Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D01507gna 1ON51551523630.0
SAKL0D01408gna 1ON50646211751e-156
Ecym_4614na 1ON4814488581e-109
ABL123Cna 1ON4943836871e-83
ACR144W8.677ON4083511651e-11
TBLA0B038308.677ON4133571642e-11
NCAS0C013608.677ON4063611623e-11
TPHA0D012608.677ON4193481614e-11
NDAI0E021058.677ON4083571605e-11
KLLA0D05929g8.677ON4093731605e-11
KNAG0J017108.677ON4153711562e-10
Kpol_1013.68.677ON4023551543e-10
Smik_6.3518.677ON4053491482e-09
KLTH0D11264g8.677ON4174111482e-09
Kwal_26.88028.677ON4123491463e-09
CAGL0M02211g8.677ON4153541463e-09
YPL154C (PEP4)8.677ON4053491437e-09
Skud_16.1288.677ON4053491437e-09
Ecym_23968.677ON4153941421e-08
Suva_16.1568.677ON4063481402e-08
SAKL0H06512g8.677ON4043491341e-07
ZYRO0F07392g8.677ON4183621285e-07
Kpol_1072.158.677ON3993501276e-07
ACR143WsingletonON3933511179e-06
KAFR0H024208.677ON4163691171e-05
NDAI0B017207.182ON5471241152e-05
SAKL0F07172g7.182ON5421951109e-05
TPHA0C008408.318ON10004071045e-04
AGR407CsingletonON2681841016e-04
Skud_12.1938.319ON4973601000.001
YIR039C (YPS6)singletonON5372911000.001
KNAG0G024108.318ON530195990.002
Smik_65.1singletonON342295970.002
CAGL0E01837gsingletonON521127940.006
ZYRO0E02266gsingletonON506184940.007
TDEL0A062308.677ON408352940.007
AGL192W8.318ON499383930.009
Suva_16.14singletonON540301930.010
YLR121C (YPS3)8.319ON508360920.013
Smik_5.7singletonON304115900.017
YIL015W (BAR1)7.182ON587311910.019
Suva_9.186singletonOFF54346900.025
Suva_9.1877.182ON33346890.026
Suva_9.13singletonON464299890.028
ZYRO0F10252gsingletonON551122890.028
Ecym_42518.318ON502185880.036
Skud_9.1547.182ON51646880.039
Smik_12.1878.319ON507359850.091
NCAS0A124607.182ON540122840.12
Suva_34.1singletonON387299830.12
ZYRO0F10274gsingletonON572221830.14
Smik_9.1757.182ON59343830.18
ZYRO0D15554g7.182ON521203800.40
Suva_79.1singletonON227124770.50
CAGL0E01727gsingletonON539132770.82
KNAG0I009108.318ON569133770.87
TBLA0D045807.182ON395183751.5
KAFR0B057108.318ON575198741.8
NCAS0B035608.318ON586232732.2
KNAG0B028607.301ON22698722.3
ZYRO0F10318g8.319ON486118732.4
KLLA0D15917g7.182ON511186732.6
TDEL0E022305.401ON573233732.7
KLTH0H05632g6.158ON448155722.7
Kwal_47.178942.159ON621129713.9
CAGL0E01749gsingletonON48245714.0
YGL082W6.195ON38148714.2
Kwal_23.51108.83ON1176119705.9
NDAI0J010308.318ON652306706.6
KAFR0D049905.419ON56256697.0
AGR240W7.182ON45232688.3
Suva_10.2128.319ON745359698.8
ZYRO0D01848g7.503ON65448689.0
Kwal_14.16156.158ON450155689.8
Kwal_26.76652.448ON55171689.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D01507g
         (515 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D01507g Chr4 (133636..135183) [1548 bp, 515 aa] {ON} weakly...   914   0.0  
SAKL0D01408g Chr4 (112123..113643) [1521 bp, 506 aa] {ON} weakly...   457   e-156
Ecym_4614 Chr4 complement(1197114..1198559) [1446 bp, 481 aa] {O...   335   e-109
ABL123C Chr2 complement(164739..166223) [1485 bp, 494 aa] {ON} N...   269   1e-83
ACR144W Chr3 (603306..604532) [1227 bp, 408 aa] {ON} Syntenic ho...    68   1e-11
TBLA0B03830 Chr2 complement(880233..881474) [1242 bp, 413 aa] {O...    68   2e-11
NCAS0C01360 Chr3 complement(249141..250361) [1221 bp, 406 aa] {O...    67   3e-11
TPHA0D01260 Chr4 (262523..263782) [1260 bp, 419 aa] {ON} Anc_8.6...    67   4e-11
NDAI0E02105 Chr5 complement(429293..430519) [1227 bp, 408 aa] {ON}     66   5e-11
KLLA0D05929g Chr4 (507555..508784) [1230 bp, 409 aa] {ON} highly...    66   5e-11
KNAG0J01710 Chr10 (312872..314119) [1248 bp, 415 aa] {ON} Anc_8....    65   2e-10
Kpol_1013.6 s1013 (10059..11267) [1209 bp, 402 aa] {ON} (10059.....    64   3e-10
Smik_6.351 Chr6 (563275..564492) [1218 bp, 405 aa] {ON} YPL154C ...    62   2e-09
KLTH0D11264g Chr4 (920981..922234) [1254 bp, 417 aa] {ON} highly...    62   2e-09
Kwal_26.8802 s26 (949063..950301) [1239 bp, 412 aa] {ON} YPL154C...    61   3e-09
CAGL0M02211g Chr13 complement(264202..265449) [1248 bp, 415 aa] ...    61   3e-09
YPL154C Chr16 complement(259714..260931) [1218 bp, 405 aa] {ON} ...    60   7e-09
Skud_16.128 Chr16 complement(231348..232565) [1218 bp, 405 aa] {...    60   7e-09
Ecym_2396 Chr2 complement(769479..770726) [1248 bp, 415 aa] {ON}...    59   1e-08
Suva_16.156 Chr16 complement(268862..270082) [1221 bp, 406 aa] {...    59   2e-08
SAKL0H06512g Chr8 complement(573927..575141) [1215 bp, 404 aa] {...    56   1e-07
ZYRO0F07392g Chr6 (598584..599840) [1257 bp, 418 aa] {ON} highly...    54   5e-07
Kpol_1072.15 s1072 complement(35798..36997) [1200 bp, 399 aa] {O...    54   6e-07
ACR143W Chr3 (601369..602550) [1182 bp, 393 aa] {ON} Syntenic ho...    50   9e-06
KAFR0H02420 Chr8 complement(462759..464009) [1251 bp, 416 aa] {O...    50   1e-05
NDAI0B01720 Chr2 complement(409125..410768) [1644 bp, 547 aa] {O...    49   2e-05
SAKL0F07172g Chr6 complement(541680..543308) [1629 bp, 542 aa] {...    47   9e-05
TPHA0C00840 Chr3 (173318..176320) [3003 bp, 1000 aa] {ON} Anc_8....    45   5e-04
AGR407C Chr7 complement(1475317..1476123) [807 bp, 268 aa] {ON} ...    44   6e-04
Skud_12.193 Chr12 complement(371627..373120) [1494 bp, 497 aa] {...    43   0.001
YIR039C Chr9 complement(430498..432111) [1614 bp, 537 aa] {ON}  ...    43   0.001
KNAG0G02410 Chr7 complement(550827..552419) [1593 bp, 530 aa] {O...    43   0.002
Smik_65.1 Chr65 (2..1027) [1026 bp, 342 aa] {ON} YIR039C (REAL)        42   0.002
CAGL0E01837g Chr5 complement(183237..184802) [1566 bp, 521 aa] {...    41   0.006
ZYRO0E02266g Chr5 complement(169081..170601) [1521 bp, 506 aa] {...    41   0.007
TDEL0A06230 Chr1 (1091257..1092483) [1227 bp, 408 aa] {ON} Anc_8...    41   0.007
AGL192W Chr7 (337445..338944) [1500 bp, 499 aa] {ON} Syntenic ho...    40   0.009
Suva_16.14 Chr16 (11240..12862) [1623 bp, 540 aa] {ON} YIR039C (...    40   0.010
YLR121C Chr12 complement(388744..390270) [1527 bp, 508 aa] {ON} ...    40   0.013
Smik_5.7 Chr5 (4489..5403) [915 bp, 304 aa] {ON} YIR039C (REAL)        39   0.017
YIL015W Chr9 (322342..324105) [1764 bp, 587 aa] {ON}  BAR1Aspart...    40   0.019
Suva_9.186 Chr9 (310161..310220,310267..310332,310362..310451,31...    39   0.025
Suva_9.187 Chr9 (310921..311922) [1002 bp, 333 aa] {ON} YIL015W ...    39   0.026
Suva_9.13 Chr9 (14409..15803) [1395 bp, 464 aa] {ON} YIR039C (REAL)    39   0.028
ZYRO0F10252g Chr6 complement(828774..830429) [1656 bp, 551 aa] {...    39   0.028
Ecym_4251 Chr4 complement(520455..521963) [1509 bp, 502 aa] {ON}...    39   0.036
Skud_9.154 Chr9 (291885..293435) [1551 bp, 516 aa] {ON} YIL015W ...    39   0.039
Smik_12.187 Chr12 complement(370001..371524) [1524 bp, 507 aa] {...    37   0.091
NCAS0A12460 Chr1 complement(2461028..2462650) [1623 bp, 540 aa] ...    37   0.12 
Suva_34.1 Chr34 complement(13..1176) [1164 bp, 387 aa] {ON} YIR0...    37   0.12 
ZYRO0F10274g Chr6 complement(831057..832775) [1719 bp, 572 aa] {...    37   0.14 
Smik_9.175 Chr9 (296875..298656) [1782 bp, 593 aa] {ON} YIL015W ...    37   0.18 
ZYRO0D15554g Chr4 complement(1298587..1300152) [1566 bp, 521 aa]...    35   0.40 
Suva_79.1 Chr79 complement(1..681) [681 bp, 227 aa] {ON} YIR039C...    34   0.50 
CAGL0E01727g Chr5 (171119..172738) [1620 bp, 539 aa] {ON} simila...    34   0.82 
KNAG0I00910 Chr9 (171104..172813) [1710 bp, 569 aa] {ON}               34   0.87 
TBLA0D04580 Chr4 complement(1133223..1134410) [1188 bp, 395 aa] ...    33   1.5  
KAFR0B05710 Chr2 complement(1177594..1179321) [1728 bp, 575 aa] ...    33   1.8  
NCAS0B03560 Chr2 complement(629374..631134) [1761 bp, 586 aa] {O...    33   2.2  
KNAG0B02860 Chr2 (552295..552975) [681 bp, 226 aa] {ON} Anc_7.30...    32   2.3  
ZYRO0F10318g Chr6 complement(835672..837132) [1461 bp, 486 aa] {...    33   2.4  
KLLA0D15917g Chr4 complement(1336727..1338262) [1536 bp, 511 aa]...    33   2.6  
TDEL0E02230 Chr5 (427831..429552) [1722 bp, 573 aa] {ON} Anc_5.4...    33   2.7  
KLTH0H05632g Chr8 (499881..501227) [1347 bp, 448 aa] {ON} simila...    32   2.7  
Kwal_47.17894 s47 (597826..599691) [1866 bp, 621 aa] {ON} YHR114...    32   3.9  
CAGL0E01749g Chr5 complement(172875..174323) [1449 bp, 482 aa] {...    32   4.0  
YGL082W Chr7 (355827..356972) [1146 bp, 381 aa] {ON} Putative pr...    32   4.2  
Kwal_23.5110 s23 (1016158..1019688) [3531 bp, 1176 aa] {ON} YPL0...    32   5.9  
NDAI0J01030 Chr10 (235967..237925) [1959 bp, 652 aa] {ON}              32   6.6  
KAFR0D04990 Chr4 (981180..982868) [1689 bp, 562 aa] {ON} Anc_5.4...    31   7.0  
AGR240W Chr7 (1200736..1202094) [1359 bp, 452 aa] {ON} Syntenic ...    31   8.3  
Suva_10.212 Chr10 complement(396611..398848) [2238 bp, 745 aa] {...    31   8.8  
ZYRO0D01848g Chr4 complement(148657..150621) [1965 bp, 654 aa] {...    31   9.0  
Kwal_14.1615 s14 (391651..393003) [1353 bp, 450 aa] {ON} YBR243C...    31   9.8  
Kwal_26.7665 s26 complement(463924..465579) [1656 bp, 551 aa] {O...    31   9.9  

>KLLA0D01507g Chr4 (133636..135183) [1548 bp, 515 aa] {ON} weakly
           similar to uniprot|Q12303 Saccharomyces cerevisiae
           YLR121C YPS3 Aspartic protease
          Length = 515

 Score =  914 bits (2363), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/515 (89%), Positives = 462/515 (89%)

Query: 1   MFFKNGIRSGVFRLIILITYIFNLTFVQAFYPCSGERYLSAGSAFKVESKNSKYAAQFVN 60
           MFFKNGIRSGVFRLIILITYIFNLTFVQAFYPCSGERYLSAGSAFKVESKNSKYAAQFVN
Sbjct: 1   MFFKNGIRSGVFRLIILITYIFNLTFVQAFYPCSGERYLSAGSAFKVESKNSKYAAQFVN 60

Query: 61  INDALSKQALQGQATAKSSTKNVEVPVKPGMSILSTDSNTQAYFVNVTIGDEIYPLVVDS 120
           INDALSKQALQGQATAKSSTKNVEVPVKPGMSILSTDSNTQAYFVNVTIGDEIYPLVVDS
Sbjct: 61  INDALSKQALQGQATAKSSTKNVEVPVKPGMSILSTDSNTQAYFVNVTIGDEIYPLVVDS 120

Query: 121 GSAYLWVYGXXXXXXXXXXXXLFSTDNVKRAADESTFSLIYSSGTASGDVYEDRIIVNKL 180
           GSAYLWVYG            LFSTDNVKRAADESTFSLIYSSGTASGDVYEDRIIVNKL
Sbjct: 121 GSAYLWVYGSSCTSKSCTSNKLFSTDNVKRAADESTFSLIYSSGTASGDVYEDRIIVNKL 180

Query: 181 ATTQNFTFGVANEVPDIFENYPVSGIFGLPXXXXXXXXXXXXVLSESNAISMEKFSLIIG 240
           ATTQNFTFGVANEVPDIFENYPVSGIFGLP            VLSESNAISMEKFSLIIG
Sbjct: 181 ATTQNFTFGVANEVPDIFENYPVSGIFGLPSNNSDNIESIISVLSESNAISMEKFSLIIG 240

Query: 241 ALNSKDNTTSEDSALQAPLTENKGLFIIGDLVEDLYTGDIHYASLITNENHYWQLKIDSV 300
           ALNSKDNTTSEDSALQAPLTENKGLFIIGDLVEDLYTGDIHYASLITNENHYWQLKIDSV
Sbjct: 241 ALNSKDNTTSEDSALQAPLTENKGLFIIGDLVEDLYTGDIHYASLITNENHYWQLKIDSV 300

Query: 301 YVNSQAVNFSTSEAVTGSQSSYIRSGIVDSGTTLLILPTQDALDLHTFFVNSVSDGTNFA 360
           YVNSQAVNFSTSEAVTGSQSSYIRSGIVDSGTTLLILPTQDALDLHTFFVNSVSDGTNFA
Sbjct: 301 YVNSQAVNFSTSEAVTGSQSSYIRSGIVDSGTTLLILPTQDALDLHTFFVNSVSDGTNFA 360

Query: 361 IPCNSTEILSLEINGVKWPISSEEYLGEAYPQDSYYYGYCVSNIQGLELDESWILGAVFL 420
           IPCNSTEILSLEINGVKWPISSEEYLGEAYPQDSYYYGYCVSNIQGLELDESWILGAVFL
Sbjct: 361 IPCNSTEILSLEINGVKWPISSEEYLGEAYPQDSYYYGYCVSNIQGLELDESWILGAVFL 420

Query: 421 KDKYAVFDVQNQQFGLANKNENAILVPYVNSATNSSDTISGDRSSTTIXXXXXXXXXXXX 480
           KDKYAVFDVQNQQFGLANKNENAILVPYVNSATNSSDTISGDRSSTTI            
Sbjct: 421 KDKYAVFDVQNQQFGLANKNENAILVPYVNSATNSSDTISGDRSSTTISASNLPATSTAA 480

Query: 481 XXXXXXXXXXXXXXXXXIKPQSFMSWVATLILLAF 515
                            IKPQSFMSWVATLILLAF
Sbjct: 481 SSSTSKSGSTSFGLGSTIKPQSFMSWVATLILLAF 515

>SAKL0D01408g Chr4 (112123..113643) [1521 bp, 506 aa] {ON} weakly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A),
           required for the posttranslational precursor maturation
           of vacuolar proteinases; synthesized as a zymogen,
           self-activates
          Length = 506

 Score =  457 bits (1175), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 243/462 (52%), Positives = 318/462 (68%), Gaps = 12/462 (2%)

Query: 14  LIILITYIFNLTFVQAFYPCSGERYLSAGSAFKVESKNSKY--AAQFVNI-NDALSKQAL 70
           L+I +  +F  +    F+P S +R+L   S ++V + N ++  A    N    + + Q  
Sbjct: 6   LVIFLGVLFP-SLALGFFPTSRDRFLQDNSCYEVNALNKQHEEATSLGNFAGSSYTPQHY 64

Query: 71  QGQATAKSSTKN-VEVPVKPGMSILSTDSNTQAYFVNVTIGDEIYPLVVDSGSAYLWVYG 129
           +  A + SS +   ++ VKPG+SIL +D ++QAYFV+VTIGD  YPL++D+GSAYLWVYG
Sbjct: 65  KDTAVSNSSNETFAKIQVKPGISILQSDEHSQAYFVDVTIGDVAYPLIIDTGSAYLWVYG 124

Query: 130 XXXXXXXXXXXXLFSTDNVKRAADESTFSLIYSSGTASGDVYEDRIIVNKLATTQNFTFG 189
                       LF T NV +  D ++FSL Y+SG A GDVY DRIIVN+LATT NFTFG
Sbjct: 125 DSCNSSSCKGRKLFPTTNVLQ--DVASFSLAYTSGVAVGDVYHDRIIVNELATTDNFTFG 182

Query: 190 VANEVPDIFENYPVSGIFGLPXXXXXXXXXXXXVLSESNAISMEKFSLIIGALNSKDNTT 249
           VA+EVPDIFENYP SGIFGLP             L  SNAISMEKFS++IG +N+ + + 
Sbjct: 183 VASEVPDIFENYPASGIFGLPSDNSQSIENIISKLRSSNAISMEKFSILIGHINA-EVSE 241

