement(1085088..1086431) [1344 bp, 447 aa] {O...   378   e-127
CAGL0L01331g Chr12 complement(151156..152499) [1344 bp, 447 aa] ...   378   e-127
KNAG0I00300 Chr9 complement(39873..41246) [1374 bp, 457 aa] {ON}...   375   e-125
Kwal_27.10157 s27 complement(219928..221358) [1431 bp, 476 aa] {...   375   e-125
NDAI0B01250 Chr2 complement(293756..295096) [1341 bp, 446 aa] {O...   374   e-125
AFR357W Chr6 (1086069..1087373) [1305 bp, 434 aa] {ON} Syntenic ...   372   e-124
KLTH0C03432g Chr3 complement(297214..298683) [1470 bp, 489 aa] {...   372   e-124
YEL036C Chr5 complement(83050..84552) [1503 bp, 500 aa] {ON}  AN...   371   e-123
NDAI0G00340 Chr7 complement(56898..58412) [1515 bp, 504 aa] {ON}...   371   e-123
Skud_5.54 Chr5 complement(81169..82644) [1476 bp, 491 aa] {ON} Y...   369   e-123
SAKL0D11792g Chr4 (979538..980989) [1452 bp, 483 aa] {ON} simila...   369   e-122
Smik_5.57 Chr5 complement(85152..86627) [1476 bp, 491 aa] {ON} Y...   367   e-122
KAFR0I02770 Chr9 (559196..560563) [1368 bp, 455 aa] {ON} Anc_1.4...   366   e-122
Suva_5.33 Chr5 complement(58480..59967) [1488 bp, 495 aa] {ON} Y...   367   e-122
KLLA0E22155g Chr5 complement(1976362..1977714) [1353 bp, 450 aa]...   364   e-121
TBLA0B02170 Chr2 complement(499391..501109) [1719 bp, 572 aa] {O...   367   e-121
TDEL0C02600 Chr3 complement(450202..451590) [1389 bp, 462 aa] {O...   359   e-119
Kpol_370.5 s370 (7329..9266) [1938 bp, 645 aa] {ON} (7329..9266)...   365   e-119
TPHA0O00430 Chr15 (76318..77964) [1647 bp, 548 aa] {ON} Anc_1.47...   362   e-119
ZYRO0F05170g Chr6 (432802..434628) [1827 bp, 608 aa] {ON} simila...   351   e-114
KLLA0E12849g Chr5 complement(1138282..1139460) [1179 bp, 392 aa]...   159   4e-43
Smik_16.186 Chr16 complement(336170..337357) [1188 bp, 395 aa] {...   158   6e-43
Kwal_27.11864 s27 (981923..983284) [1362 bp, 453 aa] {ON} YPL050...   158   2e-42
TDEL0B01370 Chr2 complement(242546..243736) [1191 bp, 396 aa] {O...   155   5e-42
TBLA0H03340 Chr8 (820028..821209) [1182 bp, 393 aa] {ON} Anc_8.5...   154   2e-41
SAKL0H11110g Chr8 complement(957784..958965) [1182 bp, 393 aa] {...   153   5e-41
YPL050C Chr16 complement(460779..461966) [1188 bp, 395 aa] {ON} ...   153   6e-41
NDAI0E03020 Chr5 complement(643198..644388) [1191 bp, 396 aa] {O...   152   1e-40
KNAG0A02150 Chr1 complement(187175..188365) [1191 bp, 396 aa] {O...   152   1e-40
Kpol_1031.78 s1031 (197094..198272) [1179 bp, 392 aa] {ON} (1970...   152   1e-40
NCAS0C02330 Chr3 complement(437234..438415) [1182 bp, 393 aa] {O...   150   3e-40
KLTH0E11616g Chr5 (1035396..1036580) [1185 bp, 394 aa] {ON} high...   150   4e-40
KAFR0H01390 Chr8 complement(258984..260180) [1197 bp, 398 aa] {O...   150   4e-40
TPHA0L01370 Chr12 (286001..287179) [1179 bp, 392 aa] {ON} Anc_8....   150   5e-40
Skud_16.232 Chr16 complement(424904..426091) [1188 bp, 395 aa] {...   150   7e-40
AGL259C Chr7 complement(221445..222614) [1170 bp, 389 aa] {ON} S...   147   4e-39
Ecym_2550 Chr2 (1066925..1068097) [1173 bp, 390 aa] {ON} similar...   145   4e-38
ZYRO0F08492g Chr6 (684329..685519) [1191 bp, 396 aa] {ON} highly...   144   7e-38
Suva_16.265 Chr16 complement(463836..465023) [1188 bp, 395 aa] {...   142   4e-37
CAGL0L12804g Chr12 (1371568..1372749) [1182 bp, 393 aa] {ON} hig...   140   3e-36
NCAS0B02440 Chr2 complement(408198..409400) [1203 bp, 400 aa] {O...   137   3e-35
NDAI0C05250 Chr3 (1217841..1219049) [1209 bp, 402 aa] {ON} Anc_8...   134   4e-34
KNAG0A03990 Chr1 complement(535490..536563) [1074 bp, 357 aa] {O...    82   2e-16
SAKL0H20438g Chr8 (1793911..1793929,1794594..1796272) [1698 bp, ...    46   2e-04
Kwal_55.19818 s55 complement(140297..140905) [609 bp, 202 aa] {O...    34   0.39 
TBLA0B05460 Chr2 complement(1299725..1300549) [825 bp, 274 aa] {...    34   0.64 
TPHA0H01510 Chr8 (340988..343018) [2031 bp, 676 aa] {ON} Anc_5.3...    32   4.8  
CAGL0D02574g Chr4 (263063..266116) [3054 bp, 1017 aa] {ON} simil...    32   6.4  
Suva_6.55 Chr6 (103697..106177) [2481 bp, 826 aa] {ON} YFL004W (...    31   9.7  

>KLLA0D01529g Chr4 complement(135998..137503) [1506 bp, 501 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 501

 Score = 1010 bits (2612), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/501 (97%), Positives = 489/501 (97%)

Query: 1   MVVFVKDKRLELPMHHDSKQKGNHFRPKSGFGLFFAKINGLRYAKSRIVFLFALVLVSTF 60
           MVVFVKDKRLELPMHHDSKQKGNHFRPKSGFGLFFAKINGLRYAKSRIVFLFALVLVSTF
Sbjct: 1   MVVFVKDKRLELPMHHDSKQKGNHFRPKSGFGLFFAKINGLRYAKSRIVFLFALVLVSTF 60

Query: 61  LLLSKLVGGNVNLMQYIPTSLDEQEYYDYDFKGLDIDTIKKYDEGVSHYIISKGGMEALS 120
           LLLSKLVGGNVNLMQYIPTSLDEQEYYDYDFKGLDIDTIKKYDEGVSHYIISKGGMEALS
Sbjct: 61  LLLSKLVGGNVNLMQYIPTSLDEQEYYDYDFKGLDIDTIKKYDEGVSHYIISKGGMEALS 120

Query: 121 SEDKEAFEREADMLLASTTDLYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNL 180
           SEDKEAFEREADMLLASTTDLYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNL
Sbjct: 121 SEDKEAFEREADMLLASTTDLYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNL 180

Query: 181 MNLTYPHELIDIAFLVSDCTDNGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQ 240
           MNLTYPHELIDIAFLVSDCTDNGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQ
Sbjct: 181 MNLTYPHELIDIAFLVSDCTDNGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQ 240

Query: 241 LYLKYMGKDYLKMVKNAFNPPFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVR 300
           LYLKYMGKDYLKMVKNAFNPPFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVR
Sbjct: 241 LYLKYMGKDYLKMVKNAFNPPFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVR 300

Query: 301 RKLMGRARNWLTANALKPYHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTF 360
           RKLMGRARNWLTANALKPYHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTF
Sbjct: 301 RKLMGRARNWLTANALKPYHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTF 360

Query: 361 LGGAQAYDLNSWVESNEAIKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXX 420
           LGGAQAYDLNSWVESNEAIKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNP     
Sbjct: 361 LGGAQAYDLNSWVESNEAIKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPDDLLD 420

Query: 421 XXXXXXXSILARAQLFRKGIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYE 480
                  SILARAQLFRKGIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYE
Sbjct: 421 LDGVGGVSILARAQLFRKGIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYE 480

Query: 481 PSDDDLREIAKLERESRRNQR 501
           PSDDDLREIAKLERESRRNQR
Sbjct: 481 PSDDDLREIAKLERESRRNQR 501

>SAKL0D01430g Chr4 complement(113921..115264) [1344 bp, 447 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 447

 Score =  649 bits (1675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/448 (67%), Positives = 365/448 (81%), Gaps = 3/448 (0%)

Query: 54  LVLVSTFLLLSKLVGGNVNLMQYIPTSLDEQEYYDYDFKGLDIDTIKKYDEGVSHYIISK 113
           +V++  F LL+ ++GG+   + Y   SL + EYY+YDFK +D+D I+KYD+G  H++IS+
Sbjct: 1   MVILIIFFLLNSILGGD-PYVNYKTFSLKDHEYYNYDFKNIDVDIIQKYDKGAEHFLISQ 59

Query: 114 GGMEALSSEDKEAFEREADMLLASTTDLYDLSQYNGASNGAANRDHVLLCVPLRDAASLL 173
           GG E L+ ED E +E+E +MLL +T D+YDLS+Y G+ NGA NRDHVLLCVPLR+A ++L
Sbjct: 60  GGAEVLTPEDNERYEKEVEMLLGATVDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVL 119

Query: 174 PMLFKNLMNLTYPHELIDIAFLVSDCTDNGRTMSSLLDFSKELQNGTLSKTL--QDFEAD 231
           P++FK+LMNLTYPHELID+AFLVSDC+++  T+ +L+ +SKELQNGTLS+    QD    
Sbjct: 120 PLMFKHLMNLTYPHELIDLAFLVSDCSEDDDTLDALIAYSKELQNGTLSELFAEQDEMRR 179

Query: 232 KDKGNSAEQLYLKYMGKDYLKMVKNAFNPPFHDDYDKPFRSIQIFEKDFGQQIGQGFSDR 291
           K     +  LYLKYM +DYL MV+ AF PPFH DYDKPFRS+Q+F+KDFGQ IGQGFSDR
Sbjct: 180 KASIKGSPDLYLKYMNQDYLNMVEMAFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDR 239

Query: 292 HAVKVQGVRRKLMGRARNWLTANALKPYHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVP 351
           HAV VQG+RRKLMGRARNWLTANALKPYHSWVYWRDVD+ELCPG+VIEDLM  + DV VP
Sbjct: 240 HAVTVQGIRRKLMGRARNWLTANALKPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVP 299

Query: 352 NVWRPLPTFLGGAQAYDLNSWVESNEAIKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKD 411
           NVWRPLP FLGG QAYDLNSWVES EA+KLA TLDEDDVIVEGYAEYPTWRVHLGY+R  
Sbjct: 300 NVWRPLPEFLGGEQAYDLNSWVESGEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNP 359

Query: 412 NGNPXXXXXXXXXXXXSILARAQLFRKGIHFPAFTFENHAETEAFGKMAKKMGFKVGGLM 471
           + NP            SILA+A+LFR G+HFPAFTFENHAETEAFGKMAKKM ++VGGL 
Sbjct: 360 DANPYEILDLDGVGGVSILAKAKLFRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLP 419

Query: 472 HYTLWHIYEPSDDDLREIAKLERESRRN 499
           HYT+WHIYEPSDDDL+EIAK ERE RR+
Sbjct: 420 HYTVWHIYEPSDDDLKEIAKKEREKRRD 447

>KAFR0A02830 Chr1 (586557..588080) [1524 bp, 507 aa] {ON} Anc_8.842
           YML115C
          Length = 507

 Score =  639 bits (1648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/489 (63%), Positives = 379/489 (77%), Gaps = 18/489 (3%)

Query: 17  DSKQKGNHFRPKSGFGLFFAKINGLRYAKSRIVFLFALVLVSTFLLL------SKLVGGN 70
           DS++K N F PK+       +   L YAK  I+F F +  +  FL+L      SKL    
Sbjct: 30  DSEKKLN-FTPKN-------RKRRLNYAK--IIFGFFVSFLILFLMLNFEFNASKLNKTI 79

Query: 71  VNLMQYIPTSLDEQEYYDYDFKGLDIDTIKKYDEGVSHYIISKGGMEALSSEDKEAFERE 130
           +++ Q    +L +QEYY++DF+ +D   I+K+D+G  HY+IS+ G + L+ ED+E +ERE
Sbjct: 80  IDIAQKT-INLSDQEYYNFDFEDIDPTVIQKFDQGAQHYLISQFGTDVLTPEDQEIYERE 138

Query: 131 ADMLLASTTDLYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELI 190
            +ML  ST + YDL  + G  NGA NRDHVLLC+PLRDA+ +LP++F++LMNLTYPHELI
Sbjct: 139 MNMLYDSTIETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELI 198

Query: 191 DIAFLVSDCTDNGRTMSSLLDFSKELQNGTLSKTLQDFEA-DKDKGNSAEQLYLKYMGKD 249
           D+AFLVSDC++N  T+ +L++FSK LQNGTLS+ L + +A  K++ ++   L+LKYM  +
Sbjct: 199 DLAFLVSDCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPE 258

Query: 250 YLKMVKNAFNPPFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARN 309
           YLK V+ AF+PPFH+DYDKPFRS+QIFEK+FGQ IGQGFSDRHAVKVQG+RRKLMGRARN
Sbjct: 259 YLKRVQKAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARN 318

Query: 310 WLTANALKPYHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTFLGGAQAYDL 369
           WLTANALKPYHSWVYWRD D+ELCPG+VIEDLM  DYDVIVPNVWRPLP FL G Q YDL
Sbjct: 319 WLTANALKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYDL 378

Query: 370 NSWVESNEAIKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXSI 429
           NSW ES EA+KLA+TLDEDDVIVEGYAEYPTWRVHL Y+R   GNP            SI
Sbjct: 379 NSWRESAEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPDEVVDIDGVGGVSI 438

Query: 430 LARAQLFRKGIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYEPSDDDLREI 489
           LA+A+LFR G+ FPAFTFENHAETEAFGKMAKKMG+KVGGL HYTLWHIYEPSDDDL+E+
Sbjct: 439 LAKAKLFRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDLKEM 498

Query: 490 AKLERESRR 498
           A  ERE RR
Sbjct: 499 ANKEREERR 507

>Kpol_541.15 s541 (41403..42899) [1497 bp, 498 aa] {ON}
           (41403..42899) [1497 nt, 499 aa]
          Length = 498

 Score =  628 bits (1620), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/419 (68%), Positives = 345/419 (82%), Gaps = 1/419 (0%)

Query: 81  LDEQEYYDYDFKGLDIDTIKKYDEGVSHYIISKGGMEALSSEDKEAFEREADMLLASTTD 140
           L++ EYYDYDFK  D   +KK+D+G  HY+ISK G E L+ EDK  +E+E   LL++T  
Sbjct: 81  LEDNEYYDYDFKNFDEPLVKKFDDGAKHYLISKYGSEVLTPEDKSRYEQELQELLSTTVQ 140

Query: 141 LYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSDCT 200
            YDLS+Y+G  NG  NR+HVLLCVPLRDA  +LP++FKN+MNLTYPHELID+AFLVSDCT
Sbjct: 141 NYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSDCT 200

Query: 201 DNGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMGKDYLKMVKNAFNP 260
           +   T+ SL+ +S+ LQ+GTL+   Q+ + D  K +S E+LYLKYM KDYLKMV++A++P
Sbjct: 201 EGDHTLESLIAYSRHLQDGTLAGLFQEMDKDDSKKDS-EKLYLKYMNKDYLKMVEDAYSP 259

Query: 261 PFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANALKPYH 320
           PFH+DY+KPFRS+QIF+KDFGQ++GQGF++RH+VKVQG+RRKLMGRARNWL  NALKPYH
Sbjct: 260 PFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPYH 319

Query: 321 SWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTFLGGAQAYDLNSWVESNEAIK 380
           +WVYWRD DVELCPGTVIEDLM  ++DV+VPNVWRPLP FL   Q YDLNSW+ESNEA+K
Sbjct: 320 AWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESNEALK 379

Query: 381 LAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXSILARAQLFRKGI 440
           LAK LDEDDVIVEGYAEYPTWRVHL Y+R+ NGNP            SIL +A+LFR GI
Sbjct: 380 LAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLFRSGI 439

Query: 441 HFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYEPSDDDLREIAKLERESRRN 499
           HFPAFTFENHAETEAFGKMAKKMGF+VGGL HYTLWHIYEPSDDDL EIA  ERE+ R+
Sbjct: 440 HFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLLEIASKERENNRS 498

>YML115C Chr13 complement(40187..41794) [1608 bp, 535 aa] {ON}
           VAN1Component of the mannan polymerase I, which contains
           Van1p and Mnn9p and is involved in the first steps of
           mannan synthesis; mutants are vanadate-resistant
          Length = 535

 Score =  629 bits (1621), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/511 (58%), Positives = 379/511 (74%), Gaps = 28/511 (5%)

Query: 5   VKDKRLELPMHHDSKQKGNH-FRPKSGFGLFFAKINGLRYAKSRIVFLFALVLVSTFLLL 63
           +KDKR E   H+ +  KG + ++P+S    F   ++        I  L  + ++S +L +
Sbjct: 33  IKDKRSE---HNSNSLKGKYRYQPRSTPSKFQLTVS--------ITSLIIIAVLSLYLFI 81

Query: 64  S---------------KLVGGNVNLMQYIPTSLDEQEYYDYDFKGLDIDTIKKYDEGVSH 108
           S                L+G + +   Y    L+++EYYDYDF+ +D + I K+D+GV H
Sbjct: 82  SFLSGMGIGVSTQNGRSLLGSSKSSENYKTIDLEDEEYYDYDFEDIDPEVISKFDDGVQH 141

Query: 109 YIISKGGMEALSSEDKEAFEREADMLLASTTDLYDLSQYNGASNGAANRDHVLLCVPLRD 168
           Y+IS+ G E L+ +D E ++RE +ML  ST + YDLS + GA NG   RDH+LLC+PLR+
Sbjct: 142 YLISQFGSEVLTPKDDEKYQRELNMLFDSTVEEYDLSNFEGAPNGLETRDHILLCIPLRN 201

Query: 169 AASLLPMLFKNLMNLTYPHELIDIAFLVSDCTDNGRTMSSLLDFSKELQNGTLSKTLQDF 228
           AA +LP++FK+LMNLTYPHELID+AFLVSDC++   T+ +L+ +S+ LQNGTLS+  Q+ 
Sbjct: 202 AADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRHLQNGTLSQIFQEI 261

Query: 229 EADKD-KGNSAEQLYLKYMGKDYLKMVKNAFNPPFHDDYDKPFRSIQIFEKDFGQQIGQG 287
           +A  D +    ++LYLKYM + Y+  V  AF+PPFH++YDKPFRS+QIF+KDFGQ IGQG
Sbjct: 262 DAVIDSQTKGTDKLYLKYMDEGYINRVHQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQG 321

Query: 288 FSDRHAVKVQGVRRKLMGRARNWLTANALKPYHSWVYWRDVDVELCPGTVIEDLMKHDYD 347
           FSDRHAVKVQG+RRKLMGRARNWLTANALKPYHSWVYWRD DVELCPG+VI+DLM  +YD
Sbjct: 322 FSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYD 381

Query: 348 VIVPNVWRPLPTFLGGAQAYDLNSWVESNEAIKLAKTLDEDDVIVEGYAEYPTWRVHLGY 407
           VIVPNVWRPLPTFLG  Q YDLNSW+ES EA+ LAKTLDEDDVIVEGYAEYPTWRVHL Y
Sbjct: 382 VIVPNVWRPLPTFLGTEQPYDLNSWMESQEALALAKTLDEDDVIVEGYAEYPTWRVHLAY 441