Query: 250 SEDSALQAPLTENKGLFIIGDLVEDLYTGDIHYASLITNENHYWQLKIDSVYVNSQAVNF 309
            ED  +Q  LT NKG+F IGD +E LY G+I+Y SLI ++N YW LKI+++YVN   VNF
Sbjct: 242 EEDGDVQ-DLTSNKGIFAIGDELEGLYKGEIYYNSLIPDKNSYWSLKINNLYVNDYKVNF 300

Query: 310 STSEAVTGSQSSYIRSGIVDSGTTLLILPTQDALDLHTFFVNSVSDGTNFAIPCNSTEIL 369
           +  E  TGS+S   RS I+DSGTTLLILP QDALD+HT+F NS++DGTNFAI CNST+ L
Sbjct: 301 TNYENFTGSKSHNTRSSIIDSGTTLLILPKQDALDIHTYFGNSITDGTNFAIMCNSTQTL 360

Query: 370 SLEINGVKWPISSEEYLGEAYPQDSYYYGYCVSNIQGLELDESWILGAVFLKDKYAVFDV 429
           +LE +   W I SE+YLG+ Y QDS YYGYCVSNIQGL++D++WILG VFL+  YAVFDV
Sbjct: 361 TLEFDNKNWTIPSEKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDV 420

Query: 430 QNQQFGLANKNENAILVPY---VNSATNSSDTISGDRSSTTI 468
           +NQ+ G A  NENA+LVPY    N+ T+S++  S   S +T+
Sbjct: 421 ENQRLGFAEGNENALLVPYSKETNATTSSTNNTSEPSSQSTV 462

>Ecym_4614 Chr4 complement(1197114..1198559) [1446 bp, 481 aa] {ON}
           similar to Ashbya gossypii ABL123C
          Length = 481

 Score =  335 bits (858), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 187/448 (41%), Positives = 256/448 (57%), Gaps = 17/448 (3%)

Query: 14  LIILITYIFNLTFVQAFYPCSGERYLSAGSAFKVESKNSKYAAQ---FVNINDALSKQAL 70
             IL   I  L    AF+P S  R+L  G   KV + +  +  +    V +    S    
Sbjct: 2   FFILTAVILFLRLSLAFFPSSERRFLHNGKVGKVATADFWFPNEQVPSVRVGREFSFGDD 61

Query: 71  QGQATAKSSTKNVE---VPVKPGMSILSTDSNTQAYFVNVTIGDEIYPLVVDSGSAYLWV 127
              A  +++   ++   V + P ++IL+ DSN+ AY VNVTI DE Y L++D+GSA+ WV
Sbjct: 62  SADAVKQAADDVLDPTYVHLSPAITILTRDSNSHAYIVNVTISDEEYSLILDTGSAFPWV 121

Query: 128 YGXXXXXXXXXXXXLFSTDNVKRAADESTFSLIYSSGTASGDVYEDRIIVNKLATTQNFT 187
           YG            L+ T   K+  + STF L Y  G  SG +++D  I+N L T++ F 
Sbjct: 122 YGDSCSLRACEGRKLYPTGG-KQTVNGSTFRLDYPYGITSGAIFQDSFIINNLNTSETFA 180

Query: 188 FGVANEVPDIFENYPVSGIFGLPXXXXXXXXXXXXVLSESNAISMEKFSLIIGALNSKDN 247
           FGVA  VP +FENYPVSGI GLP            VL  S +I  +KF+L +      D+
Sbjct: 181 FGVATSVPQMFENYPVSGILGLPANSPGTVEPALSVLYRSKSIRSQKFTLYL------DH 234

Query: 248 TTSEDSALQAPLTENKGLFIIGDLVEDLYTGDIHYASLITNENHYWQLKIDSVYVNSQAV 307
             SE++ L A    N GLF IG+ + +LY GDI+Y+ L+ N N+YW + ID ++ NS  V
Sbjct: 235 IESENTTLNA----NSGLFAIGEPITELYKGDIYYSELVVNPNNYWLIAIDRIFCNSTLV 290

Query: 308 NFSTSEAVTGSQSSYIRSGIVDSGTTLLILPTQDALDLHTFFVNSVSDGTNFAIPCNSTE 367
            F   E  TG+QS   RSGI+DSG+T L+LP  DALD+H++   S++DG  FA+ CNST 
Sbjct: 291 TFQNPENFTGAQSRSKRSGIIDSGSTFLVLPKVDALDIHSYLPGSITDGNYFAVFCNSTV 350

Query: 368 ILSLEINGVKWPISSEEYLGEAYPQDSYYYGYCVSNIQGLELDESWILGAVFLKDKYAVF 427
            L+ E+    W I +  YLGE Y + S YYGYCVSNI+G  +  SWILG VF+K+ Y VF
Sbjct: 351 DLTFELGNKNWTIPASSYLGEPYQEGSKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVF 410

Query: 428 DVQNQQFGLANKNENAILVPYVNSATNS 455
           D+ NQQ G A KN N  LV   N +TN+
Sbjct: 411 DMDNQQVGFALKNSNVNLVQNSNISTNT 438

>ABL123C Chr2 complement(164739..166223) [1485 bp, 494 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPL154C
          Length = 494

 Score =  269 bits (687), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 146/383 (38%), Positives = 218/383 (56%), Gaps = 13/383 (3%)

Query: 65  LSKQALQGQATAKSSTKNVEVPVKPGMSILSTDSNTQAYFVNVTIGDEIYPLVVDSGSAY 124
           L K    G  T KS+  N  +  +P +S+L  D  ++ + +  T G   YPLV+D+GSA 
Sbjct: 60  LLKYNRSGAETKKSAQCN-SLTFRPNISLLKRDPLSRVHIIQATFGGVSYPLVLDTGSAI 118

Query: 125 LWVYGXXXXXXX-XXXXXLFSTDNVKRAADESTFSLIYSSGTASGDVYEDRIIVNKLATT 183
            WVYG              F   +      +S F++ Y SGTA G +Y   + +N L   
Sbjct: 119 SWVYGVNSSSSANHKARQAFVAHSNSCTVTDSIFTIFYRSGTAHGPLYTGTLSINGLKI- 177

Query: 184 QNFTFGVANEVPDIFENYPVSGIFGLPXXXXXXXXXXXXVLSESNAISMEKFSLIIGALN 243
           Q+F FGVA  VP + + Y +SGIFGLP            +L  S  I+ + FS+++  + 
Sbjct: 178 QDFRFGVAIGVPSLLDAYALSGIFGLPSDPTDSDTSVVGLLQGSKLINKKSFSVLLSHIP 237

Query: 244 SKDNTTSEDSALQAPLTENKGLFIIGDLVEDLYTGDIHYASLITNENHYWQLKIDSVYVN 303
           S+             L +N GL + G+ +  LY G++ Y  L+ N  ++W + I + Y+ 
Sbjct: 238 SESRN----------LDDNNGLIVFGEPLGALYEGELSYTPLVPNPQNHWLVAIKAAYIG 287

Query: 304 SQAVNFSTSEAVTGSQSSYIRSGIVDSGTTLLILPTQDALDLHTFFVNSVSDGTNFAIPC 363
           S+ V   T++  +  ++  IRSGI+D+G+TL++LP +DAL LH++F +S+SDG NFAI C
Sbjct: 288 SERVELPTAKNPSIDKNIGIRSGIIDTGSTLVVLPQEDALALHSYFDDSISDGKNFAIYC 347

Query: 364 NSTEILSLEINGVKWPISSEEYLGEAYPQDSYYYGYCVSNIQGLELDESWILGAVFLKDK 423
           NS+E + LE++   W I    ++GE YP+DS Y GYCVSNIQG ++  SWILG VFL+D 
Sbjct: 348 NSSEPIHLELSKHNWTILPSNFVGEPYPKDSPYNGYCVSNIQGGDISSSWILGEVFLQDL 407

Query: 424 YAVFDVQNQQFGLANKNENAILV 446
           Y VFD++ +Q G AN+N  A LV
Sbjct: 408 YTVFDIEGRQVGFANRNTKATLV 430

>ACR144W Chr3 (603306..604532) [1227 bp, 408 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL154C (PEP4);
           Tandem gene duplication in this genome
          Length = 408

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 86/351 (24%), Positives = 138/351 (39%), Gaps = 54/351 (15%)

Query: 103 YFVNVTIG--DEIYPLVVDSGSAYLWVYGXXXXXXXXXXXXLFSTDNVKRAADESTFS-L 159
           Y  +VTIG   + + +VVD+GS+ LWV G             +  D      +  T + +
Sbjct: 93  YAADVTIGTPPQDFRVVVDTGSSTLWVPGKECRAMACRLHKRYDHDRSSTYKENGTLTGV 152

Query: 160 IYSSGTASGDVYEDRIIVNKLATT-QNFTFGVANEVPDIFENYPVSGIFGLPXXXXXXXX 218
            Y SG+  G V ED   ++ L    Q FT    +E   +F      GI GL         
Sbjct: 153 TYGSGSIMGYVSEDTFRISDLEIPGQQFT-ETTDEPGSVFVFAAFDGILGLAYPSLGYGV 211

Query: 219 XXX-XVLSESNAISMEKFSLIIGALNSKDNTTSEDSALQAPLTENKGLFIIGDLVEDLYT 277
                 L E   +    F + +  + +                E  G  ++G   E  + 
Sbjct: 212 TPPFQQLMEKKLVKEPVFGMYLDDMKTG---------------EGNGQLVLGGYDETKFK 256

Query: 278 GDIHYASLITNENHYWQLKIDSVYVNSQAVNFSTSEAVTGSQSSYIRSGIVDSGTTLLIL 337
           G+I  A L      YW++  DSV V    +      A             +DSGT+L+  
Sbjct: 257 GEI--AWLPVRRQAYWEVVFDSVTVGDDNIPLENYGAA------------IDSGTSLITF 302

Query: 338 PTQDALDLHTFFVNSVSDGT-----NFAIPCNSTEI---LSLEINGVKWPISSEEYLGEA 389
           P++    L   F++ +S  T     N  + C + +    L+    G K+ IS E+Y+   
Sbjct: 303 PSE----LFNQFISKLSGVTKDRQGNVYVDCANKQTAPPLTFGFGGHKFSISGEDYIISV 358

Query: 390 YPQDSYYYGYCVSNIQGLELDESW---ILGAVFLKDKYAVFDVQNQQFGLA 437
             Q +     C+  I  L++D +    I+G VFL+  Y+++D  N   GLA
Sbjct: 359 PGQSA----RCMPAIVQLDIDSAGKVAIIGDVFLRRYYSIYDFGNNAVGLA 405

>TBLA0B03830 Chr2 complement(880233..881474) [1242 bp, 413 aa] {ON}
           Anc_8.677 YPL154C
          Length = 413

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 86/357 (24%), Positives = 145/357 (40%), Gaps = 50/357 (14%)

Query: 94  LSTDSNTQAYFVNVTIG--DEIYPLVVDSGSAYLWVYGXXXXXXXXXXXXLFSTDNVKR- 150
           LS   N Q YF ++ IG   + + +V+D+GS+ LWV               ++ D     
Sbjct: 91  LSNYMNAQ-YFADIKIGTPPQSFKVVLDTGSSNLWVPSKECGSLACYLHSKYNHDESSTY 149

Query: 151 AADESTFSLIYSSGTASGDVYEDRIIVNKLATTQNFTFGVANEVPDI-FENYPVSGIFGL 209
            A+ S F++ Y SG+  G + +D + +  L  T+   F  A   P I F      GI GL
Sbjct: 150 KANGSAFAIQYGSGSLEGYISQDVMEIGDLKITKQ-DFAEATSEPGISFAFGKFDGILGL 208

Query: 210 PXXXXXXXXXXXXVLSESNA--ISMEKFSLIIGALNSKDNTTSEDSALQAPLTENKGLFI 267
                        V +  N   +   KF+  +G     D + S+D         N G  +
Sbjct: 209 AYDTIAVNRVVPPVYNAINQGLLDEPKFAFYLG-----DASKSKD---------NGGEAV 254

Query: 268 IGDLVEDLYTGDIHYASLITNENHYWQLKIDSVYVNSQAVNFSTSEAVTGSQSSYIRSGI 327
            G + E  + GDI +  L      YW++K++ + +  +        A             
Sbjct: 255 FGGIDETKFEGDITW--LPVRRKAYWEVKLEGLGLGEEYTELENHGAA------------ 300

Query: 328 VDSGTTLLILPTQDALDLHTFFVNSVSDGTNFAIPCN---STEILSLEINGVKWPISSEE 384
           +D+GT+L+ LP+  A  +++           + I C+   S   ++   +G  + IS  +
Sbjct: 301 IDTGTSLITLPSGLAEIINSEIGAKKGWTGQYTIECDKRASLPDMTFTFDGYNFTISPYD 360

Query: 385 YLGEAYPQDSYYYGYCVSNIQGLELDES----WILGAVFLKDKYAVFDVQNQQFGLA 437
           Y  E         G C+S I  ++  E      I+G  FL+  Y+V+D+ N   GLA
Sbjct: 361 YTLEVS-------GSCISAITPMDFPEPVGPMAIIGDAFLRKYYSVYDLGNDAVGLA 410

>NCAS0C01360 Chr3 complement(249141..250361) [1221 bp, 406 aa] {ON}
           Anc_8.677
          Length = 406

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 79/361 (21%), Positives = 145/361 (40%), Gaps = 49/361 (13%)

Query: 90  GMSILSTDSNTQAYFVNVTIG--DEIYPLVVDSGSAYLWVYGXXXXXXXXXXXXLFSTD- 146
           G ++  T+     YF ++++G   + + +++D+GS+ LWV               +  D 
Sbjct: 79  GHNVPLTNYLNAQYFADISVGTPPQNFKVILDTGSSNLWVPSSECNSLACFLHSKYDHDA 138

Query: 147 NVKRAADESTFSLIYSSGTASGDVYEDRIIVNKLATTQNFTFGVANEVPDI-FENYPVSG 205
           +    A+ + F++ Y SG+  G + +D + +  L   +   F  A   P + F      G
Sbjct: 139 SSSYKANGTKFAIQYGSGSLEGYISQDTLNIGDLTIPKQ-DFAEATSEPGLTFAFGKFDG 197

Query: 206 IFGLPXXXXXXXXXXXXVLS--ESNAISMEKFSLIIGALNSKDNTTSEDSALQAPLTENK 263
           I GL               +  E   +  +KF+  +G        T +D        +N 
Sbjct: 198 ILGLAYDTISVDKVVPPFYNAIEQGLLDEKKFAFYLG-------DTKKDE-------KNG 243

Query: 264 GLFIIGDLVEDLYTGDIHYASLITNENHYWQLKIDSVYVNSQAVNFSTSEAVTGSQSSYI 323
           G   IG + E  + GDI +  L      YW++K + + +  Q        A         
Sbjct: 244 GEITIGGIDESKFKGDIEW--LPVRRKAYWEVKFEGIALGDQYAALENHGAA-------- 293

Query: 324 RSGIVDSGTTLLILPTQDALDLHTFFVNSVSDGTNFAIPCNSTE---ILSLEINGVKWPI 380
               +D+GT+L+ LP+  A  ++T           + + C++ +    L+   NG  + I
Sbjct: 294 ----IDTGTSLITLPSGLAEIINTEIGAKKGWTGQYTLDCDTRDGLPDLTFNFNGKNFTI 349

Query: 381 SSEEYLGEAYPQDSYYYGYCVSNIQGLELDESW----ILGAVFLKDKYAVFDVQNQQFGL 436
           S  +Y  E         G C+S I  ++  E      I+G  FL+  Y+++D+ N   GL
Sbjct: 350 SPFDYTLEVS-------GSCISAIMPMDFPEPMGPMAIVGDAFLRKYYSIYDLDNHAVGL 402

Query: 437 A 437
           A
Sbjct: 403 A 403

>TPHA0D01260 Chr4 (262523..263782) [1260 bp, 419 aa] {ON} Anc_8.677
           YPL154C
          Length = 419

 Score = 66.6 bits (161), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 76/348 (21%), Positives = 137/348 (39%), Gaps = 48/348 (13%)

Query: 103 YFVNVTIG--DEIYPLVVDSGSAYLWVYGXXXXXXXXXXXXLFSTDNVKRAADEST-FSL 159
           Y+ ++++G   + + +++D+GS+ LWV               +  D         T F++
Sbjct: 104 YYTDISLGTPKQNFKVILDTGSSNLWVPSKDCTSLACYLHSKYDHDESTTYEKNGTKFTI 163

Query: 160 IYSSGTASGDVYEDRIIVNKLATTQNFTFGVANEVPDI-FENYPVSGIFGLPXXXXXXXX 218
            Y SG+  G +  D +I+          F  A   P + F      GI GL         
Sbjct: 164 QYGSGSMDGYISRDTLIIGDDLVIPEQDFAEATSEPGLAFAFGKFDGILGLAYDTIAVNK 223

Query: 219 XXXXVLS--ESNAISMEKFSLIIGALNSKDNTTSEDSALQAPLTENKGLFIIGDLVEDLY 276
                 +  +   +   KF+  +G  N KDN +  ++               G   +  +
Sbjct: 224 VVPPFYNAIKQGILDENKFAFYLGDTN-KDNKSGGEATF-------------GGYDKSKF 269

Query: 277 TGDIHYASLITNENHYWQLKIDSVYVNSQAVNFSTSEAVTGSQSSYIRSGIVDSGTTLLI 336
           TGDI +  L      YW++K DS+ +  +  +     A             +D+GT+L+ 
Sbjct: 270 TGDITW--LPVRRKAYWEVKFDSIALGDEVASLDGYGAA------------IDTGTSLIT 315

Query: 337 LPTQDALDLHTFFVNSVSDGTNFAIPCNSTEIL---SLEINGVKWPISSEEYLGEAYPQD 393
           LP+  A  ++T      S    + I C++ + L   +   NG  + +S  +Y  E     
Sbjct: 316 LPSGLAEVINTQIGAKKSWSGQYTIDCDTRDALPDMTFNFNGYNFTVSPYDYTLEMS--- 372

Query: 394 SYYYGYCVSNIQGLELDES----WILGAVFLKDKYAVFDVQNQQFGLA 437
               G C+S I  ++  E      I+G  FL+  Y+++D+ N   GLA
Sbjct: 373 ----GSCISAITPMDFPEPVGPLAIIGDAFLRKYYSIYDLDNNAVGLA 416

>NDAI0E02105 Chr5 complement(429293..430519) [1227 bp, 408 aa] {ON}
          Length = 408

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 79/357 (22%), Positives = 140/357 (39%), Gaps = 50/357 (14%)