Query: 408 LRKDNGNPXXXXXXXXXXXXSILARAQLFRKGIHFPAFTFENHAETEAFGKMAKKMGFKV 467
           +R   G+P            SILA+A++FR G+ FPAFTFENHAETEAFGKMAKKMG++V
Sbjct: 442 IRDAEGDPNEAVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRV 501

Query: 468 GGLMHYTLWHIYEPSDDDLREIAKLERESRR 498
           GGL HYT+WHIYEPSDDDL+EIA  ERE RR
Sbjct: 502 GGLPHYTIWHIYEPSDDDLKEIASREREKRR 532

>Suva_13.28 Chr13 complement(39946..41538) [1593 bp, 530 aa] {ON}
           YML115C (REAL)
          Length = 530

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/499 (60%), Positives = 378/499 (75%), Gaps = 10/499 (2%)

Query: 6   KDKRLELPMHHDSKQ-KGNH-FRPKSGFGLFFAKINGLRYAKSRIVFLFALVL-VSTFLL 62
           KDKR     HH+SK  KG + ++P+S    F   +N +      ++ L+ ++L +S   L
Sbjct: 34  KDKR----SHHESKSLKGKYMYQPRSSSSKFQLAVNVISLVIIIVLSLYLMILFLSEMKL 89

Query: 63  LSKLVGGNVNL--MQYIPTSLDEQEYYDYDFKGLDIDTIKKYDEGVSHYIISKGGMEALS 120
              +  GN  L    Y    L+++EYY+YDF+ +D + + K+D+GV HY+I++ G E L+
Sbjct: 90  GISIQNGNPLLGSENYKTIDLEDEEYYNYDFEDIDPEVVSKFDDGVQHYLITQFGSEVLT 149

Query: 121 SEDKEAFEREADMLLASTTDLYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNL 180
             D E ++ E  MLL ST + YDL+ + GA NG   RDH+LLC+PLR+AA +LP++FK+L
Sbjct: 150 PGDNEKYQEEMSMLLDSTVEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHL 209

Query: 181 MNLTYPHELIDIAFLVSDCTDNGRTMSSLLDFSKELQNGTLSKTLQDFEADKD-KGNSAE 239
           MNLTYPHELID+AFLVSDC++   T+ +L+ +S++LQNGTLS+  Q+ +A  D +    +
Sbjct: 210 MNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTD 269

Query: 240 QLYLKYMGKDYLKMVKNAFNPPFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGV 299
           +LYLKYM +DY+  V  AF+PPFHD+YDKPFRS+Q+F+KDFGQ IGQGFSDRHAVKVQG+
Sbjct: 270 KLYLKYMDEDYINRVHQAFSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGI 329

Query: 300 RRKLMGRARNWLTANALKPYHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPT 359
           RRKLMGRARNWLTANALKPYHSWVYWRD DVELCPG+VI+DLM  +YDVIVPNVWRPLPT
Sbjct: 330 RRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPT 389

Query: 360 FLGGAQAYDLNSWVESNEAIKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXX 419
           FL   Q YDLNSW+ES EA+ LAKTLDEDDVIVEGYAEYPTWRVHL Y+R   G+P    
Sbjct: 390 FLNSEQPYDLNSWMESGEALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVV 449

Query: 420 XXXXXXXXSILARAQLFRKGIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIY 479
                   SILA+A++FR G+ FPAFTFENHAETEAFGKMAKKMG++VGGL HYT+WHIY
Sbjct: 450 DLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIY 509

Query: 480 EPSDDDLREIAKLERESRR 498
           EPSDDDL+EIA  ERE RR
Sbjct: 510 EPSDDDLKEIATREREKRR 528

>ZYRO0G14234g Chr7 (1134555..1136084) [1530 bp, 509 aa] {ON} similar
           to uniprot|P23642 Saccharomyces cerevisiae YML115C VAN1
           Mannosyltransferase with a role in protein N-
           glycosylation
          Length = 509

 Score =  622 bits (1605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/463 (63%), Positives = 360/463 (77%), Gaps = 15/463 (3%)

Query: 48  IVFLFALVLVSTFLLLSKLVGGNVNLMQYIPTS--------LDEQEYYDYDFKGLDIDTI 99
           I+ +  L+L   F   S +V G   +M+ + ++        L+E  YYDYDF+ +D   I
Sbjct: 49  IITVMVLILYKAF---SGVVRGGREVMKTVGSNTSSNDGQVLEEDAYYDYDFEDIDPKVI 105

Query: 100 KKYDEGVSHYIISKGGMEALSSEDKEAFEREADMLLASTTDLYDLSQYNGASNGAANRDH 159
           +K+D GV HY+I++ G + L+ +D E FERE  MLL+ST + YDLS + G++NGAAN +H
Sbjct: 106 EKFDGGVQHYLITQFGNDVLTPQDGEVFEREQKMLLSSTVESYDLSMFRGSANGAANGEH 165

Query: 160 VLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSDCTDNGRTMSSLLDFSKELQNG 219
           VLLCVPLRDA  +LP++FK+LMNLTYPHELID+AFLVSDCT++ +T+ +L+ +S++LQ+G
Sbjct: 166 VLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSDCTEDDKTLDALIAYSRQLQSG 225

Query: 220 TLSKTLQDFEADKDK----GNSAEQLYLKYMGKDYLKMVKNAFNPPFHDDYDKPFRSIQI 275
           TLS+   D +    +        E+LYLKYM  DYL+ VK +F+PPFH++YDKPFRS+Q+
Sbjct: 226 TLSQVFADMDQAAAEAEQASKGTEKLYLKYMNPDYLETVKESFSPPFHENYDKPFRSVQV 285

Query: 276 FEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANALKPYHSWVYWRDVDVELCPG 335
           F+KDFGQ IGQGFSDRHAVKVQG+RRKLMGRARNWLTANALKPYHSWVYWRD DVELCPG
Sbjct: 286 FQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPG 345

Query: 336 TVIEDLMKHDYDVIVPNVWRPLPTFLGGAQAYDLNSWVESNEAIKLAKTLDEDDVIVEGY 395
           +VIEDLM  DYDV VPNVWRPLP FL G Q YDLNSW+ES EA+ LAKTLDEDDVIVEGY
Sbjct: 346 SVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDLNSWMESGEALNLAKTLDEDDVIVEGY 405

Query: 396 AEYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXSILARAQLFRKGIHFPAFTFENHAETEA 455
           AEYPT+RVHL Y+R    +P            SILA+A+LFR+GI FPAFTFENHAETE 
Sbjct: 406 AEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSILAKAELFRRGIQFPAFTFENHAETEG 465

Query: 456 FGKMAKKMGFKVGGLMHYTLWHIYEPSDDDLREIAKLERESRR 498
           FGKMAKKMG++VGGL HYTLWHIYEPSDDDLREIA  ERESRR
Sbjct: 466 FGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLREIANKERESRR 508

>Skud_13.26 Chr13 complement(39821..41440) [1620 bp, 539 aa] {ON}
           YML115C (REAL)
          Length = 539

 Score =  622 bits (1605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/452 (63%), Positives = 356/452 (78%), Gaps = 16/452 (3%)

Query: 55  VLVSTFLLLSKLVGGNVNL---------------MQYIPTSLDEQEYYDYDFKGLDIDTI 99
            ++S +LL+S+L G NVN+                 Y    L+++EYY+YDF+ +D + I
Sbjct: 73  TVLSLYLLISRLAGLNVNVSLRDGKSLLSPSESSENYKTIDLEDEEYYNYDFEDIDPEVI 132

Query: 100 KKYDEGVSHYIISKGGMEALSSEDKEAFEREADMLLASTTDLYDLSQYNGASNGAANRDH 159
            K+D G  HY+IS+ G E L  E++E +++E +MLL ST + YDLS + GA NG   RDH
Sbjct: 133 SKFDGGEQHYLISQFGSEVLPPENEEEYQKELNMLLDSTVEKYDLSDFEGAPNGLETRDH 192

Query: 160 VLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSDCTDNGRTMSSLLDFSKELQNG 219
           +LLC+PLR+AA +LP++FK+LMNLTYPHELID+AFLVSDC++   T+ +L+ +S++LQNG
Sbjct: 193 ILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQLQNG 252

Query: 220 TLSKTLQDFEADKD-KGNSAEQLYLKYMGKDYLKMVKNAFNPPFHDDYDKPFRSIQIFEK 278
           TLS+  QD +A  D +    ++LYLKYM +DY+  V  AF+PPFHD+YDKPFRS+QIF+K
Sbjct: 253 TLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNYDKPFRSVQIFQK 312

Query: 279 DFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANALKPYHSWVYWRDVDVELCPGTVI 338
           DFGQ IGQGFSDRHAVKVQG+RRKLMGRARNWLTANALKPYHSWVYWRD DVELCPG+VI
Sbjct: 313 DFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVI 372

Query: 339 EDLMKHDYDVIVPNVWRPLPTFLGGAQAYDLNSWVESNEAIKLAKTLDEDDVIVEGYAEY 398
           EDLM  +YDV+VPNVWRPLPTFL   QAYDLNSW+ES EA++LAKTLDEDDVIVEGYAEY
Sbjct: 373 EDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESREALELAKTLDEDDVIVEGYAEY 432

Query: 399 PTWRVHLGYLRKDNGNPXXXXXXXXXXXXSILARAQLFRKGIHFPAFTFENHAETEAFGK 458
           PTWRVHL Y+R   GNP            SILA+A++FR G+ FPAFTFENHAETEAFGK
Sbjct: 433 PTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGK 492

Query: 459 MAKKMGFKVGGLMHYTLWHIYEPSDDDLREIA 490
           MAKKMG++VGGL HYT+WHIYEPSDDDL+EIA
Sbjct: 493 MAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIA 524

>NDAI0E00290 Chr5 complement(39735..41238,41371..41435) [1569 bp,
           522 aa] {ON} Anc_8.842
          Length = 522

 Score =  619 bits (1596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/513 (58%), Positives = 374/513 (72%), Gaps = 22/513 (4%)

Query: 6   KDKRLELPMHHDSKQ-----KGNHFRPKSGFGLFFAKINGLRYAKSRIVFLFALVLVSTF 60
           KD +LELP+  ++       K   F PK       AK   +    S I+        S F
Sbjct: 14  KDAKLELPISRNNSNVADELKKQRFIPKKKST---AKNVAIGSVVSFIICALIYCGYSYF 70

Query: 61  LLLSKLVGGNVNL---------MQYIPTSLDEQEYYDYDFKGLDIDTIKKYDEGVSHYII 111
              S  +G  +NL           Y  T L ++EYY+YDF+ ++ D + K++ GV HY+I
Sbjct: 71  FNTSPRLG-KINLYANKNNKVSTSYKTTELSDKEYYNYDFENIEADVLGKFENGVQHYLI 129

Query: 112 SKGGMEALSSEDKEAFEREADMLLASTTDLYDLSQYNGASNGAANRDHVLLCVPLRDAAS 171
           S+ G + L+ +DKE +E+E  MLL ++ + YDL +++G+ NGA NRDH+LLCVPLRDA S
Sbjct: 130 SEFGTDVLTPKDKEQYEKELAMLLDASVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAES 189

Query: 172 LLPMLFKNLMNLTYPHELIDIAFLVSDCTDNGRTMSSLLDFSKELQNGTLSKTLQDFEA- 230
           +LP++FK+LMN+TYPHELID+AFLVSDC+D   T+ +LL +S+ LQNGTLS+  QD +  
Sbjct: 190 VLPLMFKHLMNMTYPHELIDLAFLVSDCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEY 249

Query: 231 ---DKDKGNSAEQLYLKYMGKDYLKMVKNAFNPPFHDDYDKPFRSIQIFEKDFGQQIGQG 287
                D     + L+LKYM ++YLKMV+ AFN P H++YDKPFRS+QIF KDFGQ IGQG
Sbjct: 250 QYEHSDDTRGTKNLHLKYMNQEYLKMVETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQG 309

Query: 288 FSDRHAVKVQGVRRKLMGRARNWLTANALKPYHSWVYWRDVDVELCPGTVIEDLMKHDYD 347
           FSDRHAVKVQG+RRKLMGRARNWL ANALKPYHSWVYWRD D+ELCPGT++ED+M +DYD
Sbjct: 310 FSDRHAVKVQGIRRKLMGRARNWLMANALKPYHSWVYWRDADIELCPGTIVEDMMANDYD 369

Query: 348 VIVPNVWRPLPTFLGGAQAYDLNSWVESNEAIKLAKTLDEDDVIVEGYAEYPTWRVHLGY 407
           V+VPNVWRPLP FL   Q YDLNSW+ES+EA+KLAKTL EDDVIVEGYAEYPTWRVHL Y
Sbjct: 370 VLVPNVWRPLPEFLDSEQPYDLNSWIESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAY 429

Query: 408 LRKDNGNPXXXXXXXXXXXXSILARAQLFRKGIHFPAFTFENHAETEAFGKMAKKMGFKV 467
           +R+  G+P            SILA+A+LFR G+HFPAFTFENHAETE FGKMAK+MG++V
Sbjct: 430 IREAQGDPTSVVDLDGVGGVSILAKAKLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRV 489

Query: 468 GGLMHYTLWHIYEPSDDDLREIAKLERESRRNQ 500
           GGL HYT+WHIYEPSDDDL+EIA  ER+SR  +
Sbjct: 490 GGLPHYTIWHIYEPSDDDLKEIANKERQSRHKE 522

>KNAG0G03420 Chr7 (733195..734730) [1536 bp, 511 aa] {ON} Anc_8.842
           YML115C
          Length = 511

 Score =  618 bits (1593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/441 (64%), Positives = 351/441 (79%), Gaps = 7/441 (1%)

Query: 62  LLSKLVGGNVNLMQYIPTSLDEQEYYDYDFKGLDIDTIKKYDEGVSHYIISKGGMEALSS 121
           +L KL  GN N   Y   +L E EYY+YDF+ LD   I K+D+GV HY+IS+ G + L+ 
Sbjct: 73  ILKKLESGNHN---YKTVNLQENEYYNYDFETLDPHVIGKFDQGVQHYLISEFGNDVLTP 129

Query: 122 EDKEAFEREADMLLASTTDLYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLM 181
           +D+E +E E   L  ST   YDL+++ G+ +G  NRDHVL+CVPLRDA  +LP++FK+LM
Sbjct: 130 KDQERYEAEVKQLFDSTVQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLM 189

Query: 182 NLTYPHELIDIAFLVSDCTDNGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAE-- 239
           NLTYPHELID+AFLVSDC+D+  T+ +L+ +S++LQNGTLS+   + +A  D  N+ +  
Sbjct: 190 NLTYPHELIDVAFLVSDCSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRK 249

Query: 240 --QLYLKYMGKDYLKMVKNAFNPPFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQ 297
             +LYLKYM ++YL  V+ AF PP+H++YDKPFRS+QIFEK+FGQ IGQGFSDRHAVKVQ
Sbjct: 250 NNKLYLKYMKQEYLNKVEKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQ 309

Query: 298 GVRRKLMGRARNWLTANALKPYHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPL 357
           G+RRKLMGR+RNWLTANALKPYHSWVYWRD D+ELCPG+VI+D+M  DYDV+VPNVWRPL
Sbjct: 310 GIRRKLMGRSRNWLTANALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPL 369

Query: 358 PTFLGGAQAYDLNSWVESNEAIKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXX 417
           P FL G Q YDLNSW+ES EA++LA+TLDEDDVIVEGYAEYPTWRVHL Y+R + G+P  
Sbjct: 370 PEFLNGEQPYDLNSWMESPEALELAETLDEDDVIVEGYAEYPTWRVHLAYIRDEEGDPSE 429

Query: 418 XXXXXXXXXXSILARAQLFRKGIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWH 477
                     SILARA+LFR G+ FPAFTFENHAETEAFGKMA+K+GF+VGGL HYTLWH
Sbjct: 430 VVDLDGVGGVSILARAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWH 489

Query: 478 IYEPSDDDLREIAKLERESRR 498
           IYEPSDDDLREIA  ERE RR
Sbjct: 490 IYEPSDDDLREIANKEREKRR 510

>TDEL0B00560 Chr2 complement(107343..108872) [1530 bp, 509 aa] {ON}
           Anc_8.842 YML115C
          Length = 509

 Score =  612 bits (1578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/470 (62%), Positives = 362/470 (77%), Gaps = 10/470 (2%)

Query: 39  NGLRYAKSRIVFLFALVLVSTFLLLSKLVGGN---------VNLMQYIPTSLDEQEYYDY 89
           NG R  +     L +++    F  LS ++ G+         +    Y   +L ++ YYDY
Sbjct: 39  NGSRVKRIANWALISVICFLMFKFLSTVILGSSESSSPLPSIWTKSYDTITLSDEAYYDY 98

Query: 90  DFKGLDIDTIKKYDEGVSHYIISKGGMEALSSEDKEAFEREADMLLASTTDLYDLSQYNG 149
           DF+ +D D IKK+D GV++Y I++ G E ++SE+   FE+E  MLL ST + YD+ Q+ G
Sbjct: 99  DFENIDPDVIKKFDNGVTYYKITQFGEETMTSEETTKFEQEVSMLLDSTVEKYDMEQFRG 158

Query: 150 ASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSDCTDNGRTMSSL 209
            +N A N++HVLLCVPLRDA ++LP++FK+LMN+TYPHELID+AFLVSDC++   T+ +L
Sbjct: 159 TTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFLVSDCSEGDHTLDAL 218

Query: 210 LDFSKELQNGTLSKTLQDFE-ADKDKGNSAEQLYLKYMGKDYLKMVKNAFNPPFHDDYDK 268
           + +S++LQNGTLS+   + E ++K++    E LYL+YM +DYL+ VK++F+PPFH++YDK
Sbjct: 219 IAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQRVKDSFSPPFHENYDK 278

Query: 269 PFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANALKPYHSWVYWRDV 328
            FRS+QIF+KDFGQ+IGQGFSDRHAVKVQG+RRKLM RARNWLTANALKPYHSWVYWRD 
Sbjct: 279 SFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLTANALKPYHSWVYWRDA 338

Query: 329 DVELCPGTVIEDLMKHDYDVIVPNVWRPLPTFLGGAQAYDLNSWVESNEAIKLAKTLDED 388
           DVELCPG+VI+DLM  DYDV+VPNVWRPLP FL G Q YDLNSW+ES EA+ LAKTLDED
Sbjct: 339 DVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYDLNSWIESREALDLAKTLDED 398

Query: 389 DVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXSILARAQLFRKGIHFPAFTFE 448
           DVIVEGYAEYPTWR HL Y R  NG+P            SILARA+LFR GIHFPAFTFE
Sbjct: 399 DVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILARARLFRLGIHFPAFTFE 458

Query: 449 NHAETEAFGKMAKKMGFKVGGLMHYTLWHIYEPSDDDLREIAKLERESRR 498
           NHAETEAFGKMAKKMGF+VGGL HYTLWHIYEPSDDDL+EI   ERE RR
Sbjct: 459 NHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKEIGNKEREKRR 508

>Smik_13.19 Chr13 complement(36444..38054) [1611 bp, 536 aa] {ON}
           YML115C (REAL)
          Length = 536

 Score =  611 bits (1575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/494 (58%), Positives = 370/494 (74%), Gaps = 12/494 (2%)

Query: 5   VKDKRLELPMHHDSKQKGNH-FRPKSGFGLFFAKINGLRYAKS-------RIVFLFALVL 56
           +KDKR    +H+    K  + ++P+S    F   +N +             I FL  + +
Sbjct: 33  IKDKRT---LHNSKSFKDKYVYQPRSKSSKFQMTVNAISLIIITILSLYLSISFLTGMSI 89

Query: 57  VSTFLLLSKLVGGNVNLMQYIPTSLDEQEYYDYDFKGLDIDTIKKYDEGVSHYIISKGGM 116
                    L+G + +   Y    L+++EYYDYDF+ +D + + K+D GV HY+IS+ G 
Sbjct: 90  GVPIQNGRPLLGSSKSSDNYKTIDLEDEEYYDYDFEDIDPEVVSKFDNGVEHYLISQFGS 149