Query: 94  LSTDSNTQAYFVNVTIG--DEIYPLVVDSGSAYLWVYGXXXXXXXXXXXXLFSTDNVKRA 151
           LS   N Q YF ++T+G   + + +++D+GS+ LWV               +  D     
Sbjct: 86  LSNYLNAQ-YFADITLGTPPQSFKVILDTGSSNLWVPSVECGSLACYLHSKYDHDKSSSY 144

Query: 152 ADEST-FSLIYSSGTASGDVYEDRIIVNKLATTQNFTFGVANEVPDI-FENYPVSGIFGL 209
               T F++ Y +G+  G + +D + +  L   +   F  A   P + F      GI GL
Sbjct: 145 KPNGTDFAIRYGTGSLEGYISQDTLNIGDLNIPKQ-DFAEATSEPGLTFAFGKFDGILGL 203

Query: 210 PXXXXXXXXXXXXVLS--ESNAISMEKFSLIIGALNSKDNTTSEDSALQAPLTENKGLFI 267
                          +  E   +  +KF+  +G  N K              +E+ G   
Sbjct: 204 AYDSISVNKVVPPFYNAIEQELLDEKKFAFYLGDANKK--------------SEDGGEIT 249

Query: 268 IGDLVEDLYTGDIHYASLITNENHYWQLKIDSVYVNSQAVNFSTSEAVTGSQSSYIRSGI 327
           IG + +  + GDI +  L      YW++K + + +  Q        A             
Sbjct: 250 IGGIDKTKFKGDIDW--LPVRRKAYWEVKFEGIGLGDQFAELENHGAA------------ 295

Query: 328 VDSGTTLLILPTQDALDLHTFFVNSVSDGTNFAIPCNSTE---ILSLEINGVKWPISSEE 384
           +D+GT+L+ LP+  A  ++T           + + C++      L+   NG  + I   +
Sbjct: 296 IDTGTSLIALPSGLAEIINTEIGAKKGWTGQYTVECDARPNLPDLTFNFNGKNFTIGPYD 355

Query: 385 YLGEAYPQDSYYYGYCVSNIQGLELDES----WILGAVFLKDKYAVFDVQNQQFGLA 437
           Y  E         G C+S I  ++  E      I+G  FL+  Y+++D++N   GLA
Sbjct: 356 YTLEVS-------GSCISAIMPMDFPEPVGPMAIIGDAFLRKYYSIYDLENNAVGLA 405

>KLLA0D05929g Chr4 (507555..508784) [1230 bp, 409 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 409

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 88/373 (23%), Positives = 150/373 (40%), Gaps = 48/373 (12%)

Query: 79  STKNVEVPVKP--GMSILSTDSNTQAYFVNVTIGD--EIYPLVVDSGSAYLWVYGXXXXX 134
           S  NV+V V P    S+  T+     YF  +T+G   + + +++D+GS+ LWV       
Sbjct: 70  SKDNVDVFVAPEGSHSVPLTNYLNAQYFTEITLGSPPQSFKVILDTGSSNLWVPSAECGS 129

Query: 135 XXXXXXXLFSTD-NVKRAADESTFSLIYSSGTASGDVYEDRIIVNKLATTQNFTFGVANE 193
                   +  + +    A+ S F++ Y SG+  G V  D + +  L       F  A  
Sbjct: 130 LACFLHTKYDHEASSTYKANGSEFAIQYGSGSLEGYVSRDLLTIGDLVIPDQ-DFAEATS 188

Query: 194 VPDI-FENYPVSGIFGLPXXXXXXXXXXXXVLSESNAISMEKFSLIIGALNSKDNTTSED 252
            P + F      GI GL             V    NAI  +     + A    D+  SED
Sbjct: 189 EPGLAFAFGKFDGILGLAYDSISVNRIVPPVY---NAIKNKLLDDPVFAFYLGDSDKSED 245

Query: 253 SALQAPLTENKGLFIIGDLVEDLYTGDIHYASLITNENHYWQLKIDSVYVNSQAVNFSTS 312
                      G    G + E+ YTG+I +  L      YW++K + + +  +   ++T 
Sbjct: 246 G----------GEASFGGIDEEKYTGEITW--LPVRRKAYWEVKFEGIGLGEE---YATL 290

Query: 313 EAVTGSQSSYIRSGIVDSGTTLLILPTQDALDLHTFFVNSVSDGTNFAIPCNSTEIL--- 369
           E              +D+GT+L+ LP+  A  L+            +++ C S + L   
Sbjct: 291 EG---------HGAAIDTGTSLIALPSGLAEILNAEIGAKKGWSGQYSVDCESRDSLPDL 341

Query: 370 SLEINGVKWPISSEEYLGEAYPQDSYYYGYCVSNIQGLELDES----WILGAVFLKDKYA 425
           +L  NG  + I++ +Y  E         G C+S    ++  E      I+G  FL+  Y+
Sbjct: 342 TLNFNGYNFTITAYDYTLEVS-------GSCISAFTPMDFPEPVGPLAIIGDAFLRKYYS 394

Query: 426 VFDVQNQQFGLAN 438
           ++D+ +   GLA 
Sbjct: 395 IYDIGHDAVGLAK 407

>KNAG0J01710 Chr10 (312872..314119) [1248 bp, 415 aa] {ON} Anc_8.677
           YPL154C
          Length = 415

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 83/371 (22%), Positives = 151/371 (40%), Gaps = 57/371 (15%)

Query: 81  KNVEVPVKPGMSILSTDSNTQAYFVNVTIG--DEIYPLVVDSGSAYLWVYGXXXXXXXXX 138
           K  EVP       LS   N Q Y+ ++T+G   + + +++D+GS+ LWV           
Sbjct: 87  KGHEVP-------LSNYLNAQ-YYTDITLGTPPQQFKVILDTGSSNLWVPSSECGSLACF 138

Query: 139 XXXLF-STDNVKRAADESTFSLIYSSGTASGDVYEDRIIVNKLATTQNFTFGVANEVPDI 197
               +  + +    A+ + FS+ Y SG+  G + +D + +  L   +   F  A   P +
Sbjct: 139 LHEKYDHSASSSYKANGTDFSIQYGSGSLEGYISQDTLSIGDLTIPKQ-DFAEATSEPGL 197

Query: 198 -FENYPVSGIFGLPXXXXXXXXXXXXVLS--ESNAISMEKFSLIIGALNSKDNTTSEDSA 254
            F      GI GL               +  E + +   KF+  +G  N KD        
Sbjct: 198 AFAFGKFDGILGLAYDTISVDKVVPPFYNALEQDLLDEAKFAFYLGDTN-KD-------- 248

Query: 255 LQAPLTENKGLFIIGDLVEDLYTGDIHYASLITNENHYWQLKIDSVYVNSQAVNFSTSEA 314
                 E+ G  I G + +  YTGD+ +  L      YW++K++ + +  +     +  A
Sbjct: 249 -----AEDGGEAIFGGVDKSKYTGDVTW--LPVRRKAYWEVKLEGLGLGDEYAELESHGA 301

Query: 315 VTGSQSSYIRSGIVDSGTTLLILPTQDALDLHTFFVNSVSDGTNFAIPCNSTEIL---SL 371
                        +D+GT+L+ LP+  A  +++           + + CN+ + L   + 
Sbjct: 302 A------------IDTGTSLITLPSGLAEIINSEIGAKKGWTGQYTLECNTRDQLPDLTF 349

Query: 372 EINGVKWPISSEEYLGEAYPQDSYYYGYCVSNIQGLELDES----WILGAVFLKDKYAVF 427
             NG  + I   +Y  E         G C+S I  ++  E      I+G  FL+  Y+++
Sbjct: 350 NFNGYNFTIGPYDYTLEVS-------GSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIY 402

Query: 428 DVQNQQFGLAN 438
           D+++   GLA 
Sbjct: 403 DLEHNAVGLAK 413

>Kpol_1013.6 s1013 (10059..11267) [1209 bp, 402 aa] {ON}
           (10059..11267) [1209 nt, 403 aa]
          Length = 402

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 83/355 (23%), Positives = 145/355 (40%), Gaps = 47/355 (13%)

Query: 94  LSTDSNTQAYFVNVTIGD--EIYPLVVDSGSAYLWVYGXXXXXXXXXXXXLF-STDNVKR 150
           LS   N Q Y+ ++T+G   + + +++D+GS+ LWV               +  +D+   
Sbjct: 81  LSNYLNAQ-YYTDITLGTPAQSFKVILDTGSSNLWVPSVDCNSLACYLHAKYDHSDSSTY 139

Query: 151 AADESTFSLIYSSGTASGDVYEDRIIVNKLATTQNFTFGVANEVPDI-FENYPVSGIFGL 209
             + +TFS+ Y SG+  G + +D + +  L       F  A   P + F      GI GL
Sbjct: 140 KKNGTTFSIQYGSGSMEGYISQDVLQIGDLVIPGQ-DFAEATSEPGLAFAFGKFDGILGL 198

Query: 210 PXXXXXXXXXXXXVLSESNAISMEKFSLIIGALNSKDNTTSEDSALQAPLTENKGLFIIG 269
                        V    NAI+ +     I +    D+T SED           G    G
Sbjct: 199 ---AYDTIAVNRVVPPFYNAINKKLVDEPIFSFYLGDDTKSEDG----------GQVTFG 245

Query: 270 DLVEDLYTGDIHYASLITNENHYWQLKIDSVYVNSQAVNFSTSEAVTGSQSSYIRSGIVD 329
                L+TGDI +  L      YW++K D++ + ++  +     A             +D
Sbjct: 246 GYDSSLFTGDITW--LPVRRKAYWEVKFDAIALGNEVADLVNHGAA------------ID 291

Query: 330 SGTTLLILPTQDALDLHTFFVNSVSDGTNFAIPCNSTEIL---SLEINGVKWPISSEEYL 386
           +GT+L+ LP+  A  +++      S    + + C + + L   +   +G  + I+  +Y 
Sbjct: 292 TGTSLITLPSGLAEVINSQIGAKKSWSGQWIVDCKTRDTLPDMTFTFDGYNFTITPYDYT 351

Query: 387 GEAYPQDSYYYGYCVSNIQGLELDES----WILGAVFLKDKYAVFDVQNQQFGLA 437
            E         G C+S I  ++         I+G  FL+  Y+++DV N   GLA
Sbjct: 352 LEVS-------GSCISAITPMDFPAPVGPLAIVGDAFLRRYYSIYDVGNNAVGLA 399

>Smik_6.351 Chr6 (563275..564492) [1218 bp, 405 aa] {ON} YPL154C
           (REAL)
          Length = 405

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 74/349 (21%), Positives = 140/349 (40%), Gaps = 49/349 (14%)

Query: 103 YFVNVTIG--DEIYPLVVDSGSAYLWVYGXXXXXXXXXXXXLFSTD-NVKRAADESTFSL 159
           Y+ ++T+G   + + +++D+GS+ LWV               +  + +    A+ + F++
Sbjct: 91  YYTDITLGTPPQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI 150

Query: 160 IYSSGTASGDVYEDRIIVNKLATTQNFTFGVANEVPDI-FENYPVSGIFGLPXXXXXXXX 218
            Y +G+  G + +D + +  L   +   F  A   P + F      GI GL         
Sbjct: 151 QYGTGSLEGYISQDTLSIGDLTIPKQ-DFAEATSEPGLTFAFGKFDGILGLGYDTISVDK 209

Query: 219 XXXXVLS--ESNAISMEKFSLIIGALNSKDNTTSEDSALQAPLTENKGLFIIGDLVEDLY 276
                 +  + + +  +KF+  +G        TS+DS       EN G    G + E  +
Sbjct: 210 VVPPFYNAIQQDLLDEKKFAFYLG-------DTSKDS-------ENGGEATFGGIDESKF 255

Query: 277 TGDIHYASLITNENHYWQLKIDSVYVNSQAVNFSTSEAVTGSQSSYIRSGIVDSGTTLLI 336
            GDI +  L      YW++K + + +  +     +  A             +D+GT+L+ 
Sbjct: 256 KGDITW--LPVRRKAYWEVKFEGIGLGDEYAELESHGAA------------IDTGTSLIT 301

Query: 337 LPTQDALDLHTFFVNSVSDGTNFAIPCNSTEILS---LEINGVKWPISSEEYLGEAYPQD 393
           LP+  A  ++            + + CN+ + L       NG  + I   +Y  E     
Sbjct: 302 LPSGLAEMINAELGAKKGWTGQYTLDCNTRDSLPDLIFNFNGYNYTIGPYDYTLEVS--- 358

Query: 394 SYYYGYCVSNIQGLELDES----WILGAVFLKDKYAVFDVQNQQFGLAN 438
               G C+S I  ++  E      I+G  FL+  Y+++D+ N   GLA 
Sbjct: 359 ----GSCISAITPMDFPEPVGPLAIIGDAFLRKYYSIYDLGNNAVGLAK 403

>KLTH0D11264g Chr4 (920981..922234) [1254 bp, 417 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 417

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 91/411 (22%), Positives = 158/411 (38%), Gaps = 51/411 (12%)

Query: 42  GSAFKVESKNSKYAAQFVNINDALSKQALQGQATAKSSTKNVEVPVKPGMSI-LSTDSNT 100
           G    V + + KY +QF      +   +  G      + +   +    G  + LS   N 
Sbjct: 42  GVMMSVANLHQKYLSQFSKAYPEVDFASHAGSGIGLGAVEQDVLSAMGGHDVPLSNYLNA 101

Query: 101 QAYFVNVTIG--DEIYPLVVDSGSAYLWVYGXXXXXXXXXXXXLFSTD-NVKRAADESTF 157
           Q YF  +T+G   + + +++D+GS+ LWV               +S D +    A+ + F
Sbjct: 102 Q-YFTEITLGTPPQSFKVILDTGSSNLWVPSDECGSLACFLHSKYSHDASSSYKANGTNF 160

Query: 158 SLIYSSGTASGDVYEDRIIVNKLATTQNFTFGVANEVPDI-FENYPVSGIFGLPXXXXXX 216
           ++ Y SG+  G + +D + +  L T     F  A   P + F      GI GL       
Sbjct: 161 AIQYGSGSLEGYISQDTLSIGDL-TIPKQDFAEATSEPGLAFAFGKFDGILGLGYDTIAV 219

Query: 217 XXXXXXVLSESN--AISMEKFSLIIGALNSKDNTTSEDSALQAPLTENKGLFIIGDLVED 274
                 V    N   +   +F+     LN+ D++            E+ G    G +   
Sbjct: 220 DKVVPPVYKAINDGLLDEPRFAFY---LNNADDSE-----------ESTGEVTFGGIDSS 265

Query: 275 LYTGDIHYASLITNENHYWQLKIDSVYVNSQAVNFSTSEAVTGSQSSYIRSGIVDSGTTL 334
            Y G+I +  L      YW++K D + +  +      + A             +D+GT+L
Sbjct: 266 KYKGNITW--LPVRRKAYWEVKFDGIGLGDEYAELEGTGAA------------IDTGTSL 311

Query: 335 LILPTQDALDLHTFFVNSVSDGTNFAIPCNSTEIL---SLEINGVKWPISSEEYLGEAYP 391
           + LP+  A  L+            + + C S + L   +   NG  + IS+ +Y  E   
Sbjct: 312 IALPSGLAEVLNAEIGAKKGWSGQYTVDCESRDQLPDLTFTFNGKNFTISAYDYTLEVS- 370

Query: 392 QDSYYYGYCVSNIQGLELDES----WILGAVFLKDKYAVFDVQNQQFGLAN 438
                 G C+S    ++  E      I+G  FL+  Y+V+D+ N   GLA 
Sbjct: 371 ------GSCISAFTPMDFPEPVGPLAIIGDAFLRKFYSVYDLGNNAVGLAQ 415

>Kwal_26.8802 s26 (949063..950301) [1239 bp, 412 aa] {ON} YPL154C
           (PEP4) - vacuolar proteinase A [contig 68] FULL
          Length = 412

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 77/349 (22%), Positives = 139/349 (39%), Gaps = 49/349 (14%)

Query: 103 YFVNVTIG--DEIYPLVVDSGSAYLWVYGXXXXXXXXXXXXLFSTD-NVKRAADESTFSL 159
           YF  +++G   + + +++D+GS+ LWV               +S D +    A+ ++F++
Sbjct: 98  YFTEISLGTPPQSFKVILDTGSSNLWVPSDECGSLACFLHSKYSHDASSSYKANGTSFAI 157

Query: 160 IYSSGTASGDVYEDRIIVNKLATTQNFTFGVANEVPDI-FENYPVSGIFGLPXXXXXXXX 218
            Y SG+  G + +D + +  L T     F  A   P + F      GI GL         
Sbjct: 158 QYGSGSLEGYISQDTLSIGDL-TIPKQDFAEATSEPGLAFAFGKFDGILGLGYDTISVDK 216

Query: 219 XXXXVLSESN--AISMEKFSLIIGALNSKDNTTSEDSALQAPLTENKGLFIIGDLVEDLY 276
               V    N   +   +F+     LN+ D++            E+ G    G +    Y
Sbjct: 217 VVPPVYKAINDGLLDEPRFAFY---LNNADDSE-----------ESTGEVTFGGIDSSKY 262

Query: 277 TGDIHYASLITNENHYWQLKIDSVYVNSQAVNFSTSEAVTGSQSSYIRSGIVDSGTTLLI 336
            GDI +  L      YW++K D + +  +      + A             +D+GT+L+ 
Sbjct: 263 KGDITW--LPVRRKAYWEVKFDGIGLGDEYAELQGTGAA------------IDTGTSLIA 308

Query: 337 LPTQDALDLHTFFVNSVSDGTNFAIPCNSTEIL---SLEINGVKWPISSEEYLGEAYPQD 393
           LP+  A  L++           + + C S + L   +   NG  + I++ +Y  E     
Sbjct: 309 LPSGLAEVLNSEIGAKKGWTGQYTVDCESRDQLPDLTFTFNGKNFTITAYDYTLEVS--- 365

Query: 394 SYYYGYCVSNIQGLELDES----WILGAVFLKDKYAVFDVQNQQFGLAN 438
               G C+S    ++  E      I+G  FL+  Y+++D+ N   GLA 
Sbjct: 366 ----GSCISAFTPMDFPEPVGPLAIIGDAFLRKFYSIYDLGNNAVGLAQ 410

>CAGL0M02211g Chr13 complement(264202..265449) [1248 bp, 415 aa]
           {ON} similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154c PEP4 aspartyl protease Saccharopepsin precursor
          Length = 415

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 78/354 (22%), Positives = 143/354 (40%), Gaps = 42/354 (11%)

Query: 103 YFVNVTIG--DEIYPLVVDSGSAYLWVYGXXXXXXXXXXXXLF-STDNVKRAADESTFSL 159
           YF ++++G   + + +++D+GS+ LWV               +  + +     D    S+
Sbjct: 91  YFADISLGTPPQKFKVILDTGSSNLWVPSVDCGSLACFLHNKYDHSQSSTYIKDGRPLSI 150