Query: 117 EALSSEDKEAFEREADMLLASTTDLYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPML 176
           + L+ +D E ++ E  MLL ST + YDLS++ GASNG   RDH+LLCVPLR+AA +LP++
Sbjct: 150 DVLTPKDDEKYQSELSMLLDSTVEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLM 209

Query: 177 FKNLMNLTYPHELIDIAFLVSDCTDNGRTMSSLLDFSKELQNGTLSKTLQDFEADKD-KG 235
           FK+LMNLTYPHELID+AFLVSDC+++  T+ +L+ +S++LQNGTLS+  Q+ +A  D + 
Sbjct: 210 FKHLMNLTYPHELIDLAFLVSDCSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQT 269

Query: 236 NSAEQLYLKYMGKDYLKMVKNAFNPPFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVK 295
              ++LYL+YM ++Y+  V+ AF+PPFH++YDKPFRS+QIF+KDFGQ IGQGFSDRHAVK
Sbjct: 270 KGTDKLYLQYMDQNYINRVRQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVK 329

Query: 296 VQGVRRKLMGRARNWLTANALKPYHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWR 355
           VQG+RRKLMGRARNWLTANALKPYHSWVYWRD DVELCPG++I+DLM  +YDVIVPNVWR
Sbjct: 330 VQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWR 389

Query: 356 PLPTFLGGAQAYDLNSWVESNEAIKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNP 415
           PLPTFL   Q YDLNSW+ES E ++LAKTLDEDDVIVEGYAEYPTWRVHL Y+R   G+P
Sbjct: 390 PLPTFLESEQPYDLNSWMESKEGLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDP 449

Query: 416 XXXXXXXXXXXXSILARAQLFRKGIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTL 475
                       SILA+A+LFR G+ FPAFTFENHAETEAFGKMAKKMG++VGGL HYT+
Sbjct: 450 NEVIDLDGVGGVSILAKAKLFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTI 509

Query: 476 WHIYEPSDDDLREI 489
           WHIYEPSDDDL+EI
Sbjct: 510 WHIYEPSDDDLKEI 523

>NCAS0B00300 Chr2 complement(35915..37418,37529..37596) [1572 bp,
           523 aa] {ON} Anc_8.842
          Length = 523

 Score =  608 bits (1569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/493 (59%), Positives = 359/493 (72%), Gaps = 13/493 (2%)

Query: 17  DSKQKGNHFRPKSGFGLFFAKINGLRYAKSRIVFLFALVLVSTFLLLSKL-------VGG 69
           D +QK N F PK    L  + +  L      I+ ++     S   + SK         G 
Sbjct: 32  DEEQKKNSFVPKRRKTL--SSLMKLTVFSLLIIIVYIFWGSSLTEMTSKYDSVTNLHAGQ 89

Query: 70  NVNLMQYIPTSLDEQEYYDYDFKGLDIDTIKKYDEGVSHYIISKGGMEALSSEDKEAFER 129
           N     Y    L E EYYD+DF+ ++   +KK+D GV HY+IS+ G + L+  D E + +
Sbjct: 90  NTKTASYKTKQLTENEYYDHDFEDIEPAVVKKFDNGVQHYLISQYGTDVLTPSDNEVYAK 149

Query: 130 EADMLLASTTDLYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHEL 189
           E  M+L ++ + YDLS + G+SNGA NRDH+LLCVPLRDA  +LP++FK+LMNLTYPHEL
Sbjct: 150 ELQMVLDASVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHEL 209

Query: 190 IDIAFLVSDCTDNGRTMSSLLDFSKELQNGTLSKTLQD---FEAD-KDKGNSAEQLYLKY 245
           ID+AFLVSDC++  RT+ +LL +SK LQNGTLS+   +   +E D   K    + L+LKY
Sbjct: 210 IDLAFLVSDCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKY 269

Query: 246 MGKDYLKMVKNAFNPPFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMG 305
           M  DYLK+V  +F    H +YDKPFRSIQ+F+KDFGQ IGQGFSDRHAVKVQG+RRKLMG
Sbjct: 270 MNPDYLKLVDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMG 329

Query: 306 RARNWLTANALKPYHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTFLGGAQ 365
           RARNWL ANALKPYH+WVYWRD D+ELCPG+VIEDLM  DYDVIVPNVWRPLP FL G Q
Sbjct: 330 RARNWLMANALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQ 389

Query: 366 AYDLNSWVESNEAIKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXXX 425
            YDLNSW+ES+EA+KLAKTLDEDDVIVEGYAEYPTWRVHL Y+R   G+P          
Sbjct: 390 PYDLNSWIESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLDGVG 449

Query: 426 XXSILARAQLFRKGIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYEPSDDD 485
             SILA+A++FR G+ FPAFTFENHAETEAFGKMA+KMGF+VGGL HYT+WHIYEPSDDD
Sbjct: 450 GVSILAKAKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYEPSDDD 509

Query: 486 LREIAKLERESRR 498
           L EIA  ER+++R
Sbjct: 510 LMEIANKERQNKR 522

>KLTH0C03828g Chr3 complement(334500..335714) [1215 bp, 404 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 404

 Score =  587 bits (1513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/403 (67%), Positives = 324/403 (80%), Gaps = 2/403 (0%)

Query: 99  IKKYDEGVSHYIISKGGMEALSSEDKEAFEREADMLLASTTDLYDLSQYNGASNGAANRD 158
           ++K+D G  HY+ISKGG E L S DKE +E E   LL ST + YDL  + G++ G  NR+
Sbjct: 2   LRKFDNGAEHYLISKGGQEILDSSDKERYEEEVKSLLDSTVEHYDLRDFEGSAQGEVNRE 61

Query: 159 HVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSDCTDNGRTMSSLLDFSKELQN 218
           HVLL VPLR+A  +LP++FKNLMNLTYPHELID+AFLVSDC+++ +T+ +LL++ KELQ+
Sbjct: 62  HVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDKTLEALLEYCKELQS 121

Query: 219 GTLSKTLQDFEADKD--KGNSAEQLYLKYMGKDYLKMVKNAFNPPFHDDYDKPFRSIQIF 276
           GTLS       +D++  K      L+LKYM   YLKMVK+A++PPFH  YDKPFRS+QIF
Sbjct: 122 GTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKDAYSPPFHKGYDKPFRSVQIF 181

Query: 277 EKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANALKPYHSWVYWRDVDVELCPGT 336
           +KDFGQ IGQGFSDRHAVKVQG+RRKLMGRARNWLTANALKPYHSWVYWRD DVELCPG+
Sbjct: 182 QKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGS 241

Query: 337 VIEDLMKHDYDVIVPNVWRPLPTFLGGAQAYDLNSWVESNEAIKLAKTLDEDDVIVEGYA 396
           VI+DLM  D+DV VPNVWRPLP FL G Q YDLNSW+ES+ A++LA+TLDEDDVIVEGYA
Sbjct: 242 VIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESDPALQLAQTLDEDDVIVEGYA 301

Query: 397 EYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXSILARAQLFRKGIHFPAFTFENHAETEAF 456
           EYPTWRVHL YLR  + NP            SILA+A+LFR G+HFPAFTFENHAETEAF
Sbjct: 302 EYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLFRNGVHFPAFTFENHAETEAF 361

Query: 457 GKMAKKMGFKVGGLMHYTLWHIYEPSDDDLREIAKLERESRRN 499
           GKMAKKMG++V GL HYTLWHIYEPSDDDL +IA+ ERE +R+
Sbjct: 362 GKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAEREREKKRS 404

>TPHA0C04780 Chr3 (1031751..1033328) [1578 bp, 525 aa] {ON}
           Anc_1.479 YEL036C
          Length = 525

 Score =  591 bits (1523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/510 (57%), Positives = 365/510 (71%), Gaps = 29/510 (5%)

Query: 11  ELPMHHDSKQKGNH--FRPKSGFGLFFAKINGLRYAKSRIVFLFALVLVSTFLLLSKLVG 68
           +LP+   +K+K  +  FR    +  F  K+   R   S      +++L+  F+  +K + 
Sbjct: 17  KLPLSEKTKEKRKNRDFRLLPKYSKF--KVTNFRDKVSNFNVALSVILLCIFI--AKTIS 72

Query: 69  GNVNLMQYIP---------TSLDEQ-----EYYDYDFKGLDIDTIKKYDEGVSHYII--- 111
            NV++ +Y            + D Q     EYY+YDF   ++DTI KYD+GV  Y++   
Sbjct: 73  VNVSIYKYNSFVHEEETETVTFDTQVLTAPEYYNYDFHDYNLDTISKYDKGVRQYLLDTY 132

Query: 112 SKGGMEALSSEDKEAFEREADMLLASTTDLYDLSQYNGASNGAANRDHVLLCVPLRDAAS 171
               +  LS + KEA++ E   LL+S+ D+YD+  ++G S+G ++R+HVLLC+PLRDA  
Sbjct: 133 KTDDVSQLSVQAKEAYDAELPKLLSSSVDIYDMKDFSGTSHGVSSREHVLLCIPLRDAED 192

Query: 172 LLPMLFKNLMNLTYPHELIDIAFLVSDCTDNGRTMSSLLDFSKELQNGTLSKTLQDFE-- 229
           +LP++FKNLMNLTYPHELID+AFLVSDC++N  T+ SLL +++ LQNGTL    ++ +  
Sbjct: 193 VLPLMFKNLMNLTYPHELIDVAFLVSDCSENDHTLESLLQYTRFLQNGTLPDVFEEMDKL 252

Query: 230 ---ADKDKGNSAE-QLYLKYMGKDYLKMVKNAFNPPFHDDYDKPFRSIQIFEKDFGQQIG 285
               DK   N+ + +LYLKYM K+YL+ VK AF  PFH++YDKPFRSIQI++KDFGQ +G
Sbjct: 253 DEMTDKVVENADDSKLYLKYMKKEYLQRVKEAFKSPFHENYDKPFRSIQIYKKDFGQTVG 312

Query: 286 QGFSDRHAVKVQGVRRKLMGRARNWLTANALKPYHSWVYWRDVDVELCPGTVIEDLMKHD 345
           Q FSDRH VKVQG+RRKLMGRARNWL  NALKPYHSWVYWRD DVELCPGTVIEDLM  D
Sbjct: 313 QSFSDRHDVKVQGIRRKLMGRARNWLMTNALKPYHSWVYWRDADVELCPGTVIEDLMSKD 372

Query: 346 YDVIVPNVWRPLPTFLGGAQAYDLNSWVESNEAIKLAKTLDEDDVIVEGYAEYPTWRVHL 405
           +DVIVPNVWRPLP F+   Q YDLNSW+ES EAI LAK L ED+VIVEGYAEYPTWRVHL
Sbjct: 373 FDVIVPNVWRPLPEFMNSEQPYDLNSWMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHL 432

Query: 406 GYLRKDNGNPXXXXXXXXXXXXSILARAQLFRKGIHFPAFTFENHAETEAFGKMAKKMGF 465
            YLR+ +G+P            SILARA+LFR G+HFPAFTFENHAETEAFGKMAKKMGF
Sbjct: 433 AYLREKDGDPNQVVDVDGVGGVSILARARLFRAGVHFPAFTFENHAETEAFGKMAKKMGF 492

Query: 466 KVGGLMHYTLWHIYEPSDDDLREIAKLERE 495
           +VGGL HYTLWHIYEPSDDDL  IA  E+E
Sbjct: 493 RVGGLPHYTLWHIYEPSDDDLMAIATKEKE 522

>Ecym_4613 Chr4 (1195057..1196631) [1575 bp, 524 aa] {ON} similar to
           Ashbya gossypii ABL124W
          Length = 524

 Score =  590 bits (1521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/429 (65%), Positives = 337/429 (78%), Gaps = 7/429 (1%)

Query: 76  YIPTSLDEQEYYDYDFKGLDIDTIKKYDEGVSHYIISKGGMEALSSEDKEAFEREADMLL 135
           Y    L+E EYY+++++ LD+DT+++YD+G  H +I + G   L+S  +E FE   DMLL
Sbjct: 98  YDTAVLEESEYYNFEYRPLDLDTVRRYDDGFKHILIDQDG--TLNSNQEEGFEEHLDMLL 155

Query: 136 ASTTDLYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFL 195
           ++T + YDLS+Y G +NGA NR+HVL+CVPLR+A ++LP++F++LMNLTYPHELID+AFL
Sbjct: 156 STTVETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFL 215

Query: 196 VSDCTDNGRTMSSLLDFSKELQNGTLSKTLQDFEA----DKDKGNSAE-QLYLKYMGKDY 250
           VSDC+ +  TM SL+ +++ELQ GTLSK+L+  +A     K K  + E  L+LKYM KDY
Sbjct: 216 VSDCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYKMHKKSKSKNKEGDLHLKYMNKDY 275

Query: 251 LKMVKNAFNPPFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNW 310
           L MV+NA   PFH +YDKPFRS+QIF+KDFGQ IGQGFSDRH VKVQG RRKLMG+ARNW
Sbjct: 276 LNMVENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNW 335

Query: 311 LTANALKPYHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTFLGGAQAYDLN 370
           LTANALKPYHSWVYWRD DVELCPG+VIEDLM   YDVIVPNVWRPLP FLG  Q YDLN
Sbjct: 336 LTANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQEYDLN 395

Query: 371 SWVESNEAIKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXSIL 430
           SW+ES+ A+ LAKTLDEDDVIVEGYAEY TWR HL   R   GN             SIL
Sbjct: 396 SWIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSIL 455

Query: 431 ARAQLFRKGIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYEPSDDDLREIA 490
           A+A+LFR G+HF AF FENHAETEAFGKMAKKMG++VGGL HYTLWHIYEPS+DDL EIA
Sbjct: 456 AKAKLFRNGVHFAAFAFENHAETEAFGKMAKKMGYRVGGLSHYTLWHIYEPSNDDLMEIA 515

Query: 491 KLERESRRN 499
           + ER SRR+
Sbjct: 516 RKERSSRRS 524

>ABL124W Chr2 (162889..164346) [1458 bp, 485 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML115C (VAN1)
          Length = 485

 Score =  586 bits (1511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/485 (57%), Positives = 355/485 (73%), Gaps = 33/485 (6%)

Query: 45  KSRIVFLFALVLVSTFLLLSKLVGG-------------------------NVNLMQYIPT 79
           K + V +F  V++   L++ +LVG                          +    ++ P 
Sbjct: 4   KLKHVAMFVWVMICGTLVVRQLVGSGEREVILVDREVPMEEREVFVDVSDDERAAEWEPQ 63

Query: 80  SLDEQEYYDYDFKGLDIDTIKKYDEGVSHYIISKGGMEALSSEDKEAFEREADMLLASTT 139
            LD+ EYYDY+F     + + KYDEG  HY +++ G   +S +D E FE + + L+++T 
Sbjct: 64  VLDDPEYYDYEFAAASAERLAKYDEGFEHYFVTRDGQ--ISRDDPE-FEEQMEELVSATV 120

Query: 140 DLYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSDC 199
           + YDL  Y G  NGA NR+HVL+C+PLR+A  +LPM+FK+LMNLTYPHELID+AFLVSDC
Sbjct: 121 EQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSDC 180

Query: 200 TDNGRTMSSLLDFSKELQNGTLSKTLQDFEADKDK-----GNSAEQLYLKYMGKDYLKMV 254
           ++N +T+ SL++++  LQ GTL+  L   EA+  +     GN    LYLKYM ++YL+MV
Sbjct: 181 SENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQMV 240

Query: 255 KNAFNPPFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTAN 314
           ++AF+PP+H++Y+KPFRS+Q+F+KDFGQ+IGQGFSDRH VKVQG+RR+LMGRARNWLTAN
Sbjct: 241 RDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLTAN 300

Query: 315 ALKPYHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTFLGGAQAYDLNSWVE 374
           ALKPYHSWVYWRDVDVELCPG+VIEDLM   YDVIVPNVWRPLP FLGG Q YDLNSW+E
Sbjct: 301 ALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNSWIE 360

Query: 375 SNEAIKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXSILARAQ 434
           S +A+ LAK L+EDDVIVEGYAEY TWR HL   R+  GNP            SILA+A+
Sbjct: 361 STDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILAKAK 420

Query: 435 LFRKGIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYEPSDDDLREIAKLER 494
           LFR+G HF AF FENHAETEAFGKMAKKMG+KVGGL HYTLWHIYEPSDDD+ +IA+ ER
Sbjct: 421 LFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIARRER 480

Query: 495 ESRRN 499
           E+RR+
Sbjct: 481 ENRRS 485

>CAGL0B02321g Chr2 (220222..221760) [1539 bp, 512 aa] {ON} similar
           to uniprot|P23642 Saccharomyces cerevisiae YML115c VAN1
           Vanadate resistance protein
          Length = 512

 Score =  582 bits (1500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/420 (63%), Positives = 333/420 (79%), Gaps = 1/420 (0%)

Query: 75  QYIPTSLDEQEYYDYDFKGLDIDTIKKYDEGVSHYIISKGGMEALSSEDKEAFEREADML 134
           +Y+P    +  Y+ +DF+ +D+D + K+D+G+ +Y+IS+ G E  S  D   +     ML
Sbjct: 92  EYLPFEFKDAAYHSFDFEDIDMDIVSKFDQGIMNYLISEYGTENPSESDLAEYNDNLQML 151

Query: 135 LASTTDLYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAF 194
           L ST + YDL  + G+++G   ++H+L+CVPLRDA  +LP++FKNLMNLTYPHELID+AF
Sbjct: 152 LDSTVEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAF 211

Query: 195 LVSDCTDNGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMGKDYLKMV 254
           LVSDC++  +T+ +L  +S+ LQ G L   L D + + +KG S E ++LKYM  DYLK V
Sbjct: 212 LVSDCSEGDKTLEALETYSQLLQEGILPDILADMD-NYNKGKSNESIHLKYMEPDYLKRV 270

Query: 255 KNAFNPPFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTAN 314
           K A+ PPFH +Y KPFRS+QIF+KDFGQ IGQGFSDRHAVKVQG+RRKLMGRARNWL +N
Sbjct: 271 KAAYKPPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSN 330

Query: 315 ALKPYHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTFLGGAQAYDLNSWVE 374
           ALKPYHSWVYWRD DVELCPG+VIEDLM  DYDVIVPNVWRPLP FL  AQ YDLNSW+E
Sbjct: 331 ALKPYHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWME 390

Query: 375 SNEAIKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXSILARAQ 434
           SNEA++LAKTLDEDDVIVEGYAEYPT+RVHL Y+R+++G+P            SILARA+
Sbjct: 391 SNEALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARAR 450

Query: 435 LFRKGIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYEPSDDDLREIAKLER 494
           +FR+G+HF AFTFENHAETEAFGKMAKK+GF+VGGL HYTLWHIYEPSDDDL  +AKLE+
Sbjct: 451 VFREGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAMAKLEK 510

>TBLA0B03270 Chr2 (762231..763793) [1563 bp, 520 aa] {ON} Anc_8.842
           YML115C
          Length = 520

 Score =  579 bits (1492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/418 (63%), Positives = 334/418 (79%), Gaps = 4/418 (0%)

Query: 81  LDEQEYYDYDFKGLDIDTIKKYDEGVSHYIISKGGMEALSSEDKEAFEREADMLLASTTD 140
           L++ EYYDYDF+ +D  +   +D+G  HY+I++ G + ++S+DKE + +E + LL+S+ D
Sbjct: 97  LEDVEYYDYDFRSIDEMSFHNFDQGEQHYLITQYGGDVVTSKDKERYIQEMENLLSSSVD 156

Query: 141 LYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSDCT 200
            YDLSQ+ G +NGA NR+H+L   PLRDA  +LPM+FK+LMNLTYPHELIDIAFLVSDC+
Sbjct: 157 KYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSDCS 216

Query: 201 DNGRTMSSLLDFSKELQNGTLSKTLQDFEAD----KDKGNSAEQLYLKYMGKDYLKMVKN 256
           +  +T+ +L+ F++ LQ+GTL    +D +A     + K  +  + YLK+M ++Y+KM   
Sbjct: 217 EGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHYLKFMDQNYIKMADA 276

Query: 257 AFNPPFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANAL 316
           +F  P H++Y+KPFRS+QIF+KDFGQ IGQGFSDRHAVKVQG+RRKLMGRARNWLTANAL
Sbjct: 277 SFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 336

Query: 317 KPYHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTFLGGAQAYDLNSWVESN 376
           KPYHSWVYWRD DVELCPG+VI+DLM  +YDVIVPNVWRPLP FL   Q YDLNSW+ES 
Sbjct: 337 KPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKEQPYDLNSWMESG 396

Query: 377 EAIKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXSILARAQLF 436
           EA++LAKTLDEDDVIVEGYAEYPTWRVHL YLR  NG+P            SILA+A+LF
Sbjct: 397 EALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSILAKAKLF 456

Query: 437 RKGIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYEPSDDDLREIAKLER 494
           R G+HFPAFTFENHAETEAFGKMAKKMG+ VGGL +Y LWHIYEPSDDDL+++A +ER
Sbjct: 457 RHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYEPSDDDLKDMAAIER 514

>Kwal_27.10246 s27 complement(260882..261901) [1020 bp, 339 aa] {ON}
           YML115C (VAN1) - mannosyltransferase [contig 38] FULL
          Length = 339

 Score =  518 bits (1334), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 240/338 (71%), Positives = 280/338 (82%), Gaps = 2/338 (0%)

Query: 164 VPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSDCTDNGRTMSSLLDFSKELQNGTLSK 223
           VPLR+A  +LP++FKNLMNLTYPHELID+AFLVSDC+++ RT  +LL+++KELQ+GTLS+
Sbjct: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61

Query: 224 TLQDFEADKD--KGNSAEQLYLKYMGKDYLKMVKNAFNPPFHDDYDKPFRSIQIFEKDFG 281
                 + ++  +   +  L+LKYM   YLKMVK+AF PPFH +YDKPFRS+QIF+K+FG
Sbjct: 62  VFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFG 121

Query: 282 QQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANALKPYHSWVYWRDVDVELCPGTVIEDL 341
           Q IGQ FSDRHAVKVQG RRKLMGRARNWLTANALKPYHSWVYWRD DVELCPG+VIEDL
Sbjct: 122 QVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDL 181

Query: 342 MKHDYDVIVPNVWRPLPTFLGGAQAYDLNSWVESNEAIKLAKTLDEDDVIVEGYAEYPTW 401
           M   YDV VPNVWRPLP FL G QAYDLNSWVES+ A+ LAK LDEDDVIVEGYAEYPTW
Sbjct: 182 MATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTW 241

Query: 402 RVHLGYLRKDNGNPXXXXXXXXXXXXSILARAQLFRKGIHFPAFTFENHAETEAFGKMAK 461
           RVHLGY+R+++G+P            SILA+AQLFR G+HFPAFTFENHAETEAFGKMAK
Sbjct: 242 RVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAK 301

Query: 462 KMGFKVGGLMHYTLWHIYEPSDDDLREIAKLERESRRN 499
           KMG+ V GL HYTLWHIYEPSDDDL ++ + ERES+R 
Sbjct: 302 KMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERESKRQ 339

>NCAS0G04110 Chr7 (766896..768380) [1485 bp, 494 aa] {ON} Anc_1.479
          Length = 494

 Score =  380 bits (976), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 189/360 (52%), Positives = 228/360 (63%), Gaps = 46/360 (12%)

Query: 139 TDLYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSD 198
            + YDL  Y G  +G    D +L CVPLRDAA  LPM F +L  +TYPH LID++FLVSD
Sbjct: 82  VEFYDLGNYQGNKDGWQRNDRILFCVPLRDAAEHLPMFFDHLNKMTYPHNLIDLSFLVSD 141

Query: 199 CTDNGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMGKDYLKMVKNAF 258
            +DN  TM            G L   LQ+ ++ +D+                        
Sbjct: 142 SSDN--TM------------GVLLSNLQNAQSQQDRS----------------------- 164

Query: 259 NPPFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANALKP 318
                    K F +I+IFEKDFGQ IGQ FSDRH  K QG RRKLM RARNWL + A+KP
Sbjct: 165 ---------KRFGNIEIFEKDFGQIIGQSFSDRHGFKAQGPRRKLMARARNWLGSVAIKP 215

Query: 319 YHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTFLGGAQAYDLNSWVESNEA 378
           YHSWVYWRDVDVE  P T++EDLM HD DVIVPNVWRPLP +LG  Q YDLNSW ES   
Sbjct: 216 YHSWVYWRDVDVETIPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWQESEGG 275

Query: 379 IKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXSILARAQLFRK 438
           ++LA +LDED VIVEGY EY TWR HL Y+R  NGNP            SIL++A++FR 
Sbjct: 276 LQLANSLDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELNGIGGVSILSKAKVFRS 335

Query: 439 GIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYEPSDDDLREIAKLERESRR 498
           G HFPAF+FE HAETEAFGK++++M F V GL HY +WHIYEPS +DL+ +A +  E +R
Sbjct: 336 GSHFPAFSFEKHAETEAFGKLSRRMNFNVIGLPHYVIWHIYEPSKEDLKHMAWMAEEEKR 395

>Ecym_3573 Chr3 complement(1085088..1086431) [1344 bp, 447 aa] {ON}
           similar to Ashbya gossypii AFR357W
          Length = 447

 Score =  378 bits (971), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 189/360 (52%), Positives = 229/360 (63%), Gaps = 46/360 (12%)

Query: 139 TDLYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSD 198
            D YDLS Y G  +G    D VL CVPLRDAA+ LPM FK+L ++TYPH LID++FLVSD
Sbjct: 50  VDYYDLSNYQGNKDGWQRADRVLFCVPLRDAANHLPMFFKHLKSMTYPHNLIDLSFLVSD 109

Query: 199 CTDNGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMGKDYLKMVKNAF 258
            TD+  TM            G L  +L D ++  D                         
Sbjct: 110 STDD--TM------------GVLLNSLHDLQSQADGT----------------------- 132

Query: 259 NPPFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANALKP 318
                    K F  I+IF+KDFGQ IGQ FSDRH    QG RRKLM RARNWL + A+KP
Sbjct: 133 ---------KRFGDIEIFQKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSAAIKP 183

Query: 319 YHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTFLGGAQAYDLNSWVESNEA 378
           YHSWVYWRDVDVE  P T++EDLM HD D+IVPNVWRPLP +L   Q YDLNSWVES   
Sbjct: 184 YHSWVYWRDVDVEYVPETILEDLMHHDKDIIVPNVWRPLPKWLNYIQPYDLNSWVESEGG 243

Query: 379 IKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXSILARAQLFRK 438
           ++LA +L EDDVIVEGY EY TWRVHL Y+R  NG+P            SIL++A++FR 
Sbjct: 244 LQLAASLKEDDVIVEGYPEYATWRVHLAYMRDPNGDPETEMELDGIGGVSILSKAKVFRT 303

Query: 439 GIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYEPSDDDLREIAKLERESRR 498
           G HFPAF+FE HAETEAFGK++++M + V GL HY +WH+YEPS DDL+ +A +  E +R
Sbjct: 304 GSHFPAFSFEKHAETEAFGKLSRRMKYSVVGLPHYVIWHVYEPSSDDLKHMAWMAEEEQR 363

>CAGL0L01331g Chr12 complement(151156..152499) [1344 bp, 447 aa]
           {ON} highly similar to uniprot|P32629 Saccharomyces
           cerevisiae YEL036c ANP1 required for protein
           glycosylation in the golgi
          Length = 447

 Score =  378 bits (970), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 192/360 (53%), Positives = 230/360 (63%), Gaps = 48/360 (13%)

Query: 139 TDLYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSD 198
            + YDL+ Y G  +G    D +L CVPLRDAA  LPM F +L  +TYPH LID++FLVSD
Sbjct: 54  VEFYDLNDYTGLPDGWQRNDRILFCVPLRDAAEHLPMFFDHLNAMTYPHHLIDLSFLVSD 113

Query: 199 CTDNGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMGKDYLKMVKNAF 258
            +DN  TM            G L   LQ  +A KDK                        
Sbjct: 114 SSDN--TM------------GVLMHHLQ--QAQKDK------------------------ 133

Query: 259 NPPFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANALKP 318
                   +K F +I+IFEKDFGQ IGQ FSDRH    QG RRKLM RARNWL + A+KP
Sbjct: 134 --------NKRFGNIEIFEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVAIKP 185

Query: 319 YHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTFLGGAQAYDLNSWVESNEA 378
           YHSWVYWRDVDVE+ P +++EDLM HD DVIVPNVWRPLP +LG  Q YDLNSWVES   
Sbjct: 186 YHSWVYWRDVDVEVIPRSIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWVESEGG 245

Query: 379 IKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXSILARAQLFRK 438
           ++LA TL ED VIVEGY EY TWR HL Y+R  NGNP            SIL++A++FR 
Sbjct: 246 LQLADTLSEDSVIVEGYPEYATWRTHLAYMRDPNGNPEDEMMLDGIGGVSILSKARVFRA 305

Query: 439 GIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYEPSDDDLREIAKLERESRR 498
           G HFPAF+F+ HAETEAFGK++++MGF V GL HY +WHIYEPS DDL+ +A +  E +R
Sbjct: 306 GSHFPAFSFQKHAETEAFGKLSRRMGFDVVGLPHYVIWHIYEPSTDDLKYMAWMAEEEKR 365

>KNAG0I00300 Chr9 complement(39873..41246) [1374 bp, 457 aa] {ON}
           Anc_1.479 YEL036C
          Length = 457

 Score =  375 bits (963), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 187/363 (51%), Positives = 229/363 (63%), Gaps = 46/363 (12%)

Query: 136 ASTTDLYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFL 195
            + T+ YDL  Y G SNG    D +L CVPLRDAA  LPM FK+L  +TYPH L+D++FL
Sbjct: 64  VANTEFYDLKNYRGNSNGWQTGDRILFCVPLRDAAEHLPMFFKHLNEMTYPHNLVDLSFL 123

Query: 196 VSDCTDNGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMGKDYLKMVK 255
           VSD  D+  TM            G L   LQ  ++ KD+                     
Sbjct: 124 VSDSKDD--TM------------GVLLSNLQTAQSQKDRS-------------------- 149

Query: 256 NAFNPPFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANA 315
                       K F +I+ FEKDFGQ IGQ FSDRH    QG RRKLM RARNWL + A
Sbjct: 150 ------------KRFGNIEFFEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVA 197

Query: 316 LKPYHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTFLGGAQAYDLNSWVES 375
           +KPYHSWVYWRDVDVE  P T++EDLM H  DVIVPNVWRPLP +LG  Q YDLNSW ES
Sbjct: 198 IKPYHSWVYWRDVDVETAPVTIMEDLMHHGKDVIVPNVWRPLPEWLGNIQPYDLNSWQES 257

Query: 376 NEAIKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXSILARAQL 435
           +  ++LA +LD+D VIVEGY EY TWR HL Y+R  NG+P            SIL++A++
Sbjct: 258 DAGLELADSLDDDAVIVEGYPEYATWRPHLAYMRDPNGDPEVEMELDGIGGVSILSKARV 317

Query: 436 FRKGIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYEPSDDDLREIAKLERE 495
           FR G HFPAF+FE HAETEAFGK++++MG+ V GL HY +WHIYEPS +DL+ +A +  E
Sbjct: 318 FRSGSHFPAFSFEKHAETEAFGKLSRRMGYSVVGLPHYVIWHIYEPSTEDLKHMAWMAEE 377

Query: 496 SRR 498
            +R
Sbjct: 378 EQR 380

>Kwal_27.10157 s27 complement(219928..221358) [1431 bp, 476 aa] {ON}
           YEL036C (ANP1) - subunit of mannosyltransferase complex
           [contig 41] FULL
          Length = 476

 Score =  375 bits (963), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 188/360 (52%), Positives = 228/360 (63%), Gaps = 46/360 (12%)

Query: 139 TDLYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSD 198
            + YDL  Y G  +G    D VL  VPLRDAA  LPM F ++  ++YPH LID++FLVSD
Sbjct: 53  VEYYDLRNYQGNRDGWQRGDRVLFTVPLRDAAEHLPMFFDHMDKISYPHNLIDLSFLVSD 112

Query: 199 CTDNGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMGKDYLKMVKNAF 258
            +D+  TM  LLD  K+ Q+ T                                      
Sbjct: 113 SSDD--TMGVLLDHLKKAQSKT-------------------------------------- 132

Query: 259 NPPFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANALKP 318
                 D  K F +I+IFEKDFGQ IGQ FSDRH    QG RRKLMGRARNWL + ALKP
Sbjct: 133 ------DRKKRFGNIEIFEKDFGQAIGQSFSDRHGFAAQGPRRKLMGRARNWLGSVALKP 186

Query: 319 YHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTFLGGAQAYDLNSWVESNEA 378
           YHSWVYWRDVDVE  P T++EDLM HD DVIVPNVWRPLP +LG  Q YDLNSW ES   
Sbjct: 187 YHSWVYWRDVDVETIPRTILEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWQESEGG 246

Query: 379 IKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXSILARAQLFRK 438
           ++LA++LDED VIVEGY EY TWR HL Y+R  +GNP            SIL++A++FR 
Sbjct: 247 MQLAESLDEDAVIVEGYPEYATWRTHLAYMRDPSGNPEDEMELDGIGGVSILSKAKVFRA 306

Query: 439 GIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYEPSDDDLREIAKLERESRR 498
           G HFPAF+FE HAETEAFGK+++++G+ V GL HY +WHIYEPS DDL+ +A +  E +R
Sbjct: 307 GSHFPAFSFEKHAETEAFGKLSRRLGYSVIGLPHYVIWHIYEPSSDDLKHMAWMAEEEKR 366

>NDAI0B01250 Chr2 complement(293756..295096) [1341 bp, 446 aa] {ON}
           Anc_1.479
          Length = 446

 Score =  374 bits (960), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 188/369 (50%), Positives = 233/369 (63%), Gaps = 46/369 (12%)

Query: 129 READMLLASTTDLYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHE 188
           R  D     + + YD+S Y G  +G    + +L+CVPL+DA++ LP+ FK L  +TYPHE
Sbjct: 45  RIPDFQDIPSVEFYDMSNYQGHKDGWNQNNRILICVPLKDASNALPLFFKTLEKMTYPHE 104

Query: 189 LIDIAFLVSDCTDNGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMGK 248
           LID++FLVSD +DN  TM +LL+  K LQ               D G S +         
Sbjct: 105 LIDLSFLVSDSSDN--TMYNLLNMLKRLQ--------------IDGGTSGK--------- 139

Query: 249 DYLKMVKNAFNPPFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRAR 308
                                F +I+I+EKDFGQ IGQGFSDRH    QG RRKLMG+AR
Sbjct: 140 ---------------------FGNIEIYEKDFGQVIGQGFSDRHGFAAQGPRRKLMGKAR 178

Query: 309 NWLTANALKPYHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTFLGGAQAYD 368
           NWL   A+KPYHSWVYWRDVDVE+ P T++EDLM HD DVIVPNVWRPLP +LG  Q YD
Sbjct: 179 NWLNTVAIKPYHSWVYWRDVDVEIIPETILEDLMHHDKDVIVPNVWRPLPDWLGNIQPYD 238

Query: 369 LNSWVESNEAIKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXS 428
           LNSW ES   + L+ +L ED VIVEGY EY TWR HL Y+R  NG+P            S
Sbjct: 239 LNSWKESEAGLALSNSLGEDAVIVEGYPEYATWRSHLAYMRDPNGDPEREMELDGVGGVS 298

Query: 429 ILARAQLFRKGIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYEPSDDDLRE 488
           IL++A +FR G HFPAF+F+ HAETEAFGK++K M F V GL +Y +WHIYEPS +DL+ 
Sbjct: 299 ILSKANVFRSGSHFPAFSFKKHAETEAFGKLSKHMNFTVIGLPNYVVWHIYEPSKEDLQY 358

Query: 489 IAKLERESR 497
           +AKLE + R
Sbjct: 359 MAKLEEKER 367

>AFR357W Chr6 (1086069..1087373) [1305 bp, 434 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL036C (ANP1)
          Length = 434

 Score =  372 bits (955), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 191/361 (52%), Positives = 229/361 (63%), Gaps = 47/361 (13%)

Query: 139 TDLYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSD 198
            + +DLS   G ++G A  D VL CVPLRDAA  LPM FK+L  +TYPH L+D++FLVSD
Sbjct: 42  VEYWDLSWSRGKADGWAQGDRVLFCVPLRDAAEHLPMFFKHLSEMTYPHNLVDLSFLVSD 101

Query: 199 CTDNGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMGKDYLKMVKNAF 258
             D   TMS L    +ELQ+               + ++A Q                  
Sbjct: 102 SKDE--TMSVLRQHVRELQS---------------QPDNARQ------------------ 126

Query: 259 NPPFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANALKP 318
                      F +I+IF+KDFGQ IGQ FSDRH    QG RRKLM RARNWL + ALKP
Sbjct: 127 -----------FGNIEIFQKDFGQAIGQSFSDRHGFAAQGPRRKLMARARNWLGSVALKP 175

Query: 319 YHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTFLGGAQAYDLNSWVESNEA 378
           YHSWVYWRDVDVE  P T+IEDLM HD DVIVPNVWRPLP +LG  Q YDLNSWVES   
Sbjct: 176 YHSWVYWRDVDVETVPQTIIEDLMHHDKDVIVPNVWRPLPDWLGDIQPYDLNSWVESEGG 235

Query: 379 IKLAK-TLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXSILARAQLFR 437
           ++LA  T DED VIVEGY EY TWRVHL Y+R  NG+P            SIL+RA++FR
Sbjct: 236 LQLAADTPDEDAVIVEGYPEYATWRVHLAYMRDPNGDPETEMELDGIGGVSILSRARVFR 295

Query: 438 KGIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYEPSDDDLREIAKLERESR 497
            G HFPAF+F+ HAETE FGK+++ MG+ V GL HY +WHIYEPS DDL+ +A +  E +
Sbjct: 296 SGSHFPAFSFQKHAETEGFGKLSRAMGYSVVGLPHYVIWHIYEPSSDDLKHMAWMAEEEQ 355

Query: 498 R 498
           R
Sbjct: 356 R 356

>KLTH0C03432g Chr3 complement(297214..298683) [1470 bp, 489 aa] {ON}
           similar to uniprot|P32629 Saccharomyces cerevisiae
           YEL036C ANP1 Mannan 8 Protein of the endoplasmic
           reticulum with a role in retention of
           glycosyltransferases in the Golgi also involved in
           osmotic sensitivity and resistance to aminonitrophenyl
           propanediol subunit of mannosyltransferase complex
          Length = 489

 Score =  372 bits (956), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 183/357 (51%), Positives = 229/357 (64%), Gaps = 46/357 (12%)

Query: 142 YDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSDCTD 201
           YDL  Y G ++G    DHVL  VPLRDAA  LPM F ++  ++YPH LID++FLVSD +D
Sbjct: 56  YDLRNYQGHADGWQRGDHVLFTVPLRDAAEHLPMFFDHMDRISYPHNLIDLSFLVSDSSD 115

Query: 202 NGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMGKDYLKMVKNAFNPP 261
           +  TM  LL++ ++ Q+                                           
Sbjct: 116 D--TMGVLLEYLQKAQSKP----------------------------------------- 132

Query: 262 FHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANALKPYHS 321
              D  + F +I+I+EKDFGQ IGQ FSDRH    QG RRKLMGRARNWL + ALKPYHS
Sbjct: 133 ---DRTQRFGNIEIYEKDFGQAIGQSFSDRHGFAAQGPRRKLMGRARNWLGSVALKPYHS 189