Query: 160 IYSSGTASGDVYEDRIIVNKLATTQNFTFGVANEVPDI-FENYPVSGIFGLPXXXXXXXX 218
            Y SG+  G + ED + +  L T QN  FG     P + F      GI GL         
Sbjct: 151 SYGSGSIEGYISEDNLQIGDL-TIQNQKFGETTSEPGLAFAFGKFDGILGLAYDTIAQDD 209

Query: 219 XXXXVLS--ESNAISMEKFSLIIGALNSKDNTTSEDSALQAPLTENKGLFIIGDLVEDLY 276
                 S  + + +   KFS  + ++N        D A +     + G+F +G +    +
Sbjct: 210 ITPPFYSAIQQHLLDESKFSFYLKSVN--------DPAAEGGSASDGGVFTLGGVDSSKF 261

Query: 277 TGDIHYASLITNENHYWQLKIDSVYVNSQAVNFSTSEAVTGSQSSYIRSGIVDSGTTLLI 336
            GD+    L      YW++ ++++ +  Q+         TG   +      +D+GT+L+ 
Sbjct: 262 KGDL--IPLHVRRQAYWEVPLNAIKLGDQS---------TGKLEN--TGAAIDTGTSLIT 308

Query: 337 LPTQDALDLHTFFVNSVSDGTNFAIPCNSTEIL---SLEINGVKWPISSEEYLGEAYPQD 393
           LP+  A  ++            + + C++   L   +  ++G  + +S  EY  E     
Sbjct: 309 LPSDMAEIINAQIGAKKGWTGQYTLECSTRAKLPDLTFTLDGHDFVLSPFEYTLEVS--- 365

Query: 394 SYYYGYCVSNIQGLELDES----WILGAVFLKDKYAVFDVQNQQFGLANKNENA 443
               G C+S I  ++  E      ILG  FL+  Y+VFD+      LA    +A
Sbjct: 366 ----GSCISVITPMDFPEPIGRMAILGDAFLRRYYSVFDLDANVVSLAEAVHSA 415

>YPL154C Chr16 complement(259714..260931) [1218 bp, 405 aa] {ON}
           PEP4Vacuolar aspartyl protease (proteinase A), required
           for the posttranslational precursor maturation of
           vacuolar proteinases; important for protein turnover
           after oxidative damage; synthesized as a zymogen,
           self-activates
          Length = 405

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 73/349 (20%), Positives = 140/349 (40%), Gaps = 49/349 (14%)

Query: 103 YFVNVTIG--DEIYPLVVDSGSAYLWVYGXXXXXXXXXXXXLFSTD-NVKRAADESTFSL 159
           Y+ ++T+G   + + +++D+GS+ LWV               +  + +    A+ + F++
Sbjct: 91  YYTDITLGTPPQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI 150

Query: 160 IYSSGTASGDVYEDRIIVNKLATTQNFTFGVANEVPDI-FENYPVSGIFGLPXXXXXXXX 218
            Y +G+  G + +D + +  L   +   F  A   P + F      GI GL         
Sbjct: 151 QYGTGSLEGYISQDTLSIGDLTIPKQ-DFAEATSEPGLTFAFGKFDGILGLGYDTISVDK 209

Query: 219 XXXXVLS--ESNAISMEKFSLIIGALNSKDNTTSEDSALQAPLTENKGLFIIGDLVEDLY 276
                 +  + + +  ++F+  +G        TS+D       TEN G    G + E  +
Sbjct: 210 VVPPFYNAIQQDLLDEKRFAFYLG-------DTSKD-------TENGGEATFGGIDESKF 255

Query: 277 TGDIHYASLITNENHYWQLKIDSVYVNSQAVNFSTSEAVTGSQSSYIRSGIVDSGTTLLI 336
            GDI +  L      YW++K + + +  +     +  A             +D+GT+L+ 
Sbjct: 256 KGDITW--LPVRRKAYWEVKFEGIGLGDEYAELESHGAA------------IDTGTSLIT 301

Query: 337 LPTQDALDLHTFFVNSVSDGTNFAIPCNSTEILS---LEINGVKWPISSEEYLGEAYPQD 393
           LP+  A  ++            + + CN+ + L       NG  + I   +Y  E     
Sbjct: 302 LPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGPYDYTLEVS--- 358

Query: 394 SYYYGYCVSNIQGLELDES----WILGAVFLKDKYAVFDVQNQQFGLAN 438
               G C+S I  ++  E      I+G  FL+  Y+++D+ N   GLA 
Sbjct: 359 ----GSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVGLAK 403

>Skud_16.128 Chr16 complement(231348..232565) [1218 bp, 405 aa] {ON}
           YPL154C (REAL)
          Length = 405

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 74/349 (21%), Positives = 139/349 (39%), Gaps = 49/349 (14%)

Query: 103 YFVNVTIG--DEIYPLVVDSGSAYLWVYGXXXXXXXXXXXXLFSTD-NVKRAADESTFSL 159
           Y+ ++T+G   + + +++D+GS+ LWV               +  + +    A+ + F++
Sbjct: 91  YYTDITLGTPPQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI 150

Query: 160 IYSSGTASGDVYEDRIIVNKLATTQNFTFGVANEVPDI-FENYPVSGIFGLPXXXXXXXX 218
            Y +G+  G + +D + +  L   +   F  A   P + F      GI GL         
Sbjct: 151 QYGTGSLEGYISQDTLSIGDLTIPKQ-DFAEATSEPGLTFAFGKFDGILGLGYDTISVDK 209

Query: 219 XXXXVLS--ESNAISMEKFSLIIGALNSKDNTTSEDSALQAPLTENKGLFIIGDLVEDLY 276
                 +  + + +  +KF+  +G        TS+DS       EN G    G + E  +
Sbjct: 210 VVPPFYNAIQQDLLDEKKFAFYLG-------DTSKDS-------ENGGEATFGGIDESKF 255

Query: 277 TGDIHYASLITNENHYWQLKIDSVYVNSQAVNFSTSEAVTGSQSSYIRSGIVDSGTTLLI 336
            GDI +  L      YW++K + + +  +        A             +D+GT+L+ 
Sbjct: 256 KGDITW--LPVRRKAYWEVKFEGIGLGDEYAELEGHGAA------------IDTGTSLIT 301

Query: 337 LPTQDALDLHTFFVNSVSDGTNFAIPCNSTEILS---LEINGVKWPISSEEYLGEAYPQD 393
           LP+  A  ++            + + CN+ + L       NG  + I   +Y  E     
Sbjct: 302 LPSGLAEMINAELGAKKGWTGQYTLDCNTRDSLPDLIFNFNGYNFTIGPYDYTLEVS--- 358

Query: 394 SYYYGYCVSNIQGLELDES----WILGAVFLKDKYAVFDVQNQQFGLAN 438
               G C+S I  ++  E      I+G  FL+  Y+++D+ N   GLA 
Sbjct: 359 ----GSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNDAVGLAK 403

>Ecym_2396 Chr2 complement(769479..770726) [1248 bp, 415 aa] {ON}
           similar to Ashbya gossypii ACR144W ACR143W
          Length = 415

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 93/394 (23%), Positives = 154/394 (39%), Gaps = 58/394 (14%)

Query: 59  VNINDALSKQALQGQATAKSSTKNVEVPVKPGMSILSTDSNTQAYFVNVTIG--DEIYPL 116
           +NI D L K  L+G A  +     VE     G  I   +     Y+  + +G   + + +
Sbjct: 64  INITDILEK--LKGAANGE-----VERASSNGHPIALDNFVNNQYYSEIGLGTPPQSFKV 116

Query: 117 VVDSGSAYLWVYGXXXXXXXXXXXXLFSTDNVKR-AADESTFSLIYSSGTASGDVYEDRI 175
           V+D+GS+ LWV               F  D     A ++S FS+ Y  G+  G V  D +
Sbjct: 117 VMDTGSSNLWVPNKNCVSEACLNHARFDHDRSSSYAKNDSRFSVSYGKGSMEGFVSYDTL 176

Query: 176 IVNKLATTQNFTFGVANEVP-DIFENYPVSGIFGLPXXXXXXXXXXXXVLSESNAISMEK 234
            +  L T +N  F  A   P   F      GI GL             V     A+    
Sbjct: 177 KIGDL-TIKNQGFAEATVEPGSAFVYGQFDGILGL---AYDGLAVNHIVPPFYEAVHQGL 232

Query: 235 FSLIIGALNSKDNTTSEDSALQAPLTENKGLFIIGDLVEDLYTGDIHYASLITNENHYWQ 294
               + A    D    +  A         G  + G   E  +TG+I +  +I     YW+
Sbjct: 233 LDEPVFAFYLSDEKKGDSLA---------GEVVFGGYDETKFTGEISWLPVIRKA--YWE 281

Query: 295 LKIDSVYVNSQAVNFSTSEAVTGSQSSYIRSGIVDSGTTLLILPTQDALDLHTFFVNSVS 354
           ++++S+ + SQ                    G +D+GT+ +  P++    L+  FV+   
Sbjct: 282 VELNSITLGSQKFQLQN------------YGGALDTGTSFITFPSE----LYQEFVSKTG 325

Query: 355 -----DGTNFAIPCNSTEI--LSLEINGVKWPISSEEYLGEAYPQDSYYYGYCVSNIQGL 407
                D  +   PC+ +    L+ E+ G  + ISS +Y+ +    D+     C   I  L
Sbjct: 326 ATVDPDDGHIIAPCSGSGFPDLTFELAGRSFTISSSDYVVQW--DDTT----CAVAITPL 379

Query: 408 ELDESW---ILGAVFLKDKYAVFDVQNQQFGLAN 438
           +L  +    I+G VFL+  Y+++D+     GLA 
Sbjct: 380 DLGGAGKMVIIGDVFLRRWYSIYDLSKNAVGLAK 413

>Suva_16.156 Chr16 complement(268862..270082) [1221 bp, 406 aa] {ON}
           YPL154C (REAL)
          Length = 406

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 72/348 (20%), Positives = 139/348 (39%), Gaps = 49/348 (14%)

Query: 103 YFVNVTIGD--EIYPLVVDSGSAYLWVYGXXXXXXXXXXXXLFSTDNVKRAADEST-FSL 159
           Y+ ++++G+  + + +++D+GS+ LWV               +  +         T F++
Sbjct: 92  YYTDISLGNPPQNFKVILDTGSSNLWVPSTECGSLACFLHSKYDHEASSSYKPNGTEFAI 151

Query: 160 IYSSGTASGDVYEDRIIVNKLATTQNFTFGVANEVPDI-FENYPVSGIFGLPXXXXXXXX 218
            Y +G+  G + +D + +  L   +   F  A   P + F      GI GL         
Sbjct: 152 QYGTGSLEGYISQDTLSIGDLTIPKQ-DFAEATSEPGLTFAFGKFDGILGLGYDTISVDK 210

Query: 219 XXXXVLS--ESNAISMEKFSLIIGALNSKDNTTSEDSALQAPLTENKGLFIIGDLVEDLY 276
                 +  + + +  +KF+  +G        TS+DS       EN G    G + +  +
Sbjct: 211 VVPPFYNAIQQDLLDEKKFAFYLG-------DTSKDS-------ENGGEATFGGIDKSKF 256

Query: 277 TGDIHYASLITNENHYWQLKIDSVYVNSQAVNFSTSEAVTGSQSSYIRSGIVDSGTTLLI 336
            GD+ +  L      YW++K + + +  +        A             +D+GT+L+ 
Sbjct: 257 KGDVTW--LPVRRKAYWEVKFEGIGLGHEFAELEGHGAA------------IDTGTSLIT 302

Query: 337 LPTQDALDLHTFFVNSVSDGTNFAIPCNSTE---ILSLEINGVKWPISSEEYLGEAYPQD 393
           LP+  A  ++            +A+ CN+ +    L+   NG  + I   +Y  E     
Sbjct: 303 LPSGLAEMINAEIGAKKGWSGQYALDCNTRDGLPDLTFNFNGYNFTIGPYDYTLEVS--- 359

Query: 394 SYYYGYCVSNIQGLELDES----WILGAVFLKDKYAVFDVQNQQFGLA 437
               G C+S I  ++  E      I+G  FL+  Y+++D+ N   GLA
Sbjct: 360 ----GSCISAITPMDFPEPVGPLAIIGDAFLRKYYSIYDLGNDAVGLA 403

>SAKL0H06512g Chr8 complement(573927..575141) [1215 bp, 404 aa] {ON}
           highly similar to uniprot|P07267 Saccharomyces
           cerevisiae YPL154C PEP4 Vacuolar aspartyl protease
           (proteinase A) required for the posttranslational
           precursor maturation of vacuolar proteinases synthesized
           as a zymogen self-activates
          Length = 404

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 75/349 (21%), Positives = 137/349 (39%), Gaps = 50/349 (14%)

Query: 103 YFVNVTIG--DEIYPLVVDSGSAYLWVYGXXXXXXXXXXXXLFSTDNVKR-AADESTFSL 159
           Y+  +++G   + + +++D+GS+ LWV               +  D+     A+ S+F++
Sbjct: 91  YYTEISLGTPPQNFKVILDTGSSNLWVPSAECGSLACFLHAKYDHDSSSSYKANGSSFAI 150

Query: 160 IYSSGTASGDVYEDRIIVNKLATTQNFTFGVANEVPDI-FENYPVSGIFGLPXXXXXXXX 218
            Y SG+  G + +D + +  L T     F  A   P + F      GI GL         
Sbjct: 151 QYGSGSLEGYISQDTLSIGDL-TIPKQDFAEATSEPGLAFAFGKFDGILGLAYDSISVDK 209

Query: 219 XXXXVLS--ESNAISMEKFSLIIGALNSKDNTTSEDSALQAPLTENKGLFIIGDLVEDLY 276
               V +   +  +   KFS  +G   + D +T            + G    G +    Y
Sbjct: 210 VVPPVYNAIHNGLLDEPKFSFYLG---NADKST------------DGGEATFGGIDSSKY 254

Query: 277 TGDIHYASLITNENHYWQLKIDSVYVNSQAVNFSTSEAVTGSQSSYIRSGIVDSGTTLLI 336
            G+I +  L      YW++K D + +  +        A             +D+GT+L+ 
Sbjct: 255 EGNITW--LPVRRKAYWEVKFDGIGLGDEYAILDGHGAA------------IDTGTSLIA 300

Query: 337 LPTQDALDLHTFFVNSVSDGTNFAIPCNSTEIL---SLEINGVKWPISSEEYLGEAYPQD 393
           LP+  A  L+            +++ C++ + L   +L   G  + I+  +Y  E     
Sbjct: 301 LPSGLAEILNAEIGAKKGWSGQYSVECDTRDSLPDLTLNFGGYNFTITPYDYTLEVS--- 357

Query: 394 SYYYGYCVSNIQGLELDES----WILGAVFLKDKYAVFDVQNQQFGLAN 438
               G C+S    ++  E      I+G  FL+  Y+V+D+ N   GLA 
Sbjct: 358 ----GSCISAFTPMDFPEPVGPLAIIGDAFLRKHYSVYDLGNDAVGLAK 402

>ZYRO0F07392g Chr6 (598584..599840) [1257 bp, 418 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 418

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 73/362 (20%), Positives = 144/362 (39%), Gaps = 50/362 (13%)

Query: 90  GMSILSTDSNTQAYFVNVTIG--DEIYPLVVDSGSAYLWVYGXXXXXXXXXXXXLFSTDN 147
           G S+  T+     Y+  V++G   + + +++D+GS+ LWV               +  D+
Sbjct: 92  GHSVPLTNYLNAQYYTEVSLGTPPQNFKVILDTGSSNLWVPSTECSSLACFLHSKYDHDS 151

Query: 148 VKRAADEST-FSLIYSSGTASGDVYEDRIIVNKLATTQNFTFGVANEVPDI-FENYPVSG 205
                   T F++ Y SG+  G + +D + +  L+ T+   F  A   P + F      G
Sbjct: 152 SSSYKPNGTEFAIRYGSGSLEGYISQDTLNLGDLSITKQ-DFAEATSEPGLQFAFGKFDG 210

Query: 206 IFGLPXXXXXXXXXXXXVLS--ESNAISMEKFSLIIGALNSKDNTTSEDSALQAPLTENK 263
           I GL               +  +   +   KF+  +G    +D             +++ 
Sbjct: 211 ILGLGYDTISVDGVVPPFYNAWKQGLLDEPKFAFYLG----RDGE-----------SQDG 255

Query: 264 GLFIIGDLVEDLYTGDIHYASLITNENHYWQLKIDSVYVNSQAVNFSTSEAVTGSQSSYI 323
           G+   G + +  Y G+I +  L      YW++K D + +  +        A         
Sbjct: 256 GVATFGGVDDSKYEGEITW--LPIRRKAYWEVKFDGIGLGEEYAELENHGAA-------- 305

Query: 324 RSGIVDSGTTLLILPTQDALDLHTFFVNSVSDGTNFAIPCNSTEIL---SLEINGVKWPI 380
               +D+GT+L+ LP+  A  ++       S    + + C +   L   +  + G  + +
Sbjct: 306 ----IDTGTSLIALPSGLAEIINAEIGAKKSWTGQYTVECEARSSLPNMTFTLGGHNFEL 361

Query: 381 SSEEYLGEAYPQDSYYYGYCVSNIQGLELDES----WILGAVFLKDKYAVFDVQNQQFGL 436
           ++ +Y+ E         G C+S I  ++  E      I+G  FL+  Y+++D+ N   GL
Sbjct: 362 TAYDYILEV-------SGQCISAIFPMDFPEPVGPLAIIGDSFLRKYYSIYDLGNNAVGL 414

Query: 437 AN 438
           A+
Sbjct: 415 AD 416

>Kpol_1072.15 s1072 complement(35798..36997) [1200 bp, 399 aa] {ON}
           complement(35798..36997) [1200 nt, 400 aa]
          Length = 399

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 78/350 (22%), Positives = 133/350 (38%), Gaps = 52/350 (14%)

Query: 103 YFVNVTIG--DEIYPLVVDSGSAYLWV--YGXXXXXXXXXXXXLFSTDNVKRAADESTFS 158
           Y+ +V+IG   + + +++D+GS+ LWV   G              S  +  R+ + S F 
Sbjct: 86  YYTDVSIGTPPQKFKVILDTGSSNLWVPSVGCSSLACYLHSKYDHSLSSTYRS-NGSDFV 144