Query: 322 WVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTFLGGAQAYDLNSWVESNEAIKL 381
           WVYWRDVDVE  P T++EDLM HD DVIVPNVWRPLP +LG  Q YDLNSW ES   ++L
Sbjct: 190 WVYWRDVDVETIPPTILEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWQESEGGLQL 249

Query: 382 AKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXSILARAQLFRKGIH 441
           A++LDED VIVEGY EY TWR HL Y+R  +G+P            SIL++A++FR G H
Sbjct: 250 AESLDEDSVIVEGYPEYATWRTHLAYMRDPSGDPEDEMELDGIGGVSILSKAKVFRAGSH 309

Query: 442 FPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYEPSDDDLREIAKLERESRR 498
           FPAF+FE HAETEAFGK+++++G+ V GL HY +WHIYEPS DDL+ +A +  E +R
Sbjct: 310 FPAFSFEKHAETEAFGKLSRRLGYSVVGLPHYVIWHIYEPSSDDLKHMAWMAEEEKR 366

>YEL036C Chr5 complement(83050..84552) [1503 bp, 500 aa] {ON}
           ANP1Subunit of the alpha-1,6 mannosyltransferase
           complex; type II membrane protein; has a role in
           retention of glycosyltransferases in the Golgi; involved
           in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol
          Length = 500

 Score =  371 bits (953), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 186/355 (52%), Positives = 223/355 (62%), Gaps = 46/355 (12%)

Query: 136 ASTTDLYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFL 195
             + + YDL  Y G  +G    D +L CVPLRDA+  LPM F +L  +TYPH LID++FL
Sbjct: 59  TPSVEFYDLRNYQGNKDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMTYPHNLIDLSFL 118

Query: 196 VSDCTDNGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMGKDYLKMVK 255
           VSD +DN  TM            G L   LQ  ++ +DK                     
Sbjct: 119 VSDSSDN--TM------------GVLLSNLQMAQSQQDKS-------------------- 144

Query: 256 NAFNPPFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANA 315
                       K F +I+I+EKDFGQ IGQ FSDRH    QG RRKLM RARNWL + A
Sbjct: 145 ------------KRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVA 192

Query: 316 LKPYHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTFLGGAQAYDLNSWVES 375
           LKPYHSWVYWRDVDVE  P T++EDLM HD DVIVPNVWRPLP +LG  Q YDLNSW ES
Sbjct: 193 LKPYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKES 252

Query: 376 NEAIKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXSILARAQL 435
              ++LA +LDED VIVEGY EY TWR HL Y+R  NGNP            SILA+A++
Sbjct: 253 EGGLQLADSLDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKV 312

Query: 436 FRKGIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYEPSDDDLREIA 490
           FR G HFPAF+FE HAETEAFG+++++M + V GL HY +WHIYEPS DDL+ +A
Sbjct: 313 FRTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>NDAI0G00340 Chr7 complement(56898..58412) [1515 bp, 504 aa] {ON}
           Anc_1.479 YEL036C
          Length = 504

 Score =  371 bits (952), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 186/352 (52%), Positives = 223/352 (63%), Gaps = 46/352 (13%)

Query: 139 TDLYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSD 198
            + YDL+ Y G  +G    D +L CVPLRDAA  LPM F +L  ++YPH  ID++FLVSD
Sbjct: 87  VEFYDLANYQGNKDGWQKNDRILFCVPLRDAAEHLPMFFDHLNKMSYPHNSIDLSFLVSD 146

Query: 199 CTDNGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMGKDYLKMVKNAF 258
            +D+  TM            G L   LQ+ ++ +DK                        
Sbjct: 147 SSDD--TM------------GVLLSNLQNAQSQQDKS----------------------- 169

Query: 259 NPPFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANALKP 318
                    K F +I+IFEKDFGQ IGQ FSDRH    QG RRKLM RARNWL + A+KP
Sbjct: 170 ---------KRFGNIEIFEKDFGQVIGQSFSDRHGFAAQGPRRKLMARARNWLGSVAIKP 220

Query: 319 YHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTFLGGAQAYDLNSWVESNEA 378
           YHSWVYWRDVDVE  P T++EDLM HD DVIVPNVWRPLP +LG  Q YDLNSW ES   
Sbjct: 221 YHSWVYWRDVDVETIPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEGG 280

Query: 379 IKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXSILARAQLFRK 438
           ++LA TL EDDVIVEGY EY TWR HL Y+R  NGNP            SILA+A++FR 
Sbjct: 281 LQLADTLGEDDVIVEGYPEYATWRSHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVFRT 340

Query: 439 GIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYEPSDDDLREIA 490
           G HFPAF+FE HAETEAFGK+++KM + V GL HY +WHIYEPS +DL+ +A
Sbjct: 341 GSHFPAFSFEKHAETEAFGKLSRKMNYNVIGLPHYVIWHIYEPSKEDLKHMA 392

>Skud_5.54 Chr5 complement(81169..82644) [1476 bp, 491 aa] {ON}
           YEL036C (REAL)
          Length = 491

 Score =  369 bits (948), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 184/352 (52%), Positives = 222/352 (63%), Gaps = 46/352 (13%)

Query: 139 TDLYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSD 198
            + YDL  Y G  +G    D +L CVPLRDA+  LPM F +L  ++YPH LID++FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMSYPHNLIDLSFLVSD 121

Query: 199 CTDNGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMGKDYLKMVKNAF 258
            +DN  TM            G L  +LQ  ++ +DK                        
Sbjct: 122 SSDN--TM------------GVLLSSLQTAQSQQDKS----------------------- 144

Query: 259 NPPFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANALKP 318
                    K F +I+I+EKDFGQ IGQ FSDRH    QG RRKLM RARNWL + ALKP
Sbjct: 145 ---------KRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVALKP 195

Query: 319 YHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTFLGGAQAYDLNSWVESNEA 378
           YHSWVYWRDVDV+  P T++EDLM HD DVIVPNVWRPLP +LG  Q YDLNSW ES   
Sbjct: 196 YHSWVYWRDVDVQTIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEGG 255

Query: 379 IKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXSILARAQLFRK 438
           ++LA  LDED VIVEGY EY TWR HL Y+R  NGNP            SILA+A++FR 
Sbjct: 256 LQLADALDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVFRT 315

Query: 439 GIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYEPSDDDLREIA 490
           G HFPAF+FE HAETEAFG+++++M + V GL HY +WHIYEPS DDL+ +A
Sbjct: 316 GSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>SAKL0D11792g Chr4 (979538..980989) [1452 bp, 483 aa] {ON} similar
           to uniprot|P32629 Saccharomyces cerevisiae YEL036C ANP1
           Mannan 8 Protein of the endoplasmic reticulum with a
           role in retention of glycosyltransferases in the Golgi
           also involved in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol subunit of
           mannosyltransferase complex
          Length = 483

 Score =  369 bits (946), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 182/360 (50%), Positives = 230/360 (63%), Gaps = 46/360 (12%)

Query: 139 TDLYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSD 198
            + YDL+ Y G ++G    D VL CVPLRDAA  LPM FK++  ++YPH LID++FLVSD
Sbjct: 82  VEYYDLNNYQGNADGWQRGDRVLFCVPLRDAAEHLPMFFKHMDEISYPHNLIDLSFLVSD 141

Query: 199 CTDNGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMGKDYLKMVKNAF 258
            +D+  TM            G L  +L+  ++++DK                        
Sbjct: 142 SSDD--TM------------GVLLSSLKKAQSNQDKSQR--------------------- 166

Query: 259 NPPFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANALKP 318
                      F +I+IFEKDFGQ IGQ FSDRH    QG RRKLM RARNWL + ALKP
Sbjct: 167 -----------FGNIEIFEKDFGQVIGQSFSDRHGFAAQGPRRKLMARARNWLGSVALKP 215

Query: 319 YHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTFLGGAQAYDLNSWVESNEA 378
           YHSWVYWRDVDVE  P T++EDLM H+ DVIVPNVWRPLP +LG  Q YDLNSW ES   
Sbjct: 216 YHSWVYWRDVDVETIPRTILEDLMHHNKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEGG 275

Query: 379 IKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXSILARAQLFRK 438
           ++LA +L+ED VIVEGY EY TWR HL Y+R  +G+P            SIL++A++FR 
Sbjct: 276 LQLADSLEEDAVIVEGYPEYATWRTHLAYMRDPSGDPEAEMELDGIGGVSILSKAKVFRT 335

Query: 439 GIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYEPSDDDLREIAKLERESRR 498
           G HFPAF+FE HAETEAFGK++++M + V GL HY +WH+YEPS DDL+ +A +  E +R
Sbjct: 336 GSHFPAFSFEKHAETEAFGKLSRRMKYSVVGLPHYVIWHVYEPSSDDLKHMAWMAEEEKR 395

>Smik_5.57 Chr5 complement(85152..86627) [1476 bp, 491 aa] {ON}
           YEL036C (REAL)
          Length = 491

 Score =  367 bits (943), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 184/352 (52%), Positives = 220/352 (62%), Gaps = 46/352 (13%)

Query: 139 TDLYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSD 198
            + YDL  Y G  +G    D +L CVPLRDA+  LPM F +L  +TYPH LID++FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMTYPHNLIDLSFLVSD 121

Query: 199 CTDNGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMGKDYLKMVKNAF 258
            +DN  TM            G L   L   ++ +DK                        
Sbjct: 122 SSDN--TM------------GVLLSNLHKAQSQQDKS----------------------- 144

Query: 259 NPPFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANALKP 318
                    K F +I+I+EKDFGQ IGQ FSDRH    QG RRKLM RARNWL + ALKP
Sbjct: 145 ---------KRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVALKP 195

Query: 319 YHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTFLGGAQAYDLNSWVESNEA 378
           YHSWVYWRDVDVE  P T++EDLM HD DVIVPNVWRPLP +LG  Q YDLNSW ES   
Sbjct: 196 YHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEGG 255

Query: 379 IKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXSILARAQLFRK 438
           ++LA  L+ED VIVEGY EY TWR HL Y+R  NGNP            SILA+A++FR 
Sbjct: 256 LQLADALEEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVFRT 315

Query: 439 GIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYEPSDDDLREIA 490
           G HFPAF+FE HAETEAFG+++++M + V GL HY +WHIYEPS DDL+ +A
Sbjct: 316 GSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>KAFR0I02770 Chr9 (559196..560563) [1368 bp, 455 aa] {ON} Anc_1.479
           YEL036C
          Length = 455

 Score =  366 bits (940), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 184/360 (51%), Positives = 226/360 (62%), Gaps = 46/360 (12%)

Query: 139 TDLYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSD 198
            + YDL  Y G S+G    D +L CVPLRDAA  LPM F++L  +TYPH  ID++FLVSD
Sbjct: 62  VEYYDLRNYQGNSDGWQRNDRILFCVPLRDAAEHLPMFFEHLNLMTYPHNFIDLSFLVSD 121

Query: 199 CTDNGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMGKDYLKMVKNAF 258
            +D+  TM            G L   LQ  ++  DK                        
Sbjct: 122 SSDD--TM------------GVLLSHLQSAQSQMDKS----------------------- 144

Query: 259 NPPFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANALKP 318
                    K F +I+I+EKDFGQ IGQ FSDRH    QG RRKLM RARNWL + ALKP
Sbjct: 145 ---------KRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVALKP 195

Query: 319 YHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTFLGGAQAYDLNSWVESNEA 378
           YHSWVYWRDVDVE  P T++EDLM HD DVIVPNVWRPLP +LG  Q YDLNSW ES   
Sbjct: 196 YHSWVYWRDVDVETVPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWQESEGG 255

Query: 379 IKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXSILARAQLFRK 438
           ++LA+ L+ED VIVEGY EY TWR HL Y+R  NG+P            SIL++A++FR 
Sbjct: 256 LQLAEALEEDAVIVEGYPEYATWRPHLAYMRDPNGDPEEEMELDGIGGVSILSKAKVFRT 315

Query: 439 GIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYEPSDDDLREIAKLERESRR 498
           G HFPAF+FE HAETEAFG+++++M + V GL HY +WHIYEPS +DL+ +A +  E +R
Sbjct: 316 GSHFPAFSFEKHAETEAFGRLSRRMNYNVVGLPHYVIWHIYEPSTEDLKHMAWMAEEEKR 375

>Suva_5.33 Chr5 complement(58480..59967) [1488 bp, 495 aa] {ON}
           YEL036C (REAL)
          Length = 495

 Score =  367 bits (942), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 185/352 (52%), Positives = 221/352 (62%), Gaps = 46/352 (13%)

Query: 139 TDLYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSD 198
            + YDL  Y G  +G    D +L CVPLRDA+  LPM F +L  ++YPH LID++FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFDHLNAMSYPHNLIDLSFLVSD 121

Query: 199 CTDNGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMGKDYLKMVKNAF 258
            +DN  TM            G L   LQ  ++ +DK                        
Sbjct: 122 SSDN--TM------------GVLLSKLQMAQSQQDKT----------------------- 144

Query: 259 NPPFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANALKP 318
                    K F +I+I+EKDFGQ IGQ FSDRH    QG RRKLM RARNWL + ALKP
Sbjct: 145 ---------KRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVALKP 195

Query: 319 YHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTFLGGAQAYDLNSWVESNEA 378
           YHSWVYWRDVDVE  P T++EDLM HD DVIVPNVWRPLP +LG  Q YDLNSW ES   
Sbjct: 196 YHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEGG 255

Query: 379 IKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXSILARAQLFRK 438
           ++LA  LDED VIVEGY EY TWR HL Y+R  NGNP            SILA+A++FR 
Sbjct: 256 LQLANALDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVFRT 315

Query: 439 GIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYEPSDDDLREIA 490
           G HFPAF+FE HAETEAFG+++++M + V GL HY +WHIYEPS DDL+ +A
Sbjct: 316 GSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>KLLA0E22155g Chr5 complement(1976362..1977714) [1353 bp, 450 aa]
           {ON} similar to uniprot|P32629 Saccharomyces cerevisiae
           YEL036C ANP1 Mannan 8 Protein of the endoplasmic
           reticulum with a role in retention of
           glycosyltransferases in the Golgi also involved in
           osmotic sensitivity and resistance to aminonitrophenyl
           propanediol subunit of mannosyltransferase complex
          Length = 450

 Score =  364 bits (934), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 181/360 (50%), Positives = 224/360 (62%), Gaps = 46/360 (12%)

Query: 139 TDLYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSD 198
            + YDL  Y G +NG    D V+ CVPLRDAA+ L M F  L  LTYPH LID++FLVSD
Sbjct: 57  VEYYDLINYQGNANGWQTGDRVVFCVPLRDAAAHLDMFFDTLDKLTYPHNLIDLSFLVSD 116

Query: 199 CTDNGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMGKDYLKMVKNAF 258
            +D+  TM +LL   +  Q+                                        
Sbjct: 117 SSDD--TMKTLLSHLRRAQS---------------------------------------- 134

Query: 259 NPPFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANALKP 318
               + D  + F +I+IFEKDFGQ +GQ FSDRH    QG RRK M RARNWL + ALKP
Sbjct: 135 ----NQDKSRRFANIEIFEKDFGQSVGQSFSDRHGFAAQGPRRKSMARARNWLGSAALKP 190

Query: 319 YHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTFLGGAQAYDLNSWVESNEA 378
           YHS+VYWRDVDV+  P T++EDLM HD DVIVPNVWRPLP +LG  Q YDLNSWVES   
Sbjct: 191 YHSYVYWRDVDVQTIPNTILEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWVESEGG 250

Query: 379 IKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXSILARAQLFRK 438
           ++LA +LDED  IVEGY EY TWR HL Y+R  +G+P            SIL++A++FR 
Sbjct: 251 LQLADSLDEDACIVEGYPEYATWRTHLAYMRDPSGDPEVEMELDGIGGVSILSKAKVFRT 310

Query: 439 GIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYEPSDDDLREIAKLERESRR 498
           G HFPAF+FE HAETEAFGK++++M + V GL HY +WHIYEPS DDL+ +A +  E +R
Sbjct: 311 GSHFPAFSFEKHAETEAFGKLSRRMQYSVVGLPHYVIWHIYEPSSDDLKHMAWMAEEEKR 370

>TBLA0B02170 Chr2 complement(499391..501109) [1719 bp, 572 aa] {ON}
           Anc_1.479 YEL036C
          Length = 572

 Score =  367 bits (942), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 186/358 (51%), Positives = 226/358 (63%), Gaps = 46/358 (12%)

Query: 141 LYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSDCT 200
            YDL+ Y G S+G    D +L CVPLRDAA  LP  F +L  +TYPH LID++FLVSD  
Sbjct: 74  FYDLNNYRGNSDGWQRNDRILFCVPLRDAAQHLPRFFNHLNTMTYPHNLIDLSFLVSDSK 133

Query: 201 DNGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMGKDYLKMVKNAFNP 260
           D+  TM            G L   LQ  ++ ++K        LK  G             
Sbjct: 134 DD--TM------------GVLLSHLQTAQSQQNK--------LKRFG------------- 158

Query: 261 PFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANALKPYH 320
                      +I+I+EKDFGQ IGQ FSDRH    QG RRKLM RARNWL + ALKPYH
Sbjct: 159 -----------NIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVALKPYH 207

Query: 321 SWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTFLGGAQAYDLNSWVESNEAIK 380
           SWVYWRDVDVE CP T++EDLM H  DVIVPNVWRPLP +LG  Q YDLNSW ES   ++
Sbjct: 208 SWVYWRDVDVETCPVTIMEDLMHHGKDVIVPNVWRPLPDWLGNIQPYDLNSWQESEGGLQ 267

Query: 381 LAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXSILARAQLFRKGI 440
           LA +LDED VIVEGY EY TWR HL Y+R  NG+P            SIL++A++FR G 
Sbjct: 268 LADSLDEDAVIVEGYPEYATWRPHLAYMRDPNGDPEEEMELDGIGGVSILSKAKVFRSGS 327

Query: 441 HFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYEPSDDDLREIAKLERESRR 498
           HFPAF+FE HAETEAFGK++++M + V GL HY +WHIYEPS +DL+ +A +  E +R
Sbjct: 328 HFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVVWHIYEPSTEDLKHMAWMAEEEKR 385

>TDEL0C02600 Chr3 complement(450202..451590) [1389 bp, 462 aa] {ON}
           Anc_1.479 YEL036C
          Length = 462

 Score =  359 bits (922), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 184/361 (50%), Positives = 225/361 (62%), Gaps = 47/361 (13%)

Query: 139 TDLYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSD 198
            + YDL  Y G  +G    + +L  VPLRDAA  LP  F ++  L+YPH LID++FLVSD
Sbjct: 57  VEYYDLRNYQGDRDGWQRGNRILFLVPLRDAAQHLPRFFGHMSELSYPHNLIDMSFLVSD 116

Query: 199 CTDNGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMGKDYLKMVKNAF 258
            +D+  TM  LL              LQ  ++ KD+                        
Sbjct: 117 SSDD--TMGELL------------HHLQIAQSQKDR------------------------ 138

Query: 259 NPPFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANALKP 318
                   +K F +I+IFEKDFGQ IGQ FSDRH    QG RRKLM RARNWL +  LKP
Sbjct: 139 --------NKRFGNIEIFEKDFGQAIGQSFSDRHGFAAQGPRRKLMARARNWLGSVTLKP 190

Query: 319 YHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTFLGGAQAYDLNSWVESNEA 378
           YHSWVYWRDVDVE+ P +++EDLM HD DVIVPNVWRPLP +LG  Q YDLNSW ES   
Sbjct: 191 YHSWVYWRDVDVEIAPISIMEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWKESEAG 250

Query: 379 IKLAKTL-DEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXSILARAQLFR 437
           I+LA TL DED VIVEGY E+ TWR HL Y+R  NGNP            SILA+A++FR
Sbjct: 251 IQLANTLTDEDSVIVEGYPEFATWRTHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVFR 310

Query: 438 KGIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYEPSDDDLREIAKLERESR 497
            G HFPAF+FE HAETEAFGK++++M + V GL HY +WHIYEPS +DL+ +A +  E +
Sbjct: 311 TGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVIWHIYEPSTEDLKHMAWMAEEEK 370

Query: 498 R 498
           R
Sbjct: 371 R 371

>Kpol_370.5 s370 (7329..9266) [1938 bp, 645 aa] {ON} (7329..9266)
           [1938 nt, 646 aa]
          Length = 645

 Score =  365 bits (938), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 178/352 (50%), Positives = 222/352 (63%), Gaps = 46/352 (13%)

Query: 139 TDLYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSD 198
            + YDLS Y G  +G    D +L C+PLRDAA  LPM F ++  +TYPH L+D++FLVSD
Sbjct: 66  VEFYDLSNYQGNKDGWQQNDRILFCIPLRDAAQHLPMFFDHMNKMTYPHNLVDLSFLVSD 125

Query: 199 CTDNGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMGKDYLKMVKNAF 258
            +D+  TM            G L   LQ  ++ +DK                        
Sbjct: 126 SSDD--TM------------GVLLSHLQTVQSQQDKS----------------------- 148

Query: 259 NPPFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANALKP 318
                    K F +I+I+EKDFGQ IGQ FSDRH    QG RRKLM +ARNWL + ALKP
Sbjct: 149 ---------KRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMAKARNWLGSVALKP 199

Query: 319 YHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTFLGGAQAYDLNSWVESNEA 378
           YHSWVYWRDVD+E  P T++EDLM HD D+IVPNVWRPLP +LG  Q YDLNSW ES   
Sbjct: 200 YHSWVYWRDVDIETAPVTIMEDLMHHDKDIIVPNVWRPLPDWLGNIQPYDLNSWQESEGG 259

Query: 379 IKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXSILARAQLFRK 438
           ++LA  LDE+ VIVEGY EY TWR HL Y+R  NG+P            SIL++A++FR 
Sbjct: 260 LQLANQLDENAVIVEGYPEYATWRPHLAYMRDPNGDPEDEMELDGIGGVSILSKAKVFRS 319

Query: 439 GIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYEPSDDDLREIA 490
           G HFPAF+FE HAETEAFGK++++M + V GL HY +WHIYEPS +DL+ +A
Sbjct: 320 GSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVVWHIYEPSTEDLKHMA 371

>TPHA0O00430 Chr15 (76318..77964) [1647 bp, 548 aa] {ON} Anc_1.479
           YEL036C
          Length = 548

 Score =  362 bits (929), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 178/352 (50%), Positives = 219/352 (62%), Gaps = 46/352 (13%)

Query: 138 TTDLYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVS 197
             + YDL  Y G  +G    D ++ CVPLRDAA  LP  F +L  ++YPH LID++FLVS
Sbjct: 64  NVEFYDLRNYKGNKDGWQRNDRIVFCVPLRDAAQHLPRFFDHLDKMSYPHNLIDLSFLVS 123

Query: 198 DCTDNGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMGKDYLKMVKNA 257
           D +D+  TM            G L   LQ  ++ +DK                       
Sbjct: 124 DSSDD--TM------------GVLLSNLQTAQSQRDKS---------------------- 147

Query: 258 FNPPFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANALK 317
                     K F +I+I+EKDFGQ IGQ FSDRH    QG RRKLM RARNWL + ALK
Sbjct: 148 ----------KRFGNIEIYEKDFGQVIGQSFSDRHGFAGQGPRRKLMARARNWLGSVALK 197

Query: 318 PYHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTFLGGAQAYDLNSWVESNE 377
           PYHSWVYWRDVD+E  P T++EDLM HD D+IVPNVWRPLP +LG  Q YDLNSW ES  
Sbjct: 198 PYHSWVYWRDVDIETAPRTIMEDLMHHDKDIIVPNVWRPLPDWLGNIQPYDLNSWQESEG 257

Query: 378 AIKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXSILARAQLFR 437
            ++LA  L+ED VIVEGY EY TWR HL Y+R  NG+P            SIL++A +FR
Sbjct: 258 GLQLANQLNEDAVIVEGYPEYATWRPHLAYMRDPNGDPEVEMELDGIGGVSILSKANVFR 317

Query: 438 KGIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYEPSDDDLREI 489
            G HFPAF+FE HAETEAFGK++++MG+ V GL HY +WHIYEPS +DL+ +
Sbjct: 318 SGSHFPAFSFEKHAETEAFGKLSRRMGYNVIGLPHYVVWHIYEPSTEDLKHM 369

>ZYRO0F05170g Chr6 (432802..434628) [1827 bp, 608 aa] {ON} similar
           to uniprot|P32629 Saccharomyces cerevisiae YEL036C ANP1
           Mannan 8 Protein of the endoplasmic reticulum with a
           role in retention of glycosyltransferases in the Golgi
           also involved in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol subunit of
           mannosyltransferase complex
          Length = 608

 Score =  351 bits (901), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 178/354 (50%), Positives = 221/354 (62%), Gaps = 47/354 (13%)

Query: 138 TTDLYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVS 197
             + YDL  Y G  +G    + +L  VPLRDAA  LP  F ++  +TYPH LID +FLVS
Sbjct: 62  NVEYYDLRNYQGDPDGWQRDNRILFLVPLRDAAEHLPRFFNHMDKMTYPHNLIDFSFLVS 121

Query: 198 DCTDNGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMGKDYLKMVKNA 257
           D +D+  TM +LL              L+  +++KDK                       
Sbjct: 122 DSSDD--TMGALL------------SHLEKAQSNKDKT---------------------- 145

Query: 258 FNPPFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANALK 317
                     + F +I+I+EKDFGQ IGQ FSDRH    QG RRKLM RARNWL   ALK
Sbjct: 146 ----------RRFGNIEIYEKDFGQAIGQSFSDRHGFDAQGPRRKLMARARNWLGTVALK 195

Query: 318 PYHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTFLGGAQAYDLNSWVESNE 377
            YHSWVYWRDVDVELCP +++EDLM HD DVIVPNVWRPLP +LG  Q YDLNSW ES  
Sbjct: 196 AYHSWVYWRDVDVELCPQSIMEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWKESEV 255

Query: 378 AIKLAKTLDEDD-VIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXSILARAQLF 436
            ++LA +L +DD VIVEGY +Y TWR HL Y+R  NGNP            SIL++ ++F
Sbjct: 256 GVQLADSLPDDDAVIVEGYPDYSTWRTHLAYMRDPNGNPEDELELDGIGGVSILSKGKVF 315

Query: 437 RKGIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYEPSDDDLREIA 490
           R G HFPAF+FE HAETEAFGK++++MG+ V GL HY +WHIYEPS +DL+ +A
Sbjct: 316 RTGSHFPAFSFEKHAETEAFGKLSRRMGYNVVGLPHYVIWHIYEPSTEDLQHMA 369

>KLLA0E12849g Chr5 complement(1138282..1139460) [1179 bp, 392 aa]
           {ON} highly similar to uniprot|P39107 Saccharomyces
           cerevisiae YPL050C MNN9 Subunit of Golgi
           mannosyltransferase complex also containing Anp1p Mnn10p
           Mnn11p and Hoc1p that mediates elongation of the
           polysaccharide mannan backbone forms a separate complex
           with Van1p that is also involved in backbone elongation
          Length = 392

 Score =  159 bits (401), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 101/342 (29%), Positives = 154/342 (45%), Gaps = 51/342 (14%)

Query: 142 YDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSDCTD 201
           YDL++    SN   N++ VL+  P++   +     + NL++LTYP  LI++ F++     
Sbjct: 99  YDLNKLKSTSNALVNKERVLILTPMQ---TFHQQYWNNLLSLTYPRALIELGFIIPRTAS 155

Query: 202 NGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMGKDYLKMVKNAFNPP 261
               +  L    +E+Q G                                          
Sbjct: 156 GDAALQKLESAVREVQTG------------------------------------------ 173

Query: 262 FHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANALKPYHS 321
                DK F  I I  +        G  DRHA++VQ  RR  M  ARN L  + + P+ S
Sbjct: 174 ---KQDKRFAKITILRQASQSFDRLGEKDRHALEVQKERRAAMALARNELLFSTIGPHTS 230

Query: 322 WVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPL---PTFLGGAQAYDLNSWVESNEA 378
           W+ W D D+   P TVI+DL  H+  V+  NV++            + YD N+W ES   
Sbjct: 231 WILWLDADIVETPVTVIQDLTSHNKPVLAANVYQKFYDKDQKKESIRPYDFNNWAESEIG 290

Query: 379 IKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXSILARAQLFRK 438
           +KLA+ L ++++IVEGY+E  T+R  + +    NG                L +A++ R 
Sbjct: 291 LKLAQQLGDNEIIVEGYSEIATYRPLMAHFYDANGATNSLMELDGVGGGCTLVKAEVHRD 350

Query: 439 GIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYE 480
           G  F  F F +  ETEAF KMAK++G+ V GL +Y ++HI E
Sbjct: 351 GAMFTNFPFYHLIETEAFAKMAKRLGYSVFGLPNYLVYHIEE 392

>Smik_16.186 Chr16 complement(336170..337357) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  158 bits (400), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 98/342 (28%), Positives = 165/342 (48%), Gaps = 51/342 (14%)

Query: 142 YDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSDCTD 201
           YDL++ +   + AAN++HVL+  P++   +     + NL+ LTYP ELI++ F+      
Sbjct: 99  YDLNKLHSTPDAAANKEHVLILTPMQ---TFHQQYWDNLLQLTYPRELIELGFITP---- 151

Query: 202 NGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMGKDYLKMVKNAFNPP 261
             RT +  L   K      L   ++  +ADK     ++   ++   + + K+++      
Sbjct: 152 --RTATGDLALKK------LENAVKKVQADKKAQRFSKITIMRQNSQSFDKLME------ 197

Query: 262 FHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANALKPYHS 321
                                       +RHA+ VQ  RR  M  ARN L  + + P+ S
Sbjct: 198 ---------------------------KERHALDVQKERRAAMALARNELLFSTIGPHTS 230

Query: 322 WVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPL---PTFLGGAQAYDLNSWVESNEA 378
           WV W D D+   P T+I+D+ +H+  V+  N+++            + YD N+W ES+  
Sbjct: 231 WVLWLDADIIETPTTLIQDMTQHNKAVLAANIYQRFYDQEKKQSSIRPYDFNNWQESDTG 290

Query: 379 IKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXSILARAQLFRK 438
           +++A  +D+D++IVEGYAE  T+R  + +    N  P              L +A++ R 
Sbjct: 291 LEIASQMDDDEIIVEGYAEIATYRPLMAHFYSANELPSKEMVLDGVGGGCTLVKAEVHRD 350

Query: 439 GIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYE 480
           G  FP F F +  ETE F KMAK++ ++V GL +Y ++HI E
Sbjct: 351 GAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVYHIEE 392

>Kwal_27.11864 s27 (981923..983284) [1362 bp, 453 aa] {ON} YPL050C
           (MNN9) - Protein required for complex glycosylation
           [contig 27] FULL
          Length = 453

 Score =  158 bits (399), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 101/347 (29%), Positives = 162/347 (46%), Gaps = 61/347 (17%)

Query: 142 YDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSDCTD 201
           YDL++    +N A N++ VL+  P++   +     + NL+ LTYP EL+++ F++   T 
Sbjct: 158 YDLNKLTSTANAALNKEQVLILTPMQ---TFHEEYWNNLLQLTYPRELLELGFIIPRTTS 214

Query: 202 NGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMGKDYLKMVKNAFNPP 261
               +  L    K+ Q   LSK                                      
Sbjct: 215 GDNALRKLEAAVKKTQ---LSKK------------------------------------- 234

Query: 262 FHDDYDKPFRSIQIFEKDFGQQIGQGF-----SDRHAVKVQGVRRKLMGRARNWLTANAL 316
                D+ F  I I  +D      Q F      DRHA++VQ  RR  M  ARN L  + +
Sbjct: 235 -----DQRFLKITILRQD-----SQSFDLLKEKDRHALEVQKKRRSAMALARNELLFSTI 284

Query: 317 KPYHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTFLGGAQA---YDLNSWV 373
            PY SWV W D D+   P T+I+D+  HD  V+  NV++       G +    YD N+W 
Sbjct: 285 GPYTSWVLWLDADIIETPPTLIQDMTAHDKAVLAANVYQHSIDKKTGQKTKGPYDFNNWA 344

Query: 374 ESNEAIKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXSILARA 433
           +S+ A+++A ++ +D V+ EGY E  T+R  + +  K+  +P              L +A
Sbjct: 345 DSDTALQMAASMPDDGVLFEGYGEMATYRTLMAHFYKEGESPSAEMVLDGVGGGCTLVKA 404

Query: 434 QLFRKGIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYE 480
           ++ R G  FP+F F +  ETE F KMA+++ +++ GL +Y ++HI E
Sbjct: 405 EVHRDGAMFPSFPFYHLIETEGFAKMAQRLDYEIYGLPNYLVYHIEE 451

>TDEL0B01370 Chr2 complement(242546..243736) [1191 bp, 396 aa] {ON}
           Anc_8.500 YPL050C
          Length = 396

 Score =  155 bits (393), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 104/359 (28%), Positives = 167/359 (46%), Gaps = 51/359 (14%)

Query: 128 EREADMLLASTTDLYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPH 187
           +R  D++       YDL++ +  +  A N++ VL+  P++   +     + NL+ LTYP 
Sbjct: 86  DRVEDIIPEGHIAHYDLNKLHSTAKAALNKEQVLILTPMQ---TFHEQYWDNLLQLTYPR 142

Query: 188 ELIDIAFLVSDCTDNGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMG 247
           ELI++ F+V       RT S  +  +K      L + ++  + DK      +   L+   
Sbjct: 143 ELIELGFIVP------RTQSGDVALAK------LEEAVKKVQTDKKNQRFVKVTILRQDS 190

Query: 248 KDYLKMVKNAFNPPFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRA 307
           K + K+ +                                  +RHA+ VQ  RR  M  A
Sbjct: 191 KSFDKLQE---------------------------------KERHALAVQKERRAAMALA 217

Query: 308 RNWLTANALKPYHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPL---PTFLGGA 364
           RN L  + + P+ SWV W D D+   P  +I+D+  H+  V+  NV++            
Sbjct: 218 RNELLFSTIGPHTSWVLWLDADIVEAPPNLIQDMTAHNKPVLAANVYQRYYDEEKKESSI 277

Query: 365 QAYDLNSWVESNEAIKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXX 424
           +AYD N+W ES   ++LA  + ED++IVEGY+E  T+R  + Y    NG+P         
Sbjct: 278 RAYDFNNWAESETGLELASQMAEDEIIVEGYSELATYRPLMAYYYDANGSPGAEMALDGV 337

Query: 425 XXXSILARAQLFRKGIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYEPSD 483
                L +A + R G  FP F F +  ETE F KMAK++  +V GL +Y ++HI E +D
Sbjct: 338 GGGCTLVQADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNHEVFGLPNYLVYHIEEWND 396

>TBLA0H03340 Chr8 (820028..821209) [1182 bp, 393 aa] {ON} Anc_8.500
           YPL050C
          Length = 393

 Score =  154 bits (389), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 101/345 (29%), Positives = 165/345 (47%), Gaps = 57/345 (16%)

Query: 142 YDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSDCTD 201
           YDL++ +  S+ A N++ VL+  P++   +     ++NL+ LTYP ELI++ F++     
Sbjct: 97  YDLNKLHSTSDAAVNKEQVLILTPMQ---TFHDEFWQNLLQLTYPRELIELGFILPRS-- 151

Query: 202 NGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMGKDYLKMVKNAFNPP 261
                                          D G++A            LK ++ A    
Sbjct: 152 -------------------------------DSGDAA------------LKALEAAVKKV 168

Query: 262 FHDDYDKPFRSIQIFEKD---FGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANALKP 318
             D  ++ F  I I  +D   FGQ + +   +RHA+ VQ  RR  M  ARN L  + + P
Sbjct: 169 QTDKKNQRFSKITILRQDSQGFGQLMEK---ERHALHVQKERRAAMALARNELLFSTIGP 225

Query: 319 YHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPL---PTFLGGAQAYDLNSWVES 375
           + SWV W D D+   P TVI+D+  HD  V+  NV++            +AYD N+W ES
Sbjct: 226 HTSWVLWLDADIVETPPTVIQDMTAHDKAVLAANVYQRYFDEEKKEKSIRAYDFNNWQES 285

Query: 376 NEAIKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXSILARAQL 435
           +  +++A  +++D++IVEGY+E  T+R  + +      +               L +A +
Sbjct: 286 DTGLQIAAGMNDDEIIVEGYSEIATYRPLMAHFYDPTASVNSEMMLDGVGGGCTLVKADV 345

Query: 436 FRKGIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYE 480
            R G  FP F F +  ETE F KMAK++ ++V GL +Y ++H+ E
Sbjct: 346 HRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVYHMEE 390

>SAKL0H11110g Chr8 complement(957784..958965) [1182 bp, 393 aa] {ON}
           highly similar to uniprot|P39107 Saccharomyces
           cerevisiae YPL050C MNN9 Subunit of Golgi
           mannosyltransferase complex also containing Anp1p Mnn10p
           Mnn11p and Hoc1p that mediates elongation of the
           polysaccharide mannan backbone forms a separate complex
           with Van1p that is also involved in backbone elongation
          Length = 393

 Score =  153 bits (386), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 103/352 (29%), Positives = 166/352 (47%), Gaps = 51/352 (14%)

Query: 132 DMLLASTTDLYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELID 191
           D++ A     YDL++     N A N++ VL+  P+++        + NL+ LTYP ELI+
Sbjct: 88  DVIPAGHIAHYDLNKLTSTQNAALNKEQVLILTPMQN---FHQKYWDNLLQLTYPRELIE 144

Query: 192 IAFLVSDCTDNGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMGKDYL 251
           + F+V         +  L    K++Q G            +D+            GK  +
Sbjct: 145 LGFIVPRTGSGNVALEQLEAAVKKVQTGK----------KEDR-----------FGK--I 181

Query: 252 KMVKNAFNPPFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWL 311
            +++ A        +DK      + EK+           RHA++VQ  RR  M  ARN L
Sbjct: 182 TILRQA-----SQSFDK------LLEKE-----------RHALEVQKERRAAMALARNEL 219

Query: 312 TANALKPYHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPL---PTFLGGAQAYD 368
             + + PY SW+ W D D+   P +VIED+  H+  V+  NV++            + YD
Sbjct: 220 LFSTIGPYTSWILWLDADIVETPPSVIEDMTAHNKPVLAANVYQRYYDQEQKKESIRPYD 279

Query: 369 LNSWVESNEAIKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXS 428
            N+W ES+  ++LA  +  D+++VEGY E  T+R  + +  +D+                
Sbjct: 280 YNNWAESDIGLQLASQMSADEILVEGYPEIATYRPLMAHFYEDSAPATVEMELDGVGGGC 339

Query: 429 ILARAQLFRKGIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYE 480
            L +A + R G  FP F F +  ETE F KMAK++G++V GL +Y ++HI E
Sbjct: 340 TLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLGYEVFGLPNYLVYHIDE 391

>YPL050C Chr16 complement(460779..461966) [1188 bp, 395 aa] {ON}
           MNN9Subunit of Golgi mannosyltransferase complex also
           containing Anp1p, Mnn10p, Mnn11p, and Hoc1p that
           mediates elongation of the polysaccharide mannan
           backbone; forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 395

 Score =  153 bits (386), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 96/346 (27%), Positives = 163/346 (47%), Gaps = 59/346 (17%)

Query: 142 YDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSDCTD 201
           YDL++ +  S  A N++H+L+  P++   +     + NL+ L YP ELI++ F+      
Sbjct: 99  YDLNKLHSTSEAAVNKEHILILTPMQ---TFHQQYWDNLLQLNYPRELIELGFITP---- 151

Query: 202 NGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMGKDYLKMVKNAFNPP 261
             RT +  L   K      L   ++  + DK     ++   L+   + + K+++      
Sbjct: 152 --RTATGDLALKK------LENAIKKVQTDKKTQRFSKITILRQNSQSFDKLME------ 197