Query: 159 LIYSSGTASGDVYEDRIIVNKLATTQNFTFGVANEVPDI-FENYPVSGIFGLPXXXXXXX 217
           + Y SG+  G + +D + +  L   Q   F  A   P + F      GI GL        
Sbjct: 145 IQYGSGSLKGYISQDTLTIGDLIIPQQ-DFAEATAEPGLAFAFGKFDGILGL---AYDSI 200

Query: 218 XXXXXVLSESNAISMEKFSLIIGALNSKDNTTSEDSALQAPLTENKGLFIIGDLVEDLYT 277
                V    NAI        + A    D  +S+          N G    G      + 
Sbjct: 201 SVNKAVPPLYNAIHRGLLDKPMFAFYLGDEKSSK----------NGGEATFGGYDPSRFE 250

Query: 278 GDIHYASLITNENHYWQLKIDSVYVNSQAVNFSTSEAVTGSQSSYIRSGIVDSGTTLLIL 337
           G+I +  L      YW+++ D + +  + +      A             +D+GT+L+ L
Sbjct: 251 GEIKW--LPVRRKAYWEVQFDGIKLGDKFMKLEGHGAA------------IDTGTSLITL 296

Query: 338 PTQDALDLHTFFVNSVSDGTNFAIPCNSTEILSLEINGVKWPISSEEYLGEAYPQDSYYY 397
           P+Q A  L+       S    + I C   E L         P  +  +    +  D + Y
Sbjct: 297 PSQIADFLNNEIGAKKSWNGQYTIDCKKRESL---------PKLTLNFYNHNFTIDPFDY 347

Query: 398 -----GYCVSNIQGLELDESW----ILGAVFLKDKYAVFDVQNQQFGLAN 438
                G C+S I  ++  +      I+G  FL+  Y+++D++N   GLA 
Sbjct: 348 TLEISGSCISAITPMDFPQPVGPLSIIGDAFLRRFYSIYDLENNAVGLAK 397

>ACR143W Chr3 (601369..602550) [1182 bp, 393 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL154C (PEP4);
           Tandem gene duplication in this genome
          Length = 393

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 74/351 (21%), Positives = 136/351 (38%), Gaps = 57/351 (16%)

Query: 103 YFVNVTIGD--EIYPLVVDSGSAYLWVYGXXXXXXXXXXXXLFSTDNVKRAADESTFS-- 158
           Y V++T+G   + + + +D+GS+ LW+              +  T N  R+   STF   
Sbjct: 83  YSVDITLGTPAQNFRVALDTGSSLLWI------PSDRCTSQICRTRNRYRSGASSTFKAT 136

Query: 159 -----LIYSSGTASGDVYEDRIIVNKLATTQNFTFGVANEVPDIFENYPVSGIFGLPXXX 213
                L Y  G A   V  D +     A  +N  FG A  + D F      GI G+    
Sbjct: 137 DKTLRLQYVKGDAKARVSYDTLYFAG-AKIENQGFGEAEAIGDDFSGARFDGIIGIGYPS 195

Query: 214 XX-XXXXXXXVLSESNAISMEKFSLIIGALNSKDNTTSEDSALQAPLTENKGLFIIGDLV 272
                      L +S  +    F + I    ++++   E               ++G   
Sbjct: 196 IGYGIKPPINTLIDSGGLKDPMFGIYISNAQNRNSPVGE--------------IVLGGYN 241

Query: 273 EDLYTGDIHYASLITNENHYWQLKIDSVYVNSQAVNFSTSEAVTGSQSSYIRSGIVDSGT 332
              + GDI +  ++     +W+  + +  V + A++     AV             D+G+
Sbjct: 242 TQKFKGDIKWLPVL--RKAFWETDLSAFKVGNFALDVQGLTAV------------FDTGS 287

Query: 333 TLLILPTQDALDLHTFFVN-SVSDGTNFAIPC---NSTEILSLEINGVKWPISSEEYLGE 388
           + +I+P     D  + F   S  DGT++ + C   NS   L+L+  GV   +S+ +Y+ +
Sbjct: 288 SFIIMPEDTYTDFVSQFPGASHDDGTDY-VDCSTVNSGPDLTLDFGGVALKLSARDYVMQ 346

Query: 389 AYPQDSYYYGYCVSNIQG-LELDESWILGAVFLKDKYAVFDVQNQQFGLAN 438
                      C+  + G   +    ILG  FL+  Y +++  +   G+A+
Sbjct: 347 LGRNT------CILAVSGNSRVTGEVILGDTFLRRYYTIYNFGDNTIGVAS 391

>KAFR0H02420 Chr8 complement(462759..464009) [1251 bp, 416 aa] {ON}
           Anc_8.677 YPL154C
          Length = 416

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 80/369 (21%), Positives = 140/369 (37%), Gaps = 64/369 (17%)

Query: 79  STKNVEVPVKPGMSILSTDSNTQAYFVNVTIGD--EIYPLVVDSGSAYLWVYGXXXXXXX 136
           + +N EVP       L+   N Q YF +++IG   + + +++D+GS+ LWV         
Sbjct: 83  AQQNHEVP-------LNNYLNAQ-YFADISIGSPGQTFRVIMDTGSSNLWVPSVDCNSLA 134

Query: 137 XXXXXLF----STDNVKRAADESTFSLIYSSGTASGDVYEDRIIVNKLATTQNFTFGVAN 192
                 +    S+  V+     + F++ Y SG   G +  D + V  L   +   F  A 
Sbjct: 135 CFLHNKYDHRVSSTYVRNG---TRFAIRYGSGALEGYMSNDTVTVGDLQIPKQ-DFAEAT 190

Query: 193 EVPDI-FENYPVSGIFGLPXXXXXXXXXXXXVLSESNA--ISMEKFSLIIGALNSKDNTT 249
             P + F      GIFGL               +  N   +   +F+  +G         
Sbjct: 191 SEPGLAFAFGKFDGIFGLAFDTISVNRAVPPFYNAVNRGLLDAPQFAFYLG--------- 241

Query: 250 SEDSALQAPLTENKGLFIIGDLVEDLYTGDIHYASLITNENHYWQLKIDSVYVNSQAVNF 309
                    L +  G    G   E  +TG+I +  L      YW++  + +   SQ    
Sbjct: 242 ------DKRLRKEGGEVTFGGYDETRFTGNITW--LPVRREAYWEVDFNGISFGSQYAPL 293

Query: 310 STSEAVTGSQSSYIRSGIVDSGTTLLILPTQDALDLHTFFVNSVSDGTNFAIPCNSTEIL 369
           + + A             +D+GT+L+ LP+  A  L+       +    + + C+    L
Sbjct: 294 TATGAA------------IDTGTSLITLPSGLAEILNAQIGARKNWSGQYVLDCSRRSTL 341

Query: 370 ---SLEINGVKWPISSEEYLGEAYPQDSYYYGYCVSNIQGLELDES----WILGAVFLKD 422
              +  + G  + I   +Y  EA        G C+S I  ++  E      I+G  FL+ 
Sbjct: 342 PDITFNLGGSNFSIGPYDYTLEA-------SGTCISAIVPMDFPEPVGPLAIIGDAFLRR 394

Query: 423 KYAVFDVQN 431
            Y+V+D+ N
Sbjct: 395 WYSVYDLGN 403

>NDAI0B01720 Chr2 complement(409125..410768) [1644 bp, 547 aa] {ON}
           Anc_7.182
          Length = 547

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 62/124 (50%), Gaps = 12/124 (9%)

Query: 327 IVDSGTTLLILPTQDALDLHTFFVNSV--SDGTNFAIPCNSTEILS-----LEINGVKWP 379
           ++DSGTTL+  P + A D    FVN+    D   + + C S E+L+      +  G++  
Sbjct: 299 LLDSGTTLMSAPKELA-DKMADFVNATYSEDDRIYILNCPSQEVLNDIEYIFDFGGLQVK 357

Query: 380 ISSEEYLGEAYPQDSYYYGYCVSNIQGLELDESWILGAVFLKDKYAVFDVQNQQFGLANK 439
           I  E+++    P D    G C   +      +  +LG +FL   YAVFD+ + Q  LAN 
Sbjct: 358 IPLEKFI---LPSDDGS-GPCAFGVLPETTTDRMVLGDIFLSFVYAVFDLDHYQISLANI 413

Query: 440 NENA 443
           N+NA
Sbjct: 414 NKNA 417

>SAKL0F07172g Chr6 complement(541680..543308) [1629 bp, 542 aa] {ON}
           some similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 542

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 52/195 (26%), Positives = 93/195 (47%), Gaps = 24/195 (12%)

Query: 259 LTENKGLFIIGDLVEDLYTGDIHYASLITNENHYWQLKIDSVYVNSQAVNFSTSEAVTGS 318
           L  + G  + G +  + YTGD++   L+ N +     K    +V  Q +   +S    GS
Sbjct: 225 LDSSSGSILFGGIDSNKYTGDLYTFPLV-NIHPSVVNKPAKFHVTVQGIGVQSS----GS 279

Query: 319 QSSYIRS----GIVDSGTTLLILPTQDALDLHTFFVNSVSDGTN--FAIPC----NSTEI 368
           + S + S     ++DSGTTLL+ P Q+  D    +VN+  +     + + C    + TE 
Sbjct: 280 EQSILMSTKYPALLDSGTTLLVAP-QEFADSMANYVNATYNDLEGIYTMTCPPENDDTEF 338

Query: 369 LSLEINGVKWPISSEEYLGEAYPQDSYYYGYCVSNIQGLELDESWILGAVFLKDKYAVFD 428
           L  +   +K  +  + ++    P+D+ Y G+ V     L   ++ ILG +FL   Y V+D
Sbjct: 339 L-FDFGDLKIKVPLKNFI--LAPEDNEYCGFGV-----LPTVDTMILGDMFLSAAYVVYD 390

Query: 429 VQNQQFGLANKNENA 443
           +++ +  LA  N N+
Sbjct: 391 LESYEVSLAQANWNS 405

>TPHA0C00840 Chr3 (173318..176320) [3003 bp, 1000 aa] {ON} Anc_8.318
           YLR120C
          Length = 1000

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 90/407 (22%), Positives = 167/407 (41%), Gaps = 78/407 (19%)

Query: 78  SSTKNVEVPVKPGMSILSTDSNTQAYFVNVTIGD--EIYPLVVDSGSAYLWVYGXXXXXX 135
           +ST   ++  + G  I+ T+ NT  Y   + +G   +   ++VD+GS+ LWV G      
Sbjct: 49  TSTSETKLVKRDGEDIVLTNRNT-FYSAEIEVGTPAQTMNVIVDTGSSDLWVIGHDNLTC 107

Query: 136 XXXXXXLFSTDNVKR---------AADESTFSLIYSSGTASGDVY-EDRIIVNKLATTQN 185
                  F+ +               + + F++ Y SG     V+ +D +I+  +  T  
Sbjct: 108 PLASDGSFNCERFGSFSISKSSTFTKNSTEFAITYVSGNNCIGVWGQDNLIIGGVNAT-G 166

Query: 186 FTFGVANEVPDIFENYPVSGIFGLPXXXXXXXXXXX--------XVLSESNAISMEKFSL 237
            +FGV +       +  + GI GLP                    VL     IS + +S+
Sbjct: 167 LSFGVVHTTT---SSAGILGI-GLPDTETTAVGQYGHYKYDNFPMVLKNKGIISHQGYSI 222

Query: 238 IIGALNSKDNTTSEDSALQAPLTENKGLFIIGDLVEDLYTGDIHYASLITNENHYWQLKI 297
               L+S  +T  E              F++G +    YTG ++   L+   N Y+    
Sbjct: 223 Y---LDSSSSTYGE--------------FLLGGVDTSKYTGTLYKLPLVNWYNTYFSSPG 265

Query: 298 DSVYVNSQAVNFSTSEAVTGSQSSYIRSGIVDSGTTLLILPTQ--DAL--DLHTFFVNSV 353
           D  +V  Q +   T+     + +    + I+D+G+T+  +P    +AL   L  ++ +S 
Sbjct: 266 D-FHVTLQGLGLITNSGSAVTLTETKMAVILDTGSTVTGIPATLYNALLSSLGGYY-SST 323

Query: 354 SDGTNFAIPCNSTEILSLEINGV--KWPISSEEYLGEAYPQDSYYYGYCVSNIQGLEL-- 409
                F  P  +++++     G+  K P+SS             +      N+  L++  
Sbjct: 324 HGAYVFTCPTETSKLV-FNFGGINYKLPMSS-------------FINTLGDNVCSLKVSS 369

Query: 410 --DESWILGAVFLKDKYAVFDVQNQQFGLA---------NKNENAIL 445
             D ++ILG  FL++ YA FD++N++ GLA         NK E+ ++
Sbjct: 370 RSDSNFILGDDFLRNVYAAFDLENKEIGLAMADFDSSSNNKREDTVI 416

>AGR407C Chr7 complement(1475317..1476123) [807 bp, 268 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPL154C
           (PEP4)
          Length = 268

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 82/184 (44%), Gaps = 29/184 (15%)

Query: 262 NKGLFIIGDLVEDLYTGDIHYASLITNENHYWQLKIDSVYVNSQAVNFSTSEAVTGSQSS 321
           N+G  I G      + G + +  L   +  +W+++ +S+         ST E+    +  
Sbjct: 105 NEGEIIFGGYDSTKFAGSLEW--LPITKKGFWEVEFNSI---------STGESTVQGEG- 152

Query: 322 YIRSGIVDSGTTLLILPTQDALDLHTFFVNSVSDGTNFAIPCNSTEI---LSLEINGVKW 378
                I+D+G++L +LPT+     +     ++   T   + C++ E    +  E+ G K+
Sbjct: 153 --LGAILDTGSSLTLLPTEIFDKFNGALEAALGSKTGGRVSCSARETAPEIVFELGGKKF 210

Query: 379 PISSEEYLGEAYPQDSYYYGYCVSNIQ----GLELDESWILGAVFLKDKYAVFDVQNQQF 434
            I+  EY+    P  S     C+  I+    G +     ILG  FL+  Y+V+D+ + + 
Sbjct: 211 AITGNEYI---MPAGSE----CMVTIRPQASGAQ-SNVVILGTPFLRKFYSVYDLGSDRV 262

Query: 435 GLAN 438
           GLA 
Sbjct: 263 GLAE 266

>Skud_12.193 Chr12 complement(371627..373120) [1494 bp, 497 aa] {ON}
           YLR121C (REAL)
          Length = 497

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 83/360 (23%), Positives = 142/360 (39%), Gaps = 41/360 (11%)

Query: 98  SNTQAYF-VNVTIGDEIYPLVV--DSGSAYLWV--YGXXXXXXXXXXXXLFSTDNVK--- 149
           +N Q+++ V + IG     L V  D+GSA LWV   G                D  K   
Sbjct: 57  ANEQSFYSVELAIGTPSQSLTVLLDTGSADLWVPSKGNPYCGSVMDCDQYGVFDKTKSST 116

Query: 150 -RAADESTFSLIYSSGT-ASGDVYEDRIIVNKLATTQNFTFGVANEVPDIFENYPVSGIF 207
            +A   S F   Y  GT A G   +DR+  N L  +   +F VANE    F      G+ 
Sbjct: 117 FKANKSSPFYAAYGDGTFAQGAFGQDRLKYNGLDLS-GLSFAVANESNSTF------GVL 169

Query: 208 GLPXXXXXXXXXXXXVLSESNAISMEKFSLIIGALNSKDNTTSEDSALQAPLTENKGLFI 267
           G+              + +  +   + F L +    + D T    S      +++ G  +
Sbjct: 170 GIGLPALEVTYSGKVAVVDKKSYEYDNFPLFLKRSGAIDATAY--SLFLNDESQSSGSIL 227

Query: 268 IGDLVEDLYTGDIHYASLIT---NENHYWQLKIDSVYVNSQAVNFSTSEAVTGSQSSYIR 324
            G +    Y G ++   L+    ++ +   +  D   V    +   T    T   ++ I 
Sbjct: 228 FGAVDHSKYEGRLYTVPLVNLYRSQGYQHPVAFD---VTLHGIGLQTDRHNTTLTATKIP 284

Query: 325 SGIVDSGTTLLILPTQDALDLHTFFVNSVSDGT----NFAIPCNSTEI-LSLEING--VK 377
           + ++DSGTTL  LP+Q A+ L    +N+          +A P +  +  ++ +  G  + 
Sbjct: 285 A-LLDSGTTLTYLPSQ-AVALLAKSLNATYSKALGYYEYACPSSDNDTSVAFDFGGFHIN 342

Query: 378 WPISSEEYLGEAYPQDSYYYGYCVSNIQGLELDESWILGAVFLKDKYAVFDVQNQQFGLA 437
            P+S        +   +   G CV  +     + + ILG  FL++ Y V+D+ N +  LA
Sbjct: 343 APVSD-------FTMQTSVGGTCVLAVIPQAGNATAILGDSFLRNAYVVYDLDNYEVSLA 395

>YIR039C Chr9 complement(430498..432111) [1614 bp, 537 aa] {ON}
           YPS6Putative GPI-anchored aspartic protease, member of
           the yapsin family of proteases involved in cell wall
           growth and maintenance
          Length = 537

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 69/291 (23%), Positives = 121/291 (41%), Gaps = 24/291 (8%)

Query: 157 FSLIYSSGTASGDVYEDRIIVNKLATTQNFTFGVANEVPDIFENYPVSGIFG--LPXXXX 214
           F+  Y  GT     Y   ++  +  T  +FTFGV+N   D   N   SGI G  LP    
Sbjct: 160 FNNTYGDGTYYAGTYGTDVVSFENITLNDFTFGVSN---DTIGN--PSGILGISLPIAEF 214

Query: 215 XXXXXXXXVLSESNAISMEKFSLIIGALNSKDNTTSEDSALQAPLTENKGLFIIGDLVED 274
                    L+ +  I  + F + +     K N  +    L  P   + G  + G + + 
Sbjct: 215 TDGIEYALALNRTPFI-YDNFPMELKN-QGKINKIAYSLFLNGP-DAHFGSILFGAVDKS 271

Query: 275 LYTGDIHYASLITNENHYWQLKIDSVYVNSQAVNFSTSEAVTGSQSSYIRSGIVDSGTTL 334
            YTG ++   ++   N         + + +Q+V    SE+   + S      ++DSGTT 
Sbjct: 272 KYTGQLYTLPMLQAFNTLGSNP--GMIITAQSVAILDSESGNKTVSDIQFPVMLDSGTTF 329

Query: 335 LILPTQDALDLHTFFVNSVS-DGTNFAIPCNSTE--ILSLEINGVKWPISSEEYLGEAYP 391
             LPT+ A  +   F    S D   +   C+     +LS++  G     +   ++  A  
Sbjct: 330 SYLPTEIAEAIGKSFDGEYSSDDQGYIFDCSKVNDTLLSVDFGGFNISANISNFVTSAKD 389