Query: 262 FHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANALKPYHS 321
                                       +RHA+ VQ  RR  M  ARN L  + + P+ S
Sbjct: 198 ---------------------------KERHALDVQKERRAAMALARNELLFSTIGPHTS 230

Query: 322 WVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPL-------PTFLGGAQAYDLNSWVE 374
           WV W D D+   P ++I+D+ KH+  ++  N+++         P+     + YD N+W E
Sbjct: 231 WVLWLDADIIETPPSLIQDMTKHNKAILAANIYQRFYDEEKKQPSI----RPYDFNNWQE 286

Query: 375 SNEAIKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXSILARAQ 434
           S+  +++A  + +D++IVEGYAE  T+R  + +    NG P              L +A+
Sbjct: 287 SDTGLEIASQMGDDEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGCTLVKAE 346

Query: 435 LFRKGIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYE 480
           + R G  FP F F +  ETE F KMAK++ + V GL +Y ++HI E
Sbjct: 347 VHRDGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEE 392

>NDAI0E03020 Chr5 complement(643198..644388) [1191 bp, 396 aa] {ON}
           Anc_8.500
          Length = 396

 Score =  152 bits (384), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 98/342 (28%), Positives = 160/342 (46%), Gaps = 51/342 (14%)

Query: 142 YDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSDCTD 201
           +DL++ +   + + N++ VL+  PL+         ++N++ L+YP ELI++ F+V     
Sbjct: 100 FDLNKLHSTKDASINKEKVLILTPLQ---KFHQEYWENILQLSYPRELIELGFIVP---- 152

Query: 202 NGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMGKDYLKMVKNAFNPP 261
             RT           Q G L+  LQ  E   +K  +                        
Sbjct: 153 --RT-----------QTGDLA--LQSLEKAVEKTQT------------------------ 173

Query: 262 FHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANALKPYHS 321
             D  ++ F  + I  +D          +RHA+ VQ  RR  M  ARN L  + + P+ S
Sbjct: 174 --DKKNQRFAKVTILRQDSESFNKLAEKERHALNVQKERRSSMALARNELLFSTIGPHTS 231

Query: 322 WVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPL---PTFLGGAQAYDLNSWVESNEA 378
           WV W D D+   P T+I+D+  HD  V+  NV++            + YD N+W ES   
Sbjct: 232 WVLWLDADIVETPSTLIQDMTAHDKSVLAANVFQRYYDDEKKASATRPYDFNNWQESEIG 291

Query: 379 IKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXSILARAQLFRK 438
           ++LA  +++D++IVEGY+E  T+R  + Y                      L +A++ R 
Sbjct: 292 LELASKMNDDEIIVEGYSEIATYRPLMAYFHDTTKPVSEEMILDGVGGGCTLVKAEVHRD 351

Query: 439 GIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYE 480
           G  FP+F F +  ETE F KMAK++G+++ GL +Y ++HI E
Sbjct: 352 GAMFPSFPFYHLIETEGFAKMAKRLGYEIFGLPNYLVYHIEE 393

>KNAG0A02150 Chr1 complement(187175..188365) [1191 bp, 396 aa] {ON}
           Anc_8.500 YPL050C
          Length = 396

 Score =  152 bits (384), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 101/342 (29%), Positives = 157/342 (45%), Gaps = 51/342 (14%)

Query: 142 YDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSDCTD 201
           YDL++ +     A N++ VL+  P++   +     + N++++TYP ELI++ F+      
Sbjct: 100 YDLNKLHSTKQAAVNKERVLILTPMQ---TFHEQYWDNILHMTYPRELIELGFIAPRTPT 156

Query: 202 NGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMGKDYLKMVKNAFNPP 261
               +  L    K++Q+G  ++        + +  S + L  K                 
Sbjct: 157 GDAALKKLEAAIKKIQSGKKNERFAKIIILRQESQSFDMLAEK----------------- 199

Query: 262 FHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANALKPYHS 321
                                       DRHA+ VQ  RR  M  ARN L  + L P+ S
Sbjct: 200 ----------------------------DRHALAVQKQRRSAMALARNELLFSTLGPHTS 231

Query: 322 WVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVW-RPLPTFLGGA--QAYDLNSWVESNEA 378
           WV W D D+   P TVI+DL  HD  V+  NV+ R     L  A  + YD N+W ES   
Sbjct: 232 WVLWLDADIVETPPTVIQDLAAHDKPVLAANVYQRFFNDELSKADIRPYDFNNWQESETG 291

Query: 379 IKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXSILARAQLFRK 438
           ++LA +L  D++IVEGYAE  T+R  + +   ++                 L +A++ R 
Sbjct: 292 LELANSLPADEIIVEGYAEMATFRPLMAHFFDESKPVSEEMALDGVGGGCTLVKAEVHRD 351

Query: 439 GIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYE 480
           G  FP F F +  ETE F KMAK++G++V GL +Y ++HI E
Sbjct: 352 GAMFPNFPFYHLIETEGFAKMAKRLGYEVFGLPNYLVYHIEE 393

>Kpol_1031.78 s1031 (197094..198272) [1179 bp, 392 aa] {ON}
           (197094..198272) [1179 nt, 393 aa]
          Length = 392

 Score =  152 bits (383), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 105/363 (28%), Positives = 169/363 (46%), Gaps = 65/363 (17%)

Query: 128 EREADMLLASTTDLYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPH 187
           +R  D++       YDL++ +  S+  ++++HVL+  P++   +     ++NL+ L+YP 
Sbjct: 85  DRVEDIIPEGHIAHYDLNKLHSTSDSISDKEHVLVLTPMQ---TFHEKYWENLLKLSYPR 141

Query: 188 ELIDIAFLVSDCTDNGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMG 247
           ELI++ F++                                    D G++A         
Sbjct: 142 ELIELGFIIPRS---------------------------------DAGDAA--------- 159

Query: 248 KDYLKMVKNAFNPPFHDDYDKPFRSIQIFEKDFGQQIGQGF-----SDRHAVKVQGVRRK 302
              LK ++ A      D  +  F  I I      +Q  Q F      +RH++ VQ  RR 
Sbjct: 160 ---LKKLETAVKNVQSDKKNNRFSKITIL-----RQESQSFDKLEEKERHSLAVQKERRA 211

Query: 303 LMGRARNWLTANALKPYHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTFLG 362
            M  ARN L  + L P+ SWV W D D+   P TVIE + KHD  V+  NV++    F  
Sbjct: 212 AMALARNELLFSTLGPHTSWVLWLDSDIVETPTTVIESMTKHDKPVLAANVYQRF--FDN 269

Query: 363 GAQ-----AYDLNSWVESNEAIKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXX 417
             Q      YD N+W ES+  ++LA  + +D++IVEGYAE  T+R  + +    +G+   
Sbjct: 270 DKQQDSIRPYDFNNWAESDIGLQLASKMGDDEIIVEGYAEIATYRPLMAHFYNPSGDVGE 329

Query: 418 XXXXXXXXXXSILARAQLFRKGIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWH 477
                       L +A++ R G  FP F F +  ETE F KMAK++ ++V GL ++ ++H
Sbjct: 330 EMALDGVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNFLVYH 389

Query: 478 IYE 480
           I E
Sbjct: 390 IEE 392

>NCAS0C02330 Chr3 complement(437234..438415) [1182 bp, 393 aa] {ON}
           Anc_8.500
          Length = 393

 Score =  150 bits (380), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 99/347 (28%), Positives = 162/347 (46%), Gaps = 61/347 (17%)

Query: 142 YDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSDCTD 201
           YDL++ +  S+ A N++ +L+  P++         ++NL+ LTYP ELI++ F+      
Sbjct: 97  YDLNKLHSTSDAAINKEKILILTPIQ---KFHQEYWENLLQLTYPRELIELGFIAPRTPT 153

Query: 202 NGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMGKDYLKMVKNAFNPP 261
             + +++L                   EA  DK  S                        
Sbjct: 154 GDQALAAL-------------------EAAVDKVQS------------------------ 170

Query: 262 FHDDYDKPFRSIQIFEKDFGQQIGQGFS-----DRHAVKVQGVRRKLMGRARNWLTANAL 316
             D  ++ F  + I  +D       GF+     +RHA++VQ  RR  M  ARN L  + +
Sbjct: 171 --DKKNQRFSKVTILRQD-----SVGFNKLTEKERHALEVQKERRASMALARNELLFSTI 223

Query: 317 KPYHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPL---PTFLGGAQAYDLNSWV 373
            P+ SWV W D D+   P ++I+D+  HD  V+  NV++            + YD N+W 
Sbjct: 224 GPHTSWVLWLDADIIETPASLIQDMTAHDRAVLSANVFQRYYDEEKKQKAIRPYDFNNWQ 283

Query: 374 ESNEAIKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXSILARA 433
           ES+  ++LA  + +D++IVEGYAE  T+R  + Y    + +               L +A
Sbjct: 284 ESDTGLELASKMKDDEIIVEGYAEIATYRPLMAYFHDPDNSVAEEMRLDGVGGGCTLVKA 343

Query: 434 QLFRKGIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYE 480
           ++ R G  FP F F +  ETE F KMAK++ ++V GL +Y ++HI E
Sbjct: 344 EVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVYHIEE 390

>KLTH0E11616g Chr5 (1035396..1036580) [1185 bp, 394 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050C MNN9 Subunit of Golgi mannosyltransferase
           complex also containing Anp1p Mnn10p Mnn11p and Hoc1p
           that mediates elongation of the polysaccharide mannan
           backbone forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 394

 Score =  150 bits (380), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 96/352 (27%), Positives = 164/352 (46%), Gaps = 51/352 (14%)

Query: 132 DMLLASTTDLYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELID 191
           D + A     YDL++        AN++ VL+  P++   +     + NL+ LTYP +LI+
Sbjct: 89  DNIPAGHISHYDLNKLTSTDKAFANKEQVLILTPMQ---TFHDQYWDNLLQLTYPRDLIE 145

Query: 192 IAFLVSDCTDNGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMGKDYL 251
           + F++                    +  T    L+  EA   +           +GK   
Sbjct: 146 LGFIIP-------------------RTATGDTALRKLEAAVKRTQ---------LGKK-- 175

Query: 252 KMVKNAFNPPFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWL 311
                          D+ F  I I  +D          +RHA+KVQ  RR  M  ARN L
Sbjct: 176 ---------------DQRFSKITILRQDSQSFDSLQEKERHALKVQKERRAAMALARNEL 220

Query: 312 TANALKPYHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPL---PTFLGGAQAYD 368
             + + P+ SW+ W D D+   P ++I+D+  H+  V+  NV++      T     + YD
Sbjct: 221 LFSTIGPHTSWILWLDADIIETPPSLIQDMTAHNKPVLAANVYQKYMNEETKKIAERPYD 280

Query: 369 LNSWVESNEAIKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXS 428
            N+W +S +A+++A  + +D+V+ EGYAE PT+R  + ++   +G+              
Sbjct: 281 FNNWADSEKALQMAAGMADDEVLFEGYAELPTYRTLMAHMYDASGSQAAEMSLDGVGGGC 340

Query: 429 ILARAQLFRKGIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYE 480
            L +A++ R G  FP+F F +  ETE F KMA+++ +++ GL +Y ++HI E
Sbjct: 341 TLVKAEVHRDGAMFPSFPFYHLIETEGFAKMARRLEYEIFGLPNYLVYHIEE 392

>KAFR0H01390 Chr8 complement(258984..260180) [1197 bp, 398 aa] {ON}
           Anc_8.500 YPL050C
          Length = 398

 Score =  150 bits (380), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 101/343 (29%), Positives = 160/343 (46%), Gaps = 53/343 (15%)

Query: 142 YDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSDCTD 201
           YDL++    +  A N++ VL+  P++   +     ++NL+ LTYP ELI++ F++     
Sbjct: 102 YDLNKLRSTAYAAVNKERVLILTPMQ---TFHKQYWENLLQLTYPRELIELGFIIP---- 154

Query: 202 NGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMGKDYLKMVKNAFNPP 261
             RT +                                       G++ LK ++ A    
Sbjct: 155 --RTKT---------------------------------------GENALKELEIAIKKV 173

Query: 262 FHDDYDKPFRSIQIFEKDFGQQIGQ-GFSDRHAVKVQGVRRKLMGRARNWLTANALKPYH 320
             D  ++ F  I I  +D  Q   Q    DRH++ VQ  RR  M  ARN L  + L P+ 
Sbjct: 174 QSDKKNQRFAKITILRQD-SQSFDQLAEKDRHSILVQKERRAAMALARNELLFSTLGPHT 232

Query: 321 SWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPL---PTFLGGAQAYDLNSWVESNE 377
           +WV W D D+   P TVI+D+  HD  V+  NV++            + YD N+W ES+ 
Sbjct: 233 AWVLWLDADIIETPPTVIQDMTSHDKSVLAANVYQKYFDNDEKKMAIRPYDFNNWRESDI 292

Query: 378 AIKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXSILARAQLFR 437
            +++A  +DE+++IVEGY+E  T+R  + +    +G                L +A + R
Sbjct: 293 GLEIAANMDENEIIVEGYSEIATYRPLMAHFYNADGQVTDEMELDGVGGGCTLVKADVHR 352

Query: 438 KGIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYE 480
            G  FP F F +  ETE F KMAK++ + V GL +Y ++HI E
Sbjct: 353 DGAMFPNFPFYHLIETEGFAKMAKRLNYGVFGLPNYLVYHIEE 395

>TPHA0L01370 Chr12 (286001..287179) [1179 bp, 392 aa] {ON} Anc_8.500
           YPL050C
          Length = 392

 Score =  150 bits (379), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 92/342 (26%), Positives = 154/342 (45%), Gaps = 51/342 (14%)

Query: 142 YDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSDCTD 201
           YDL++ +   +    ++HVL+  P++   +     + NL+ ++YP  L+++ F++     
Sbjct: 99  YDLNKLHSTKDAMKLKEHVLIATPMQ---TFHDAYWSNLLKMSYPRSLLELGFIIPRTPT 155

Query: 202 NGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMGKDYLKMVKNAFNPP 261
              T+  L    K +Q G +                                        
Sbjct: 156 GDETLKKLEAAVKNVQTGKV---------------------------------------- 175

Query: 262 FHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANALKPYHS 321
                +  F  I I  +D       G  +RH++ VQ  RR  M  ARN L  +++ P  S
Sbjct: 176 -----EDRFAKITILRQDSQSFDKLGEKERHSLAVQKERRSAMALARNELLFSSIGPSTS 230

Query: 322 WVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPL---PTFLGGAQAYDLNSWVESNEA 378
           WV W D D+   P TVI+D+  H+  V+  NV++            + YD N+W ES + 
Sbjct: 231 WVLWLDADIVETPATVIQDMTNHNKPVLAANVYQRFFDKEKNENSIRPYDFNNWAESEKG 290

Query: 379 IKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXSILARAQLFRK 438
           +++AK ++ED++IVEGYAE  T+R  + +     G                L +A++ R 
Sbjct: 291 LEIAKNMNEDEIIVEGYAEIATYRPLMAHFYDKAGKIDALMALDGVGGGCTLVKAEVHRD 350

Query: 439 GIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYE 480
           G  FP F F +  ETE F KMAK++ +++ GL +Y ++HI E
Sbjct: 351 GAMFPNFPFYHLIETEGFAKMAKRLNYEIFGLPNYLVYHIEE 392

>Skud_16.232 Chr16 complement(424904..426091) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  150 bits (378), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 97/346 (28%), Positives = 166/346 (47%), Gaps = 59/346 (17%)

Query: 142 YDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSDCTD 201
           YDL++ +  S+ A N++HVL+  P++   +     + NL+ L+YP ELI++ F+      
Sbjct: 99  YDLNKLHSTSDAAVNKEHVLILTPMQ---TFHQQYWDNLLQLSYPRELIELGFITP---- 151

Query: 202 NGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMGKDYLKMVKNAFNPP 261
             RT +  L   K L+N      ++  + DK     ++   L+   + + K+++      
Sbjct: 152 --RTATGDLAL-KNLENA-----IKKVQTDKKTQRFSKITILRQNSQSFDKLME------ 197

Query: 262 FHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANALKPYHS 321
                                       +RHA+ VQ  RR  M  ARN L  + + P+ S
Sbjct: 198 ---------------------------KERHALDVQKERRAAMALARNELLFSTIGPHTS 230

Query: 322 WVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPL-------PTFLGGAQAYDLNSWVE 374
           W+ W D D+   P ++I+D+ +HD  V+  N+++         P+     + YD N+W E
Sbjct: 231 WILWLDADIIETPVSLIQDMTQHDKAVLAANIYQRFYDQEKKQPSI----RPYDFNNWQE 286

Query: 375 SNEAIKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXSILARAQ 434
           S+  +++A  + +D++IVEGYAE  T+R  + +    +G P              L +A 
Sbjct: 287 SDTGLEIASQMGDDEIIVEGYAEIATYRPLMAHHYNADGLPNEEMALDGVGGGCTLVKAD 346

Query: 435 LFRKGIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYE 480
           + R G  FP F F +  ETE F KMAK++ + V GL +Y ++HI E
Sbjct: 347 VHRDGAMFPNFPFYHLIETEGFAKMAKRLNYNVFGLPNYLVYHIEE 392

>AGL259C Chr7 complement(221445..222614) [1170 bp, 389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL050C
           (MNN9)
          Length = 389

 Score =  147 bits (372), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 98/338 (28%), Positives = 148/338 (43%), Gaps = 50/338 (14%)

Query: 142 YDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSDCTD 201
           YDL+     +  AAN + VL+  P++         + NL+ LTYP + I + FL+   + 
Sbjct: 97  YDLNTLQSTAMAAANGEQVLILTPMQ---IFHQQYWDNLLLLTYPRKYIHLGFLLPRTSS 153

Query: 202 NGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMGKDYLKMVKNAFNPP 261
               +  L    +++Q G                                          
Sbjct: 154 GNTALRKLEKAVRKVQTGP----------------------------------------- 172

Query: 262 FHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANALKPYHS 321
                D+ F  I I  +DF        S RH   VQ  RR  M  ARN L  + + PY S
Sbjct: 173 ----KDQRFGKITILRQDFASFNKLSQSARHRFHVQKERRSAMALARNELLFSTIGPYTS 228

Query: 322 WVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVW-RPLPTFLGGAQAYDLNSWVESNEAIK 380
           WV W D D+   P T+IED+  H+  ++  NV+ R +       +AYDLN+W ES   +K
Sbjct: 229 WVLWLDSDIVETPNTLIEDMTSHNKPILAANVYQRYVENGEPAIRAYDLNNWAESELGLK 288

Query: 381 LAKTLDEDDVIVEGYA-EYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXSILARAQLFRKG 439
           +A  L ED +IVEGY  E+ T+R  + ++  D                  L +A++ R G
Sbjct: 289 IASELPEDQIIVEGYGDEFATYRPLMAHMYSDKRPKDELMALDGVGGGCTLVKAEVHRDG 348

Query: 440 IHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWH 477
             FP F F +  ETE F KMAK++ +++ GL +Y ++H
Sbjct: 349 AMFPNFPFYHLIETEGFAKMAKRLNYEIYGLPNYLVYH 386

>Ecym_2550 Chr2 (1066925..1068097) [1173 bp, 390 aa] {ON} similar to
           Ashbya gossypii AGL259C
          Length = 390

 Score =  145 bits (366), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 95/341 (27%), Positives = 157/341 (46%), Gaps = 50/341 (14%)

Query: 142 YDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSDCTD 201
           YD++     S+  AN++ VL+  P++         ++NL++LTYP +L  + F++     
Sbjct: 98  YDMNTLTTTSSPLANKEIVLILTPMQ---KFHDKYWENLLSLTYPRKLTQLGFIIPRTPT 154

Query: 202 NGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMGKDYLKMVKNAFNPP 261
               M  L D  K++Q+G  ++                    +++    L+    +FN  
Sbjct: 155 GDVAMKRLEDAVKKVQSGKENQ--------------------RFLKITILRQDSQSFN-- 192

Query: 262 FHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANALKPYHS 321
                       ++ EK+           RHA  VQ  RR  M  ARN L  + + P  S
Sbjct: 193 ------------KLDEKE-----------RHAFNVQKERRAAMALARNELVFSTIGPSTS 229

Query: 322 WVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPL--PTFLGGAQAYDLNSWVESNEAI 379
           W+ W D D+   P TVI+D+  HD  ++  NV++           + YD N+W ES   +
Sbjct: 230 WILWLDADIVETPATVIQDMAAHDKAILAANVFQRYIDDQNQENIRPYDFNNWQESQTGL 289

Query: 380 KLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXSILARAQLFRKG 439
           ++A ++ +D++IVE Y E  T+R  +  L   NG+P              L +AQ+ R G
Sbjct: 290 EIAASMKDDEIIVESYHEIVTYRPLMAKLYDPNGSPSAEMSLDGVGGGCTLVKAQVHRDG 349

Query: 440 IHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYE 480
             FP F F +  ETE F  MAK++ ++V GL +Y ++H  E
Sbjct: 350 AMFPNFPFYHLIETEGFAHMAKRLNYEVFGLPNYLVYHFNE 390

>ZYRO0F08492g Chr6 (684329..685519) [1191 bp, 396 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050C MNN9 Subunit of Golgi mannosyltransferase
           complex also containing Anp1p Mnn10p Mnn11p and Hoc1p
           that mediates elongation of the polysaccharide mannan
           backbone forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 396

 Score =  144 bits (364), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 100/361 (27%), Positives = 164/361 (45%), Gaps = 61/361 (16%)

Query: 128 EREADMLLASTTDLYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPH 187
           +R  D++  +    YDL++ +  +  A N++HVL+  P++   +     + NL+ LTYP 
Sbjct: 86  DRVEDIIPENHIAHYDLNKLHSTAEAALNKEHVLILTPMQ---TFHQEYWDNLLQLTYPR 142

Query: 188 ELIDIAFLVSDCTDNGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMG 247
           E  ++ F++       RT S  +  SK      L   ++  + DK               
Sbjct: 143 EFTELGFILP------RTSSGDIALSK------LEAAVKKVQTDKK-------------- 176

Query: 248 KDYLKMVKNAFNPPFHDDYDKPFRSIQIFEKDFGQQIGQGF-----SDRHAVKVQGVRRK 302
                              ++ F  I I      +Q   GF      +RHA++VQ  RR 
Sbjct: 177 -------------------NQRFSKITIL-----RQNSAGFDKLMEKERHALEVQKERRS 212

Query: 303 LMGRARNWLTANALKPYHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPL---PT 359
            M  ARN L  ++L P  SWV W D D+   P  +I+D+  H+  V+  NV++       
Sbjct: 213 AMASARNELLFSSLGPKTSWVLWLDADIVETPPNLIQDMTSHNKAVLSANVYQKYYDDQA 272

Query: 360 FLGGAQAYDLNSWVESNEAIKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXX 419
                + YD N+W ES+ A++LAK + +D+++VEGY +  T+R  + Y     G      
Sbjct: 273 KKVQIRPYDFNNWQESDTALELAKQMGDDEILVEGYGDLATYRALMAYFYDATGATNAEM 332

Query: 420 XXXXXXXXSILARAQLFRKGIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIY 479
                     L +A + R G  FP F F +  ETE F KMA+++ + + GL +Y ++HI 
Sbjct: 333 NLDGVGGGCTLVKADVHRDGAMFPTFPFYHLIETEGFAKMAQRLNYDIFGLPNYLVYHIE 392

Query: 480 E 480
           E
Sbjct: 393 E 393

>Suva_16.265 Chr16 complement(463836..465023) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  142 bits (358), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 97/347 (27%), Positives = 160/347 (46%), Gaps = 61/347 (17%)

Query: 142 YDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSDCTD 201
           YDL++ +   + A N++H+L+  P++   +     + NL+ L YP ELI++ F+      
Sbjct: 99  YDLNKLHSTPDAAVNKEHILILTPMQ---TFHQQYWDNLLQLNYPRELIELGFITP---- 151

Query: 202 NGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMGKDYLKMVKNAFNPP 261
             RT +                           G+SA            LK +++A    
Sbjct: 152 --RTAT---------------------------GDSA------------LKKLESAIKKV 170

Query: 262 FHDDYDKPFRSIQIFEKDFGQQIGQGF-----SDRHAVKVQGVRRKLMGRARNWLTANAL 316
             D   + F  I I      +Q  Q F      +RHA++VQ  RR  M  ARN L  + +
Sbjct: 171 QTDKKTQRFSKITIL-----RQNSQSFDKLMEKERHALEVQKERRAAMALARNELLFSTI 225

Query: 317 KPYHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPL---PTFLGGAQAYDLNSWV 373
            P+ SWV W D D+   P ++I+D+ +H+  V+  N+++            + YD N+W 
Sbjct: 226 GPHTSWVLWLDADIIETPTSLIQDMTQHNKAVLAANIYQRFYDQEKKQASIRPYDFNNWQ 285

Query: 374 ESNEAIKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXSILARA 433
           ES+  + +A  + +D++IVEGYAE  T+R  + +    +                 L +A
Sbjct: 286 ESDIGLDIASQMGDDEIIVEGYAEIATYRPLMAHFFDASKPQNEEMALDGVGGGCTLVKA 345

Query: 434 QLFRKGIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYE 480
           ++ R G  FP F F +  ETE F KMAK++ + V GL +Y ++HI E
Sbjct: 346 EVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEE 392

>CAGL0L12804g Chr12 (1371568..1372749) [1182 bp, 393 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050c required for complex N-glycosylation
          Length = 393

 Score =  140 bits (352), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 96/353 (27%), Positives = 158/353 (44%), Gaps = 67/353 (18%)

Query: 142 YDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSDCTD 201
           YDL++ +  S+ A N++ VL+  P++   +     + NL+ LTYP +L+++ F++     
Sbjct: 97  YDLNKLHSTSDAAVNKEQVLILTPMQ---TFHQAYWDNLLQLTYPRDLLELGFIIPKSAS 153

Query: 202 NGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMGKDYLKMVKNAFNPP 261
               +  L    K  Q               DK N+                        
Sbjct: 154 GDAALKQLEAAVKRAQT--------------DKKNNR----------------------- 176

Query: 262 FHDDYDKPFRSIQIFEKDFGQQIGQGF-----SDRHAVKVQGVRRKLMGRARNWLTANAL 316
                   F  + I  +D      +GF      +RHA+ VQ  RR  M  ARN L  + +
Sbjct: 177 --------FGKVTILRQD-----SKGFDKLQEKERHALAVQKERRSAMALARNELLFSTI 223

Query: 317 KPYHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTFLGGAQ------AYDLN 370
            P+ SWV W D D+     ++I+D+   +  V+  NV++    +   A+       YD N
Sbjct: 224 GPHTSWVLWLDADIIETKPSLIQDMTALNKPVLAANVYQ---RYFDEAENKPSIRPYDFN 280

Query: 371 SWVESNEAIKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXSIL 430
           +W +S  A +L   + +D++IVEGYAE  T+R  + +    +G P              L
Sbjct: 281 NWADSQIAQELGDKMGDDEIIVEGYAEIATYRPLMAHFYTPDGPPNELMSLDGVGGGCTL 340

Query: 431 ARAQLFRKGIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYEPSD 483
            +A++ R G  FP F F +  ETE F KMAK++ ++V GL +Y ++HI E +D
Sbjct: 341 VKAEVHRDGAMFPTFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVFHIEERND 393

>NCAS0B02440 Chr2 complement(408198..409400) [1203 bp, 400 aa] {ON}
           Anc_8.500
          Length = 400

 Score =  137 bits (346), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 90/353 (25%), Positives = 156/353 (44%), Gaps = 50/353 (14%)

Query: 128 EREADMLLASTTDLYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPH 187
           +R  D +       YDL++   ++N A N++HVL+  PL+   S     + NL+ L+YP 
Sbjct: 92  DRAEDTIPEGHIAHYDLNKLQSSANAAENKEHVLILTPLK---SFEQGYWDNLLKLSYPR 148

Query: 188 ELIDIAFLVSDCTDNGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMG 247
           + I++ F++        ++  L    K++Q              +      E +  K   
Sbjct: 149 DAIELGFIIPRTKKGDHSLKKLESAIKKVQTAKQGDKFSKITILRQNSKGFETVPEKK-- 206

Query: 248 KDYLKMVKNAFNPPFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRA 307
                                     ++ E ++ +QI                R  M  A
Sbjct: 207 --------------------------EVSEIEYEKQI----------------RAEMALA 224

Query: 308 RNWLTANALKPYHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTFLGGA--- 364
           RN L A+ L P  +W+ W D D+   P ++I+D+  HD  V+  NV+        G    
Sbjct: 225 RNELLASTLGPQTAWILWLDSDIVETPPSLIQDMTHHDKPVLAANVYERYKDRESGELSI 284

Query: 365 QAYDLNSWVESNEAIKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXX 424
           + YD  +W+ES EA++LA  + ED++IVEG A   T R  + +  + +G+P         
Sbjct: 285 RPYDFRNWIESTEALQLASGMQEDEIIVEGLAGISTNRQLMTHFYQQDGSPSSEISLDGV 344

Query: 425 XXXSILARAQLFRKGIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWH 477
               +L ++++ R G  FP F F +  E+E F KMAK++ ++V GL +Y ++H
Sbjct: 345 GASCLLVKSEVHRDGAMFPNFPFYHLIESEGFAKMAKRLTYEVYGLPNYLVYH 397

>NDAI0C05250 Chr3 (1217841..1219049) [1209 bp, 402 aa] {ON}
           Anc_8.500
          Length = 402

 Score =  134 bits (337), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 92/337 (27%), Positives = 164/337 (48%), Gaps = 43/337 (12%)

Query: 142 YDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSDCTD 201
           YDL++   ++N   N++HVL+  PL+   S     ++NL+NL+YP +LI++ F+V +   
Sbjct: 105 YDLNKLVSSANALENKEHVLILTPLQ---SFDEKYWENLLNLSYPRDLIELGFMVPNTKK 161

Query: 202 NGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMGKDYLKMVKNAFNPP 261
             + +  L +  K +Q             DK  G++      K+     L+   + F+  
Sbjct: 162 GDQILKQLENAVKNVQG-----------IDKKLGSN------KFAKITILRQKDSGFHK- 203

Query: 262 FHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANALKPYHS 321
           F+D  DK                     + + ++++  +R  M  ARN L ++ L    +
Sbjct: 204 FNDRKDK--------------------KEMNDIELEKEKRAEMALARNELLSSTLSHSTA 243

Query: 322 WVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTFLGGA--QAYDLNSWVESNEAI 379
           W+ W D +V   P T+I+D+ +HD  V+  NV+         A  + YD  +W+ES+ A+
Sbjct: 244 WILWLDSNVIETPNTLIQDMTQHDKPVLATNVYMKDSNDKDKANIRPYDFRNWIESDTAL 303

Query: 380 KLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXXXXXXXXXSILARAQLFRKG 439
           +LA  + ED++IVEG A   T R  +    + +G+P              L ++++ R G
Sbjct: 304 QLASEMPEDEIIVEGMAGLATNRQLMTNFYESDGSPTEELALDGIGAACTLVKSEVHRDG 363

Query: 440 IHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLW 476
             FP F F +  E+E F KMAK++ ++V GL +Y ++
Sbjct: 364 AMFPNFPFYHLIESEGFAKMAKRLTYEVVGLPNYLVF 400

>KNAG0A03990 Chr1 complement(535490..536563) [1074 bp, 357 aa] {ON} 
          Length = 357

 Score = 82.4 bits (202), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 79/175 (45%), Gaps = 3/175 (1%)

Query: 301 RKLMGRARNWLTANALKPYHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTF 360
           RK +   +N L  + L PY SWV W D  +   P T+++DL  H   ++  +++      
Sbjct: 183 RKQLAALKNQLLFSTLPPYCSWVLWLDSQITGTPTTLVQDLANHGKAILTTHIFN---NS 239

Query: 361 LGGAQAYDLNSWVESNEAIKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPXXXXX 420
            G   +  LN+WV S+    LA  +    V++EG +   T R  +G       +      
Sbjct: 240 DGSPDSETLNNWVASDTWRSLATGMPHSRVVIEGVSHVYTDRPLMGQFYDAAASVLTEME 299

Query: 421 XXXXXXXSILARAQLFRKGIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTL 475
                    L +A++ R G  FP F F +  ETE F +MA+ +  +  GL +Y +
Sbjct: 300 LDSVSTACTLVKAEVHRDGAMFPNFAFHHLVETEGFARMARLLKHQAFGLPNYVV 354

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 42/76 (55%), Gaps = 3/76 (3%)

Query: 142 YDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSDCTD 201
           Y+L++   + +   + +H+L+ +PL +  S     F+NL  LTYP +LID+  +V D  +
Sbjct: 82  YNLNELAASPDAEGHSEHILVLIPLINFNS---RFFENLFALTYPKQLIDLGVIVPDSKN 138

Query: 202 NGRTMSSLLDFSKELQ 217
               + +L +   ++Q
Sbjct: 139 ATGILQALQETLAKVQ 154

>SAKL0H20438g Chr8 (1793911..1793929,1794594..1796272) [1698 bp, 565
           aa] {ON} weakly similar to gnl|GLV|DEHA0C12881g
           Debaryomyces hansenii DEHA0C12881g
          Length = 565

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/207 (24%), Positives = 80/207 (38%), Gaps = 29/207 (14%)

Query: 290 DRHAVKVQGVRRKLMGRARNWLTANALKPYHSWVYWRDVDVELCPGTVIEDLMKHDYDVI 349
           DRH   VQ  RRK + + RN+L  N       +    D D+ + P  ++E  +K   ++I
Sbjct: 368 DRHKDSVQRARRKTIAKVRNFL-YNRSHMDEKYTLTIDSDMMVIPSDMLEKFVKMGKELI 426

Query: 350 VPNVWRPLPTFLGGAQAYDLNSWVESNEAIKLAKTLDEDDVIVEGYAEYP----TWRVHL 405
           VP + R     +G  + YD N+W+   E  K   T  +++   E Y   P    T  +  
Sbjct: 427 VPRILR-----VGSDREYDKNTWI--GERTKPEDTSKQNN--YESYVPRPVNGKTKFLQD 477

Query: 406 GYLRKDNGNPXXXXXXXXXXXXSI-----LARAQLFRKGIHFPAFTF----------ENH 450
               K   N             S+         ++F +GI FP F             + 
Sbjct: 478 CVDEKITLNSPEAYTDNVVELDSVGGAILFWDNKIFDQGIQFPVFYLIGSDWDHSEGYDG 537

Query: 451 AETEAFGKMAKKMGFKVGGLMHYTLWH 477
            ETE     AK +G+K  G+ +    H
Sbjct: 538 VETEGLCYQAKTLGYKCYGVPNVICRH 564

>Kwal_55.19818 s55 complement(140297..140905) [609 bp, 202 aa] {ON}
           YJR112W (NNF1) - nuclear envelope protein [contig 159]
           FULL
          Length = 202

 Score = 34.3 bits (77), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 33/73 (45%), Gaps = 10/73 (13%)

Query: 202 NGRTMSSLLDFSKEL---------QNGTLSKTLQDFEAD-KDKGNSAEQLYLKYMGKDYL 251
           NG   +S L+ SKEL          N  L K LQ+  AD + +     QLY KY+GKD  
Sbjct: 119 NGNLHNSRLELSKELDERLSKMSGMNEQLQKELQELYADVEQESQEVHQLYDKYLGKDTA 178

Query: 252 KMVKNAFNPPFHD 264
            +  +A      +
Sbjct: 179 SLADDALQQGLRN 191

>TBLA0B05460 Chr2 complement(1299725..1300549) [825 bp, 274 aa] {ON}
           Anc_2.503 YKL007W
          Length = 274

 Score = 34.3 bits (77), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 28/43 (65%), Gaps = 2/43 (4%)

Query: 270 FRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKL-MGRAR-NW 310
            ++I+ FE DF +Q+   F+D +  K + +RR+L + RAR NW
Sbjct: 215 LKTIKSFESDFEKQLDVSFNDLNEKKFKTLRRRLPVSRARVNW 257

>TPHA0H01510 Chr8 (340988..343018) [2031 bp, 676 aa] {ON} Anc_5.377
           YDR332W
          Length = 676

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 39/136 (28%), Positives = 67/136 (49%), Gaps = 20/136 (14%)

Query: 156 NRDHVLLCVPLRDAASLLPMLFKNL-MNLTYPH-ELIDIAFLVSDCTDNGRTMSSLLDFS 213
           N D VLLC P +  + L+ M+ + L ++ +  H  +ID   + +    +  T+  + +F+
Sbjct: 335 NIDCVLLCRPTKSRSLLVQMIGRGLRLHHSKKHCHIIDFVGVENVGVVSVPTLMGIDNFN 394

Query: 214 KELQNGTLSK--TLQDFEADKDK-----GNSAEQLYLKYMGKDYLKMVKNAFNPPFHDDY 266
            EL+  T+S+  TL+  + DK+K      N+A +  LK    DYL+          H+D+
Sbjct: 395 DELEAATISELNTLK-LQIDKEKQEMVLKNAAVEDSLKAKYNDYLEE---------HNDF 444

Query: 267 DKPFRSIQIFEKDFGQ 282
           D    S   FE DF +
Sbjct: 445 DLTLTSYPSFE-DFCE 459

>CAGL0D02574g Chr4 (263063..266116) [3054 bp, 1017 aa] {ON} similar
           to uniprot|P33760 Saccharomyces cerevisiae YNL329c PAS8
           peroxisomal assembly protein
          Length = 1017

 Score = 31.6 bits (70), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 50/116 (43%), Gaps = 3/116 (2%)

Query: 11  ELPMHHDSKQKGNHFRPKSGFGLFFAKINGLRYAKSRIVFLFALVLVSTFLLLSKLVGGN 70
           ELP+        N     +   +  +K+  + + + R   L    L   FL   +++   
Sbjct: 281 ELPLVEVEPVYNNELAFPTASEVVISKVGNVLHTQKRYQELILQKLRYYFLTARRILSNG 340

Query: 71  VNLMQYIPTSLDEQEYYDYDFKGLDIDTIKKYDEGVSHYIISKGGMEALSSEDKEA 126
             +   I +S DE    D D   LD++TIK  D+ +  +++S    E +S+ D +A
Sbjct: 341 SLIPITIDSSFDEIILEDID---LDVNTIKSDDDCIVWFVVSNRKFENISNYDPKA 393

>Suva_6.55 Chr6 (103697..106177) [2481 bp, 826 aa] {ON} YFL004W
           (REAL)
          Length = 826

 Score = 30.8 bits (68), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 52/117 (44%), Gaps = 5/117 (4%)

Query: 99  IKKYD---EGVSHYIISKGGMEALSSEDKEAFEREADMLLASTTDLYDLSQYNGASNGAA 155
           +KKY+   E ++H         A+ + D +AF+R  + LL+ +T+L +  + N       
Sbjct: 69  LKKYNNLIERLTHLEKQTDSESAIKALDSDAFQRILEELLSESTELDNFKRLNFTGFVKI 128

Query: 156 NRDHVLLCVPLRDAASLLPMLFKNLMNLT--YPHELIDIAFLVSDCTDNGRTMSSLL 210
            + H  L        SLL +  K L + +  Y   L  I+FL +    N  TMS  L
Sbjct: 129 VKKHDKLHPKYPSVKSLLEVRLKELPSHSEEYSPLLYRISFLYNILRSNFNTMSQSL 185

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.138    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,135,201
Number of extensions: 2436286
Number of successful extensions: 6507
Number of sequences better than 10.0: 80
Number of HSP's gapped: 6622
Number of HSP's successfully gapped: 118
Length of query: 501
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 387
Effective length of database: 40,409,475
Effective search space: 15638466825
Effective search space used: 15638466825
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)