Query: 392 QDSYYYGYCVSNIQGLELDESWILGAVFLKDKYAVFDVQNQQFGLANKNEN 442
           +       CV N++  + + +++LG  FL D Y V+D++N +  +A  + N
Sbjct: 390 R-------CVLNVK--QSESTYMLGDAFLVDAYVVYDLENYEISIAQASFN 431

>KNAG0G02410 Chr7 complement(550827..552419) [1593 bp, 530 aa] {ON} 
          Length = 530

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/195 (25%), Positives = 82/195 (42%), Gaps = 33/195 (16%)

Query: 259 LTENKGLFIIGDLVEDLYTGDIHYASLITNENHYWQLKIDSVYVNSQAVNFSTSEAVTGS 318
           L E +G  + G +    YTG ++   +I     Y         +  Q +  S+SE+  G 
Sbjct: 230 LEEERGSILFGAVDHSKYTGSMYTLPIINRLQSYGYTTPIQFDITLQGIGLSSSES-NGD 288

Query: 319 Q---SSYIRSGIVDSGTTLLILPTQDALDLHTFFVNSVSDG-TNFAIPC-NSTEILSLEI 373
           +   +S     ++DSGTT+  LP+     +      S+S     + +PC N  E + L  
Sbjct: 289 EVTITSTKMPALLDSGTTMTYLPSNIVSQIAQQLGASMSARFGQYVLPCSNVPENMHLVY 348

Query: 374 NGVKWPISSE--EYLGEA---------YPQDSYYYGYCVSNIQGLELDESWILGAVFLKD 422
           +   + I+S    Y+ +A         +P+DS                 + ILG  FL D
Sbjct: 349 DFGGFHINSNLTNYIVQASQTLCILGLFPRDS----------------NTAILGDTFLTD 392

Query: 423 KYAVFDVQNQQFGLA 437
            Y V+D++N Q GLA
Sbjct: 393 AYVVYDLENLQIGLA 407

>Smik_65.1 Chr65 (2..1027) [1026 bp, 342 aa] {ON} YIR039C (REAL)
          Length = 342

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 67/295 (22%), Positives = 120/295 (40%), Gaps = 36/295 (12%)

Query: 153 DESTFSLIYSSGTASGDVYEDRIIVNKLATTQNFTFGVANEVPDIFENYPVSGIFGLPXX 212
           +++ F   Y  GT     Y   ++     T ++F+FGVAN      EN    GI G+   
Sbjct: 1   NDTQFDETYGDGTYYRGTYGTDVVSLGNITLESFSFGVANNT----ENQ--GGILGISLP 54

Query: 213 XXXXXXXXXXVLSESNAISMEKFSLIIGALNSKDNTTSEDSALQAPLTENKGLF---IIG 269
                       + +     E F + +     K +   E  A    L E K  F   + G
Sbjct: 55  AGENTHSLGGAYN-TTPFEYENFPMAL-----KSHGKIEKIAYSLFLNEPKAHFGSILFG 108

Query: 270 DLVEDLYTGDIHYASLITNENHYWQLKIDSV----YVNSQAVNFSTSEAVTGSQSSYIRS 325
            + +  Y+G ++   ++   +      +DSV    +V +Q+V     ++   + S     
Sbjct: 109 AVDKSKYSGQLYTLPMLQAYD-----TLDSVSPGMFVTAQSVAVLNGDSGNKTVSKVRFP 163

Query: 326 GIVDSGTTLLILPTQDALDLHTFFVNSVSDG-TNFAIPCNSTE--ILSLEINGVKWPISS 382
            + DSGTT   LPT+ A  +   F    S G   +   C+  +  +LS++  G     + 
Sbjct: 164 VLFDSGTTYSSLPTEVAHAIGKSFDGKYSSGDQGYTFDCSKVKDTLLSIDFGGFNISANI 223

Query: 383 EEYLGEAYPQDSYYYGYCVSNIQGLELDESWILGAVFLKDKYAVFDVQNQQFGLA 437
             ++     +D     +C+ NI+    D  ++LG  FL D Y VFD+++ +  +A
Sbjct: 224 SNFVTRT--KD-----HCLLNIEAA--DSGFVLGDAFLVDAYVVFDLESHEVSIA 269

>CAGL0E01837g Chr5 complement(183237..184802) [1566 bp, 521 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3
          Length = 521

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 60/127 (47%), Gaps = 14/127 (11%)

Query: 327 IVDSGTTLLILPTQDALDLHTFFVNSVSDGTNFAIP---CNS---TEILSLEINGVKWPI 380
           ++DSG+T+ +LP +D  DL    VN   DG    I    C S    + L    +G ++ +
Sbjct: 301 LLDSGSTISLLP-RDVADLVAQQVNGTVDGKGNCIKLPKCPSKKDNQKLIFNFSGAEFSV 359

Query: 381 SSEEYLGEAYPQDSYYYGYCVSNIQGLELDESWILGAVFLKDKYAVFDVQNQQFGLANKN 440
           +  +++ +       + G C      L+     +LG  F+ + Y VF++ +++  LA  N
Sbjct: 360 NVTDFMEK-------HKGKCYLQFSALDGINFALLGDNFMNNVYTVFNLDDKELSLAQAN 412

Query: 441 ENAILVP 447
            N+ L P
Sbjct: 413 YNSSLKP 419

>ZYRO0E02266g Chr5 complement(169081..170601) [1521 bp, 506 aa] {ON}
           weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 506

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 79/184 (42%), Gaps = 20/184 (10%)

Query: 264 GLFIIGDLVEDLYTGDIHYASLITNE--NHYWQLKIDSVYVNSQAVNFSTSEAV-TGSQS 320
           G  + G +  + Y+GD++   ++  +  +  W+  +    V  Q +    SE   T + +
Sbjct: 296 GNILFGGVDHNKYSGDLYTLPVLKGQEDSDPWERFV----VTVQGIGIKGSETQNTLTTT 351

Query: 321 SYIRSGIVDSGTTLLILPTQDALDLHTFFVNSVSDGT---NFAIPCNST-EILSLEINGV 376
            +I  G++DSGTT + LP   A  +   +  S  D     ++ I C S  E +     G 
Sbjct: 352 PFI--GLLDSGTTAVYLPEPVADMVANAYGGSFDDDPEVQSYVISCPSDDEKIVFNFGGF 409

Query: 377 KWPISSEEYLGEAYPQDSYYYGYCVSNIQGLELDESWILGAVFLKDKYAVFDVQNQQFGL 436
               S   Y+ +         G C+ NI     D   ILG  FL+D Y V+D+ N +  L
Sbjct: 410 NIETSLSNYITDNG------NGQCILNISPTS-DYMGILGDSFLRDSYVVYDMDNNEISL 462

Query: 437 ANKN 440
           A  N
Sbjct: 463 AQAN 466

>TDEL0A06230 Chr1 (1091257..1092483) [1227 bp, 408 aa] {ON}
           Anc_8.677 YPL154C
          Length = 408

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 69/352 (19%), Positives = 139/352 (39%), Gaps = 52/352 (14%)

Query: 103 YFVNVTIGD--EIYPLVVDSGSAYLWVYGXXXXXXXXXXXXLF-STDNVKRAADESTFSL 159
           Y+ ++++G   + + +++D+GS+ LWV               +  + +     + + F++
Sbjct: 91  YYTDISLGTPAQNFKVILDTGSSNLWVPSVDCGSLACFLHSKYDHSASSSYKPNGTDFAI 150

Query: 160 IYSSGTASGDVYEDRIIVNKLATTQNFTFGVANEVPDI-FENYPVSGIFGLPXXXXXXXX 218
            Y SG+  G + +D + V  L   +   F  A   P + F      GI GL         
Sbjct: 151 QYGSGSLEGYISQDTLSVGDLVIPKQ-DFAEATSEPGLAFAFGKFDGILGL---AYNTIS 206

Query: 219 XXXXVLSESNAISME-----KFSLIIGALNSKDNTTSEDSALQAPLTENKGLFIIGDLVE 273
               V    NAI  +     +F+  +G  +  ++++            + G+   G + +
Sbjct: 207 VDKVVPPFYNAIDQDLLDEPRFAFYLGDSSDSEDSSV-----------SGGVATFGGIDK 255

Query: 274 DLYTGDIHYASLITNENHYWQLKIDSVYVNSQAVNFSTSEAVTGSQSSYIRSGIVDSGTT 333
             + G+I +  L      YW++K + + +  +        A             +D+GT+
Sbjct: 256 SKFKGEISW--LPVRRKAYWEVKFEGIGLGDEFAILDGHGAA------------IDTGTS 301

Query: 334 LLILPTQDALDLHTFFVNSVSDGTNFAIPC---NSTEILSLEINGVKWPISSEEYLGEAY 390
           L+ LP+  A  +++           + + C   +S   L+   +G  + I   +Y  E  
Sbjct: 302 LITLPSGLAEIINSEIGAKKGWSGQYTVDCETRSSLPDLTFNFSGKNYTIGPYDYTLEVS 361

Query: 391 PQDSYYYGYCVSNIQGLELDES----WILGAVFLKDKYAVFDVQNQQFGLAN 438
                  G C+S I  ++  E      I+G  FL+  Y+V+D+ N   GLA 
Sbjct: 362 -------GSCISAITPMDFPEPVGPLAIVGDTFLRRFYSVYDLGNNAVGLAK 406

>AGL192W Chr7 (337445..338944) [1500 bp, 499 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR121C (YPS3),
           YDR144C (MKC7) and YLR120C (YPS1); Tandem gene
           duplication in Saccharomyces cerevisiae
          Length = 499

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 91/383 (23%), Positives = 141/383 (36%), Gaps = 71/383 (18%)

Query: 94  LSTDSNTQAYFVNVTIG--DEIYPLVVDSGSAYLWVYGXXXX----------XXXXXXXX 141
           +  D+    Y VN++IG   +   +++D+GS+ LWV G                      
Sbjct: 65  IEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGPNNYPNPNQLNCYEHG 124

Query: 142 LFSTDNVKRAADEST-FSLIYSSGT-ASGDVYEDRIIVNKLATTQNFTFGVANEVPDIFE 199
            F T       D +T F + Y   T A G    DR+ + + A     TF VA+       
Sbjct: 125 SFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQ-ANVDGLTFAVAHASN---S 180

Query: 200 NYPVSGIFGLPXXXXXXXXXX--------XXVLSESNAISMEKFSLIIGALNSKDNTTSE 251
           +  V GI GLP                    VL  +N I    +S+ I  LN+K      
Sbjct: 181 SVAVLGI-GLPAMETTMSSQQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAK------ 233

Query: 252 DSALQAPLTENKGLFIIGDLVEDLYTGDIHYASLITNENHYWQL-KIDSVYVNSQAVNFS 310
                       G  + G +    Y G ++   L+ N N+  ++ K   ++V   A+   
Sbjct: 234 -----------TGSVLFGAVDHSKYKGTLNTVPLV-NANYRRRVNKPVELHVTLAAIGLH 281

Query: 311 TS------EAVTGSQSSYIRSGIVDSGTTLLILPTQDALDL-HTFFVNSVSDGTNFAIPC 363
           T       + + GS+       ++DSGTTL   P Q A  L         S+   + + C
Sbjct: 282 TGRDEDKVQTLLGSKVP----ALLDSGTTLTYFPMQLADRLARAAGARWHSEEVGYIVDC 337

Query: 364 NSTEILSL----EING--VKWPISSEEYLGEAYPQDSYYYGYCVSNIQGLELDESWILGA 417
           NS  +       +  G  ++ P+S        Y   +   G C   I     D   ILG 
Sbjct: 338 NSRRLHQTAYIYDFGGFQIRSPLSD-------YSMMTNVRGTCRFGIMPHSSDYV-ILGD 389

Query: 418 VFLKDKYAVFDVQNQQFGLANKN 440
           VFL   Y VFD++  +  +A  N
Sbjct: 390 VFLTRAYVVFDLEALEVSMAQAN 412

>Suva_16.14 Chr16 (11240..12862) [1623 bp, 540 aa] {ON} YIR039C
           (REAL)
          Length = 540

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 69/301 (22%), Positives = 125/301 (41%), Gaps = 31/301 (10%)

Query: 153 DESTFSLIYSSGTASGDVYEDRIIVNKLATTQNFTFGVANEVPDIFENYPVSGIFGLPXX 212
           +E+ F+L Y   +     Y   ++     T  NFTFGV+N+  +        GI G+   
Sbjct: 158 NETIFNLTYGDNSYYAGTYGTDVVSLGNITLSNFTFGVSNDTTN------NGGILGVSLP 211

Query: 213 XXXXXXXXXXVLSE-SNAISMEKFSLIIGALNSKDNTTSEDSALQAPLTENKGLFIIGDL 271
                      LS  +       F + + +   K    +    L  P +   G  + G +
Sbjct: 212 SAEVTDDTEDALSSNTTPFIYNNFPMALKS-QGKIKKIAYSLFLNEP-SARFGSILFGAV 269

Query: 272 VEDLYTGDIHYASLITNENHYWQLKIDSVYVNSQAVNFSTSEAVTGSQSSYIRSGIVDSG 331
            +  Y+G ++   ++   N         ++V +Q+V    S++   + S      + DSG
Sbjct: 270 DKSEYSGQLYTLPMLQAYNT-LDATDAGMFVTAQSVAILDSKSGNKTVSEVQFPVLFDSG 328

Query: 332 TTLLILPTQ--DALDLHTFFVNSVSDGTNFAIPC---NSTEILSLEINGVKWPISSEEYL 386
           T+  +LPT+  DA+   +F     SD   +   C   N+T +LS +  G     +   ++
Sbjct: 329 TSTSVLPTKIADAIG-RSFDGKYSSDDQGYIFDCAKVNNT-LLSFDFGGFNISANISNFV 386

Query: 387 GEAYPQDSYYYGYCVSNIQGLELDESWILGAVFLKDKYAVFDVQNQQFGLA-----NKNE 441
             A  +D     +C+  +Q L  D  ++LG  FL D Y V+D++N +  +A     NK E
Sbjct: 387 TPA--KD-----HCI--LQILPSDTIFVLGDAFLVDTYVVYDLENHEVSVAQASFDNKEE 437

Query: 442 N 442
           +
Sbjct: 438 D 438

>YLR121C Chr12 complement(388744..390270) [1527 bp, 508 aa] {ON}
           YPS3Aspartic protease, member of the yapsin family of
           proteases involved in cell wall growth and maintenance;
           attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor
          Length = 508

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 81/360 (22%), Positives = 144/360 (40%), Gaps = 42/360 (11%)

Query: 98  SNTQAYF-VNVTIGDEIYPLVV--DSGSAYLWVYGX----XXXXXXXXXXXLFSTDNVK- 149
           +N Q+++ V + IG     L V  D+GSA LWV G                +F  D  K 
Sbjct: 57  ANEQSFYSVELAIGTPSQNLTVLLDTGSADLWVPGKGNPYCGSVMDCDQYGVF--DKTKS 114

Query: 150 ---RAADESTFSLIYSSGT-ASGDVYEDRIIVNKLATTQNFTFGVANEVPDIFENYPVSG 205
              +A   S F   Y  GT A G   +D++  N+L  +   +F VANE    F      G
Sbjct: 115 STFKANKSSPFYAAYGDGTYAEGAFGQDKLKYNELDLS-GLSFAVANESNSTF------G 167

Query: 206 IFGLPXXXXXXXXXXXXVLSESNAISMEKFSLIIGALNSKDNTTSEDSALQAPLTENKGL 265
           + G+              + +  +   + F L +    + D T    S      +++ G 
Sbjct: 168 VLGIGLSTLEVTYSGKVAIMDKRSYEYDNFPLFLKHSGAIDATAY--SLFLNDESQSSGS 225

Query: 266 FIIGDLVEDLYTGDIHYASLI---TNENHYWQLKIDSVYVNSQAVNFSTSEAVTGSQSSY 322
            + G +    Y G ++   L+    ++ +   +  D   V  Q +   T +      ++ 
Sbjct: 226 ILFGAVDHSKYEGQLYTIPLVNLYKSQGYQHPVAFD---VTLQGLGLQTDKRNITLTTTK 282

Query: 323 IRSGIVDSGTTLLILPTQDALDLHTFFVNSVSDGT----NFAIPCNSTEI-LSLEINGVK 377
           + + ++DSGTTL  LP+Q A+ L    +N+    T     +  P +  +  ++ +  G +
Sbjct: 283 LPA-LLDSGTTLTYLPSQ-AVALLAKSLNASYSKTLGYYEYTCPSSDNKTSVAFDFGGFR 340

Query: 378 WPISSEEYLGEAYPQDSYYYGYCVSNIQGLELDESWILGAVFLKDKYAVFDVQNQQFGLA 437
                 ++  +         G CV  I     + + ILG  FL++ Y V+D+ N +  LA
Sbjct: 341 INAPLSDFTMQTS------VGTCVLAIIPQAGNATAILGDSFLRNAYVVYDLDNYEISLA 394

>Smik_5.7 Chr5 (4489..5403) [915 bp, 304 aa] {ON} YIR039C (REAL)
          Length = 304

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 54/115 (46%), Gaps = 12/115 (10%)

Query: 327 IVDSGTTLLILPTQDALDLHTFFVNSVSDG-TNFAIPCNSTE--ILSLEINGVKWPISSE 383
           + DSGTT   LPT+ A  +   F    S G   +   C+  +  +LS++  G     +  
Sbjct: 88  LFDSGTTYSSLPTEVAHAIGKSFDGKYSSGDQGYTFDCSKVKDTLLSIDFGGFNISANIS 147

Query: 384 EYLGEAYPQDSYYYGYCVSNIQGLELDESWILGAVFLKDKYAVFDVQNQQFGLAN 438
            ++     +D     +C+ NI+    D  ++LG  FL D Y VFD+++ +  +A 
Sbjct: 148 NFVTRT--KD-----HCLLNIEAA--DSGFVLGDAFLVDAYVVFDLESHEVSIAQ 193

>YIL015W Chr9 (322342..324105) [1764 bp, 587 aa] {ON}  BAR1Aspartyl
           protease secreted into the periplasmic space of mating
           type a cells, helps cells find mating partners, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest
          Length = 587

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 77/311 (24%), Positives = 122/311 (39%), Gaps = 61/311 (19%)

Query: 157 FSLIYSSGT-ASGDVYEDRIIVNKLATTQNFTFGVANEVPDIFENYPVSGIFGL--PXXX 213
           F + Y+ GT A G    + + +N +    N  FGVA      +   PVSG+ G+  P   
Sbjct: 126 FYITYADGTFADGSWGTETVSINGI-DIPNIQFGVAK-----YATTPVSGVLGIGFPRRE 179

Query: 214 XXXXXXXX---------XVLSESNAISMEKFSLIIGALNSKDNTTSEDSALQAPLTENKG 264
                             +L     I +  +SL    LNS D+ T              G
Sbjct: 180 SVKGYEGAPNEYYPNFPQILKSEKIIDVVAYSLF---LNSPDSGT--------------G 222

Query: 265 LFIIGDLVEDLYTGDIHYASLITNENHYWQLKIDSVYVNSQAV------NFSTSEAVTGS 318
             + G + E  ++GD+    ++   N Y  + +D+    +  +      N S+ E  T +
Sbjct: 223 SIVFGAIDESKFSGDLFTFPMV---NEYPTI-VDAPATLAMTIQGLGAQNKSSCEHETFT 278

Query: 319 QSSYIRSGIVDSGTTLLILPTQDALDLHTFFVNSVSDGTNFAIPCNSTEILSLEIN---- 374
            + Y    ++DSGT+LL  P   A  + +F   S S+     I      +  +E N    
Sbjct: 279 TTKYPV--LLDSGTSLLNAPKVIADKMASFVNASYSEEEGIYILDCPVSVGDVEYNFDFG 336

Query: 375 --GVKWPISSEEYLGEAYPQDSYYYGYCVSNIQGLELDESWILGAVFLKDKYAVFDVQNQ 432
              +  P+SS     E    +  Y G+ V        ++S +LG VFL   Y VFD+ N 
Sbjct: 337 DLQISVPLSSLILSPET---EGSYCGFAVQ-----PTNDSMVLGDVFLSSAYVVFDLDNY 388

Query: 433 QFGLANKNENA 443
           +  LA  N NA
Sbjct: 389 KISLAQANWNA 399

>Suva_9.186 Chr9
           (310161..310220,310267..310332,310362..310451,
           310470..310622,310626..310658,310662..310688,
           310692..310742,310746..310787,310807..310833,
           310840..311922) [1632 bp, 543 aa] {OFF} YIL015W (PSEUDO)
          Length = 543

 Score = 39.3 bits (90), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 26/46 (56%), Gaps = 2/46 (4%)

Query: 398 GYCVSNIQGLELDESWILGAVFLKDKYAVFDVQNQQFGLANKNENA 443
           GYC   +Q    ++S +LG VFL   Y VFD+ N +  LA  N NA
Sbjct: 308 GYCGFAVQ--PTNDSMVLGDVFLSSAYVVFDLDNYKISLAQANWNA 351

>Suva_9.187 Chr9 (310921..311922) [1002 bp, 333 aa] {ON} YIL015W
           (REAL)
          Length = 333

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 26/46 (56%), Gaps = 2/46 (4%)

Query: 398 GYCVSNIQGLELDESWILGAVFLKDKYAVFDVQNQQFGLANKNENA 443
           GYC   +Q    ++S +LG VFL   Y VFD+ N +  LA  N NA
Sbjct: 98  GYCGFAVQ--PTNDSMVLGDVFLSSAYVVFDLDNYKISLAQANWNA 141

>Suva_9.13 Chr9 (14409..15803) [1395 bp, 464 aa] {ON} YIR039C (REAL)
          Length = 464

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 70/299 (23%), Positives = 122/299 (40%), Gaps = 31/299 (10%)

Query: 153 DESTFSLIYSSGTASGDVYEDRIIVNKLATTQNFTFGVANEVPDIFENYPVSGIFGLPXX 212
           +E+ F++ Y+        Y   ++     T  NFTFGV+N+    +      GI G+   
Sbjct: 154 NETIFNISYADNMYYAGTYGTDVVSLGNITLSNFTFGVSNDTKMSY------GILGVSLP 207

Query: 213 XXXXXXXXXXVLSE-SNAISMEKFSLIIGALNSKDNTTSEDSALQAPLTENKGLF---II 268
                      LS  +     E F +   AL S+     E  A    L E    F   + 
Sbjct: 208 SVEETDDIEDALSSNTTPFVYENFPM---ALKSQGKI--EKIAYSLFLNEPSARFGSILF 262

Query: 269 GDLVEDLYTGDIHYASLITNENHYWQLKIDSVYVNSQAVNFSTSEAVTGSQSSYIRSGIV 328
           G + +  Y+G ++   ++   N    L    ++V +Q+     S++   + S      + 
Sbjct: 263 GAVDKSKYSGQLYTLPMLQAYNTLDAL-YSGMFVTAQSAAIIDSKSGNKTVSEVQFPVLF 321

Query: 329 DSGTTLLILPTQ--DALDLHTFFVNSVSDGTNFAIPC---NSTEILSLEINGVKWPISSE 383
           DSGT+  +LPT+  DA+   +F     SD   +   C   N+T+ LS++  G     +  
Sbjct: 322 DSGTSTSVLPTEIADAIG-RSFDGKYSSDDEGYIFDCSKVNNTQ-LSIDFGGFNISANIS 379

Query: 384 EYLGEAYPQDSYYYGYCVSNIQGLELDESWILGAVFLKDKYAVFDVQNQQFGLANKNEN 442
            ++            +CV  +Q L  D   +LG  FL D Y V+D++N +  +A  + N
Sbjct: 380 NFVTPLTKD------HCV--LQILPSDTVSVLGDAFLVDTYVVYDLENHEVSVAQASFN 430

>ZYRO0F10252g Chr6 complement(828774..830429) [1656 bp, 551 aa] {ON}
           weakly similar to YYIL015W uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 551

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 55/122 (45%), Gaps = 11/122 (9%)

Query: 327 IVDSGTTLLILPTQDALDLHTFFVNSVSDGTNF-AIPC---NSTEILSLEINGVKWPISS 382
           ++DSGTTL+ LPT  A +L        S  T +  IP    N    ++ +  G       
Sbjct: 309 LLDSGTTLMYLPTALADELAKSLGGKFSPSTGYYLIPKPSENDDTKITFDFGGFHIETKL 368

Query: 383 EEY-LGEAYPQDSYYYGYCVSNIQGLELDESWILGAVFLKDKYAVFDVQNQQFGLANKNE 441
             Y L  + PQD       +  I   E D + I G VFL D Y V+D+++ +  LA  N 
Sbjct: 369 SNYILQGSGPQD-----VAILGILRTEGDRA-IFGDVFLVDAYVVYDLEDYEISLAQANF 422

Query: 442 NA 443
           N+
Sbjct: 423 NS 424

>Ecym_4251 Chr4 complement(520455..521963) [1509 bp, 502 aa] {ON}
           similar to Ashbya gossypii AGL192W
          Length = 502

 Score = 38.5 bits (88), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 80/185 (43%), Gaps = 14/185 (7%)

Query: 259 LTENKGLFIIGDLVEDLYTGDIHYASLITNENHYWQLKIDSVYVNSQAVNFSTSEAVTGS 318
           L    G  + G +    YTG +    L+     Y   K   +++    + FS+ +   G+
Sbjct: 232 LDATSGSVLFGAVDHSKYTGTLATVPLVNVNARYGFPKPIELHITLNGLGFSSGKK-RGT 290

Query: 319 QSSYIRSGIVDSGTTLLILPTQDALDLHTFFVNSVSDGT--NFAIPCNSTEILSLEI--- 373
            S+     ++DSGTTL   PT+ A  + +  V +V +     F IPC+  +  ++++   
Sbjct: 291 ISATKVPALLDSGTTLSYFPTELAAAIASN-VGAVWNARLRKFLIPCSQAKRNNIDLIYN 349

Query: 374 -NGVKWPISSEEYLGEAYPQDSYYYGYCVSNIQGLELDESWILGAVFLKDKYAVFDVQNQ 432
             GV+       YL E   +D    G   ++   +      ILG VFL   Y V+D++  
Sbjct: 350 FGGVEITSPLVNYLSETNVEDVCLLGIVPTSSNDI------ILGDVFLTSVYTVYDLEAL 403

Query: 433 QFGLA 437
           +  +A
Sbjct: 404 EVSIA 408

>Skud_9.154 Chr9 (291885..293435) [1551 bp, 516 aa] {ON} YIL015W
           (REAL)
          Length = 516

 Score = 38.5 bits (88), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 26/46 (56%), Gaps = 2/46 (4%)

Query: 398 GYCVSNIQGLELDESWILGAVFLKDKYAVFDVQNQQFGLANKNENA 443
           GYC   +Q    ++S +LG VFL   Y VFD+ N +  LA  N NA
Sbjct: 356 GYCGFAVQ--PTNDSMVLGDVFLSSAYVVFDLDNYKISLAQANWNA 399

>Smik_12.187 Chr12 complement(370001..371524) [1524 bp, 507 aa] {ON}
           YLR121C (REAL)
          Length = 507

 Score = 37.4 bits (85), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 82/359 (22%), Positives = 140/359 (38%), Gaps = 40/359 (11%)

Query: 98  SNTQAYF-VNVTIGDEIYPLVV--DSGSAYLWVYGX----XXXXXXXXXXXLF--STDNV 148
           +N Q+++ V + IG     L V  D+GSA LWV G                +F  S  + 
Sbjct: 57  ANEQSFYSVELAIGTPSQNLTVLLDTGSADLWVPGKGNPYCGSVMDCDQYGVFDKSKSST 116

Query: 149 KRAADESTFSLIYSSGT-ASGDVYEDRIIVNKLATTQNFTFGVANEVPDIFENYPVSGIF 207
            +A   S F   Y  GT A G   +D++  N L  +    F VANE    F      G+ 
Sbjct: 117 FKANKSSPFYAAYGDGTFAEGAFGQDKLKYNNLDLS-GLPFAVANESNSTF------GVL 169

Query: 208 GLPXXXXXXXXXXXXVLSESNAISMEKFSLIIGALNSKDNTTSEDSALQAPLTENKGLFI 267
           G+              + +  +   + F L +    + D T    S      ++  G  +
Sbjct: 170 GIGLSTLEVTYSGKVAVMDKRSYEYDNFPLFLKHSGAIDATAY--SLFLNDESQASGSIL 227

Query: 268 IGDLVEDLYTGDIHYASLI---TNENHYWQLKIDSVYVNSQAVNFSTSEAVTGSQSSYIR 324
            G +    Y G ++   L+    ++ +   +  D   V  Q +   T +  T   ++   
Sbjct: 228 FGAVDHSKYEGQLYTIPLVNMYKSQGYQHPVAFD---VTLQGLGLQTDKRNTTLTTTKFP 284

Query: 325 SGIVDSGTTLLILPTQDALDLHTFFVNSVSDGT----NFAIPC--NSTEILSLEINGVKW 378
           + ++DSGTTL  LP+Q A+ L    +N+    T     +  P   N T I + +  G + 
Sbjct: 285 A-LLDSGTTLTYLPSQ-AVALLAKSLNASYSKTLGYYEYTCPSSDNKTSI-AFDFGGFRI 341

Query: 379 PISSEEYLGEAYPQDSYYYGYCVSNIQGLELDESWILGAVFLKDKYAVFDVQNQQFGLA 437
                ++  +         G C   +     + + ILG  FL++ Y V+D+ N +  LA
Sbjct: 342 NAPLSDFTMQT------SVGTCALALIPQAGNATAILGDSFLRNAYVVYDLDNYEISLA 394

>NCAS0A12460 Chr1 complement(2461028..2462650) [1623 bp, 540 aa]
           {ON} Anc_7.182
          Length = 540

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 56/122 (45%), Gaps = 15/122 (12%)

Query: 327 IVDSGTTLLILPTQDALDLHTFFVNSV--SDGTNFAIPCNSTEILS-----LEINGVKWP 379
           ++DSGTTL+  P + A D+   F+N+    D   + + C + E L+      +  GV+  
Sbjct: 300 LLDSGTTLMGAPKEIA-DMMADFMNATFSEDEGIYIMECPTKETLANTDYIFDFGGVQIK 358

Query: 380 ISSEEYLGEAYPQDSYYYGYCVSNIQGLELDE-SWILGAVFLKDKYAVFDVQNQQFGLAN 438
           +    ++  A  +     G C      L  D  + +LG +FL   Y VFD+ N Q  LA 
Sbjct: 359 VPLSNFILSAQSEG----GPC--GFAVLPDDSNTMVLGDIFLSSAYVVFDLDNYQISLAA 412

Query: 439 KN 440
            N
Sbjct: 413 AN 414

>Suva_34.1 Chr34 complement(13..1176) [1164 bp, 387 aa] {ON} YIR039C
           (REAL)
          Length = 387

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 71/299 (23%), Positives = 123/299 (41%), Gaps = 31/299 (10%)

Query: 153 DESTFSLIYSSGTASGDVYEDRIIVNKLATTQNFTFGVANEVPDIFENYPVSGIFGLPXX 212
           +E+ F++ Y   +     +   I+     T  NFTFGV+N   D   N    GI G+   
Sbjct: 4   NETIFNITYDDNSYYAGTFGTDIVSLGDITLSNFTFGVSN---DTTIN---GGILGISLP 57

Query: 213 XXXXXXXXXXVLSE-SNAISMEKFSLIIGALNSKDNTTSEDSALQAPLTENKGLF---II 268
                      LS  +   + + F + +     K+    E  A    L E    F   + 
Sbjct: 58  SAEITDSGQGALSSNTTPFAYDNFPMAL-----KNQGKIEKIAYSLFLNEPNARFGSILF 112

Query: 269 GDLVEDLYTGDIHYASLITNENHYWQLKIDSVYVNSQAVNFSTSEAVTGSQSSYIRSGIV 328
           G + +  YTG ++   ++   N    L    + V +Q+V    S +   + S      + 
Sbjct: 113 GAVDKSKYTGQLYTLPMLQAYNTLDALG-GGMLVTAQSVAILDSISGNKTVSEVQFPVLF 171

Query: 329 DSGTTLLILPTQ--DALDLHTFFVNSVSDGTNFAIPC---NSTEILSLEINGVKWPISSE 383
           DSGT+  +LPT+  DA+   +F     SD   +   C   N+T+ LS++  G     +  
Sbjct: 172 DSGTSTSVLPTEIADAIG-RSFDGKYSSDDEGYIFDCSKVNNTQ-LSIDFGGFNISANIS 229

Query: 384 EYLGEAYPQDSYYYGYCVSNIQGLELDESWILGAVFLKDKYAVFDVQNQQFGLANKNEN 442
            ++     +D     +CV  +Q L  D   +LG  FL D Y V+D+++ +  +A  + N
Sbjct: 230 NFV-TPLTKD-----HCV--LQILPSDTVSVLGDAFLVDTYVVYDLESHEVSVAQASFN 280

>ZYRO0F10274g Chr6 complement(831057..832775) [1719 bp, 572 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 572

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 57/221 (25%), Positives = 92/221 (41%), Gaps = 31/221 (14%)

Query: 223 VLSESNAISMEKFSLIIGALNSKDNTTSEDSALQAPLTENKGLFIIGDLVEDLYTGDIHY 282
           VL    AI+   +SL + +L++                 + G  + G +    Y GD++ 
Sbjct: 276 VLKSKGAINKAAYSLFLNSLDA-----------------SSGDILFGAVDRSKYKGDLYT 318

Query: 283 ASLITNENHYWQLKIDSVYVNSQAVNFSTSEAVTGSQSSYIRSGIVDSGTTLLILPTQDA 342
             L+ ++   ++  ++   V  Q V F+   + T   ++ I + ++DSGT+L+ LP  DA
Sbjct: 319 LPLLNSDPTKYKNPME-FDVTLQGVGFTNGSSKTTFTTTKIPA-LLDSGTSLIYLP--DA 374

Query: 343 LD---LHTFFVNSVSDGTNFAIPC---NSTEILSLEINGVKWPISSEEYLGEAYPQDSYY 396
           L     H    +   D   + I C   N    L  +  G     +   YL    P D   
Sbjct: 375 LAKGIAHKLGGSYNEDIGYYVIGCPSENDDSQLVFDFGGFTIKNNLSNYL-LGSPDDGDD 433

Query: 397 YGYCVSNIQGLELDESWILGAVFLKDKYAVFDVQNQQFGLA 437
              CV  I  L  D   ILG VFL D Y V+D+ + +  LA
Sbjct: 434 -SQCVLGI--LPSDVQAILGDVFLADAYVVYDLDDYEVSLA 471

>Smik_9.175 Chr9 (296875..298656) [1782 bp, 593 aa] {ON} YIL015W
           (REAL)
          Length = 593

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 2/43 (4%)

Query: 398 GYCVSNIQGLELDESWILGAVFLKDKYAVFDVQNQQFGLANKN 440
           GYC   +Q    ++S +LG VFL   Y VFD+ N +  LA  N
Sbjct: 356 GYCGFAVQ--PTNDSMVLGDVFLSSAYVVFDLDNYKISLAQAN 396

>ZYRO0D15554g Chr4 complement(1298587..1300152) [1566 bp, 521 aa]
           {ON} weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 521

 Score = 35.4 bits (80), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 45/203 (22%), Positives = 79/203 (38%), Gaps = 41/203 (20%)

Query: 255 LQAPLTENKGLFIIGDLVEDLYTGDIHYASLITNENHYWQLKIDSVYVNSQAVNFSTSEA 314
           L  P     G  + G +    Y+GD++   +    N Y  +      +      F   + 
Sbjct: 216 LNDPNGSGGGSVLFGGVDPSKYSGDLYTFPM---ANQYPNIVSKPATLAVTLQGFGAQKK 272

Query: 315 VTGSQSSYIRSG---IVDSGTTLLILPTQDALDLHTFFVN-----SVSDGTNFAIPC--- 363
             G Q ++  +    ++DSGT+L+  P ++ +     F+N     S  DG  + + C   
Sbjct: 273 SEGRQETFDTNNYAVLLDSGTSLMGAP-EEVVSKMAHFINKNARFSEDDGI-YVMDCPPK 330

Query: 364 -NSTEI--------LSLEINGVKWPISSEEYLGEAYPQDSYYYGYCVSNIQGLELDESWI 414
            + TE         +++ ++ +  P S E Y G                +  L  D +W 
Sbjct: 331 DDDTEFVFDFGDLQIAVPVSTLILPPSGESYCG----------------LGVLPKDGTWT 374

Query: 415 LGAVFLKDKYAVFDVQNQQFGLA 437
           LG VFL   Y VFD+ N +  +A
Sbjct: 375 LGDVFLSYAYLVFDLDNYKVSMA 397

>Suva_79.1 Chr79 complement(1..681) [681 bp, 227 aa] {ON} YIR039C
           (REAL)
          Length = 227

 Score = 34.3 bits (77), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 54/124 (43%), Gaps = 31/124 (25%)

Query: 327 IVDSGTTLLILPTQ--DALDLHTFFVNSVSDGTNFAIPCNSTE--ILSLEINGVK----- 377
           + DSGT+   LPT+  DA+   +F     SD   +   C+     +LS++  G       
Sbjct: 119 LFDSGTSTSALPTEIADAIG-RSFDGKYSSDNQGYIFDCSKVNNTLLSIDFGGFNISANI 177

Query: 378 ----WPISSEEYLGEAYPQDSYYYGYCVSNIQGLELDESWILGAVFLKDKYAVFDVQNQQ 433
                PI+ +               +C+ NI+    D  ++LG  FL D Y VFD+++ +
Sbjct: 178 SNSVTPITKD---------------HCLLNIEAD--DSGYVLGDAFLIDTYVVFDLESHE 220

Query: 434 FGLA 437
             +A
Sbjct: 221 VSVA 224

>CAGL0E01727g Chr5 (171119..172738) [1620 bp, 539 aa] {ON} similar
           to uniprot|P32329 Saccharomyces cerevisiae YLR120c YAP3
           or uniprot|Q12303 Saccharomyces cerevisiae YLR121c YPS3
           or uniprot|P53379 Saccharomyces cerevisiae YDR144c MKC7
          Length = 539

 Score = 34.3 bits (77), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 65/132 (49%), Gaps = 24/132 (18%)

Query: 327 IVDSGTTLLILPTQDALDLHTFFVNSVSDGTNFAIP---C-NSTEILSLEIN--GVKWPI 380
           ++D+GTTL   P Q  +D+    VN   D     I    C N+ +   L  N  G + P+
Sbjct: 306 LLDTGTTLAYAPKQ-VVDVIAKRVNGTIDSKTGGIKLKKCPNAKDNSELIFNFAGAEIPV 364

Query: 381 S----SEEYLGEAYPQDSYYYGYCVSNIQGLELDES-WILGAVFLKDKYAVFDVQNQQ-- 433
           S     E+  G+ Y +  Y+           EL ++  +LG +F++  Y+VF++++ +  
Sbjct: 365 SLLNMVEKRKGKCYLEIRYHE----------ELSKTGMLLGDIFMRHVYSVFNMEDMEVS 414

Query: 434 FGLANKNENAIL 445
           F +AN N++A L
Sbjct: 415 FAVANGNDSAPL 426

>KNAG0I00910 Chr9 (171104..172813) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 34.3 bits (77), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 63/133 (47%), Gaps = 18/133 (13%)

Query: 317 GSQSSYIRSGI---VDSGTTLLILPTQDALDLHTFFVNSVSDGTN--FAIPCN---STEI 368
           GSQS+   + I   +DSGTT+   P Q A ++   F N+  D  +  + + C+   S   
Sbjct: 336 GSQSTIATTTIPALLDSGTTISYFPAQLANEIARKF-NATYDSRSGFYTMSCSYDTSNTN 394

Query: 369 LSLEINGVKWPISSEEYLGEAYPQDSYYYGYCVSNIQGLELDESWI-LGAVFLKDKYAVF 427
           L  +  G       ++++ +   Q       CV  I   +  E+W+ LG VFL + Y V+
Sbjct: 395 LVFDFGGFHITAPLDDFVVQQSSQT------CVLAIGPQQ--ENWVVLGDVFLSNAYVVY 446

Query: 428 DVQNQQFGLANKN 440
           D++N +  +A  N
Sbjct: 447 DLENLEVSMAQAN 459

>TBLA0D04580 Chr4 complement(1133223..1134410) [1188 bp, 395 aa]
           {ON} Anc_7.182 YIL015W
          Length = 395

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 40/183 (21%), Positives = 80/183 (43%), Gaps = 29/183 (15%)

Query: 276 YTGDIHYASLI------TNENHYWQLKIDSVYV---NSQAVNFSTSEAVTGSQSSYIRSG 326
           Y GD+H   ++      T++   + + +DS+Y+   N+Q+ N   S     +   Y  S 
Sbjct: 214 YIGDLHNFPMVNQYPNVTDKPATFAITLDSMYISMDNNQSDNIYIS-----NDEKY--SV 266

Query: 327 IVDSGTTLLILPTQDALDLHTFFVNSVSDGTNFAIPCNSTE-------ILSLEINGVKWP 379
           ++DSGT+LL  P      +      +  + T+  +  + T+       I++ +      P
Sbjct: 267 VLDSGTSLLSAPDHYVSKIAGLLNATFDNTTHMYLLPSETDLTLYKDMIINFKFMDFNVP 326

Query: 380 ISSEEYLGEAYPQDSYYYGYCVSNIQGLELDESWILGAVFLKDKYAVFDVQNQQFGLANK 439
           I+  E++    P D     Y  + +    ++  ++LG +FL   Y +F++ N    L   
Sbjct: 327 INMLEFI---LPYDD---SYVFAILPTKNVNTGFVLGDIFLPHVYTIFNLDNYTISLGLS 380

Query: 440 NEN 442
           N+N
Sbjct: 381 NQN 383

>KAFR0B05710 Chr2 complement(1177594..1179321) [1728 bp, 575 aa]
           {ON} Anc_8.318 YLR120C
          Length = 575

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 45/198 (22%), Positives = 79/198 (39%), Gaps = 38/198 (19%)

Query: 260 TENKGLFIIGDLVEDLYTGDIHYASLI---TNENHYWQLKIDSVYVNSQAVNFSTSEAVT 316
           ++  G  + G +    Y+G ++   ++    +E +   L+ D   V    +  STS++ T
Sbjct: 297 SDTTGNLLFGAVDHSKYSGSLYTLPIVNVYASEGYKNPLEFD---VTMYGLGISTSDSNT 353

Query: 317 GSQSSYIRSGIVDSGTTLLILPT--------------QDALDLHTFFVNSVSDGTNFAIP 362
              +  I + ++DSGTT++  P                D L  +     S SD T F   
Sbjct: 354 TIATMKIPA-LLDSGTTIVYFPETLLELVADQLGASYSDELGFYAMSCVSSSDDTEFVFD 412

Query: 363 CNSTEILSLEINGVKWPISSEEYLGEAYPQDSYYYGYCVSNIQGLELDESWILGAVFLKD 422
                I ++ ++     +S  E +     QD                DES ILG  FL +
Sbjct: 413 FGGFHI-TVPLSDFLIRVSGSECILAMAAQD----------------DESIILGDYFLTN 455

Query: 423 KYAVFDVQNQQFGLANKN 440
            Y V+D++N +  +A  N
Sbjct: 456 AYVVYDLENYEISMAQAN 473

>NCAS0B03560 Chr2 complement(629374..631134) [1761 bp, 586 aa] {ON} 
          Length = 586

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 51/232 (21%), Positives = 87/232 (37%), Gaps = 49/232 (21%)

Query: 223 VLSESNAISMEKFSLIIGALNSKDNTTSEDSALQAPLTENKGLFIIGDLVEDLYTGDIHY 282
           +L +S AI    +SL +  L++K     + S L   +   K        V +LYT  +  
Sbjct: 289 LLKQSGAIDSTSYSLFLDDLDAK-----QGSVLFGAVDHTK-------YVGNLYT--VPM 334

Query: 283 ASLITNENHYWQLKIDSVYVNSQAVNFSTSEAVTGSQSSYIRSGIVDSGTTLLILPTQ-- 340
            +++ ++ +   ++ D         N S +  VT ++       ++DSGTT+   P +  
Sbjct: 335 VNILASKGYPNPIQFDVTLAGIGIQNDSKNYTVTTNK----FPALLDSGTTISYFPQEVV 390

Query: 341 ------------DALDLHTFFVNSVSDGTNFAIPCNSTEILSLEINGVKWPISSEEYLGE 388
                        AL  +    N VS  TNF        I    ++    P S    +  
Sbjct: 391 QTIARQLGARYSSALGFYAMSCNGVSSSTNFVFDFGGFHITG-PVSDFLLPTSGNTCVLA 449

Query: 389 AYPQDSYYYGYCVSNIQGLELDESWILGAVFLKDKYAVFDVQNQQFGLANKN 440
             PQ+S                +  +LG +FL   Y V+D+ N +  LA  N
Sbjct: 450 MAPQES----------------QHILLGDIFLTHAYVVYDLDNYEISLAQAN 485

>KNAG0B02860 Chr2 (552295..552975) [681 bp, 226 aa] {ON} Anc_7.301
           YDL186W
          Length = 226

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 41/98 (41%), Gaps = 8/98 (8%)

Query: 304 SQAVNFSTSEAVTGS------QSSYIRSGIVDSGTTLLILPTQDALDLHTFFVNSVSDGT 357
           SQ  N + S+   GS       S Y+   +   G + ++LP +D+  L T   N  +  T
Sbjct: 78  SQVDNETHSQLPQGSGKWYKENSEYLLRQLPSGGFSDVVLPDEDSFVLPT--SNPATTAT 135

Query: 358 NFAIPCNSTEILSLEINGVKWPISSEEYLGEAYPQDSY 395
            FAIP   TE   +E     + +      G+   QD Y
Sbjct: 136 PFAIPAPDTETAGIEKPKEAYKLKDNNARGKPLHQDPY 173

>ZYRO0F10318g Chr6 complement(835672..837132) [1461 bp, 486 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 486

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 52/118 (44%), Gaps = 17/118 (14%)

Query: 327 IVDSGTTLLILPT----QDALDLHTFFVNSVSDGTNFAIPC---NSTEILSLEINGVKWP 379
           ++DSGTTL+ LP     Q A  L   +    S+ + + + C   N    L L+  G +  
Sbjct: 324 LLDSGTTLMTLPRPVTDQMAKQLGATYN---SETSYYQLKCPSQNDNTRLILDFGGFQVN 380

Query: 380 ISSEEYLGEAYPQDSYYYGYCVSNIQGLELDESWILGAVFLKDKYAVFDVQNQQFGLA 437
                ++  +        G C+  I   + D S  LG VFL D Y V+D+ N +  LA
Sbjct: 381 AKITNHITRSQ------NGECLLGITPSDTD-SGTLGDVFLVDAYVVYDLDNYEISLA 431

>KLLA0D15917g Chr4 complement(1336727..1338262) [1536 bp, 511 aa]
           {ON} some similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease
          Length = 511

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 81/186 (43%), Gaps = 27/186 (14%)

Query: 264 GLFIIGDLVEDLYTGDIHYASLITNENHYWQLKIDSVY-VNSQAVNFSTSEAVTGSQSSY 322
           G  + G + E  Y G ++   L+   N Y Q+   + + +  Q +   +      +  ++
Sbjct: 234 GTVLFGGIDEKKYDGVLYTLPLV---NIYEQIDEPAAFDITLQGLGIRSESNCKDTVIAH 290

Query: 323 IRS-GIVDSGTTLLILPTQDALD-----LHTFFVNSVSDGTNFAIPC---NSTEILSLEI 373
            ++  ++DSG+T++  P Q+AL+     L   F  S SDG  + + C   N       + 
Sbjct: 291 KKAPALLDSGSTIMGAP-QEALESIAQELGAAF--SESDGL-YVLDCPASNDDRTFYFDF 346

Query: 374 NGVKW--PISSEEYLGEAYPQDSYYYGYCVSNIQGLELDESWILGAVFLKDKYAVFDVQN 431
             +K   PI    YL E+         YC   I  +   E WILG + LK  Y V+D+ N
Sbjct: 347 GELKLKVPIHDLLYLPESG------QNYCGLAI--IASGEEWILGDLVLKSAYVVYDLDN 398

Query: 432 QQFGLA 437
            +  +A
Sbjct: 399 LEISIA 404

>TDEL0E02230 Chr5 (427831..429552) [1722 bp, 573 aa] {ON} Anc_5.401
           YDR349C
          Length = 573

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 48/233 (20%), Positives = 95/233 (40%), Gaps = 40/233 (17%)

Query: 230 ISMEKFSLIIGALNSKDNTTSEDSALQAPLTENKGLFIIGDLVEDLYTGDIHYASLI--- 286
           I    +SL  GA    D    +   L +    + G  I+G +   LYTG +    +I   
Sbjct: 205 IKTPSYSLWFGA----DTVPYDRRKLASGTMADCGKLILGAVDPSLYTGILRSFKMIPFI 260

Query: 287 -----TNENHYWQLKIDSVYVNS---QAVNFSTSEAVTGSQSSYIRSGIVDSGTTLLILP 338
                   N+Y  L + ++Y+NS   +++N ++ E        ++   ++DS  +   LP
Sbjct: 261 DPVSQAQSNNYPILPLGTIYINSANGKSLNMTSEE--------FVEPVLLDSRYSTTYLP 312

Query: 339 ----TQDALDLHTFFVNSVSDGTNFAIPCNSTEI---LSLEINGVKWPISSEEYLGEAYP 391
                Q A+ +   FV S+     + + C+  ++   L      ++  +  E++L   Y 
Sbjct: 313 IDAIVQIAVQIGATFVESLD---KWLVACSVAKLDVSLDFTFGNIEIRVPLEDFLVTTYD 369

Query: 392 QDS-----YYYGYCVSNIQGLELDESW--ILGAVFLKDKYAVFDVQNQQFGLA 437
             S     +  G     +  +  D++   +LG  FLK+ Y   D+++    +A
Sbjct: 370 PKSNTSLHFSTGEEACFLAMVSKDKTGYNVLGGPFLKNLYMAVDIEDSSIAIA 422

>KLTH0H05632g Chr8 (499881..501227) [1347 bp, 448 aa] {ON} similar
           to uniprot|P07286 Saccharomyces cerevisiae YBR243C ALG7
           UDP-N-acetyl-glucosamine-1-P transferase transfers
           Glc-Nac-P from UDP-GlcNac to Dol-P in the ER in the
           first step of the dolichol pathway of protein
           asparagine-linked glycosylation inhibited by tunicamycin
          Length = 448

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 68/155 (43%), Gaps = 25/155 (16%)

Query: 317 GSQSSYIRSGIVDSGTTLLILPTQDALDL---HTFFVNSVSDGTNFAIPCNSTEILSLEI 373
           G  S Y+ S ++   +T+L+    D  DL   H FF+ +V+     AIP      +   +
Sbjct: 122 GKMSEYL-SAVLCLQSTVLLGIADDLFDLRWRHKFFLPAVA-----AIPLLVVYYVDFGV 175

Query: 374 NGVKWPISSEEYLGEA---YPQDSYYYGY-------C------VSNIQGLELDESWILGA 417
             V  P   + +LG +   +   + YY Y       C      ++ + GLE+ +S +LG 
Sbjct: 176 THVLIPDVIQRWLGTSKTIFNLGALYYVYMASMAIFCPNSINILAGVNGLEVGQSIVLGV 235

Query: 418 VFLKDKYAVFDVQNQQFGLANKNENAILVPYVNSA 452
           +FL +      + N+    A+     +++P++  A
Sbjct: 236 IFLINDSLYLLLGNEASKEAHLFSAILIIPFLGVA 270

>Kwal_47.17894 s47 (597826..599691) [1866 bp, 621 aa] {ON} YHR114W
           (BZZ1) - Myo3/5p-Bee1p-Vrp1p actin assembly complex
           component [contig 204] FULL
          Length = 621

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 57/129 (44%), Gaps = 20/129 (15%)

Query: 4   KNGIRSGVFRLIILITYIFNLTFVQAFYPCSGERYLSAGSAFKVESKNSKYAAQFVNIND 63
           K G +SGVF       +   LT      P   ER  SA S F  ESK  K+  +F     
Sbjct: 410 KAGKKSGVFN-----RFKKTLTISSDKKPTQAERTDSA-SVFSSESK-GKHHNRF----- 457

Query: 64  ALSKQALQGQATAKSSTKNVEVPVKPGMSILSTDSNTQAYF--------VNVTIGDEIYP 115
           +L K   + Q+ A   ++ V       ++ + +++NT  Y         V+++ GD I  
Sbjct: 458 SLFKSRDRAQSNASGLSEAVSSDYSSSVAPMESNTNTVLYLYQKQDDDEVSISPGDPITL 517

Query: 116 LVVDSGSAY 124
           LV D+GS +
Sbjct: 518 LVADTGSGW 526

>CAGL0E01749g Chr5 complement(172875..174323) [1449 bp, 482 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 482

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 26/45 (57%)

Query: 398 GYCVSNIQGLELDESWILGAVFLKDKYAVFDVQNQQFGLANKNEN 442
           G C   +Q  +  E   LG +FL+  Y V+++++++  +AN N N
Sbjct: 373 GKCYLQMQARDDIEFAALGDIFLRHVYVVYNLEDEEISIANANFN 417

>YGL082W Chr7 (355827..356972) [1146 bp, 381 aa] {ON} Putative
           protein of unknown function; predicted
           prenylation/proteolysis target of Afc1p and Rce1p; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; YGL082W is not an essential
           gene
          Length = 381

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query: 275 LYTGDIHYASLITNENHYWQLKIDSVYVNSQAVNFSTSEAVTGSQSSY 322
           L+  D H+ +L  N    + L  D  Y N + +N+ + ++V GSQ SY
Sbjct: 211 LFRND-HFCTLYKNNGELFTLVTDPTYRNRKDINWQSLKSVNGSQDSY 257

>Kwal_23.5110 s23 (1016158..1019688) [3531 bp, 1176 aa] {ON} YPL006W
           (NCR1) - predicted transmembrane protein [contig 7] FULL
          Length = 1176

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 52/119 (43%), Gaps = 17/119 (14%)

Query: 11  VFRLIILITYIFNLTFVQAFYPCSGERYLSAGSAFKVESKNSKYAAQFVNINDALSKQAL 70
            F  +ILITY+    F+ A++      Y   G    +  ++ +   + ++IND L ++  
Sbjct: 265 CFSFVILITYLVLFAFILAWHI----HYFRKGKGHSLVEQDIE-EREVIDINDCLFQE-- 317

Query: 71  QGQATAKSSTKNVEVPVKPGMSILSTDSNTQAYFVNVTIGDEIYPLVVDSGSAYLWVYG 129
                    T  ++  V  G+ +LST S     FV V        L+V   +A+ WV+G
Sbjct: 318 -----HTYRTYKLDEKVADGIGLLSTFSYKNPVFVLVGTS-----LLVILMTAFAWVFG 366

>NDAI0J01030 Chr10 (235967..237925) [1959 bp, 652 aa] {ON} 
          Length = 652

 Score = 31.6 bits (70), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 67/306 (21%), Positives = 116/306 (37%), Gaps = 52/306 (16%)

Query: 155 STFSLIYSSGT-ASGDVYEDRIIVNKLATTQNFTFGVANE-----------VPDIFENYP 202
           ++FS+ Y   T ASG   +D + ++ L  T   +F VAN            +P +   Y 
Sbjct: 263 TSFSISYGDSTFASGTWAQDVLNLSDLNVT-GLSFAVANMTNSTVGVLGIGLPALESTY- 320

Query: 203 VSGIFGLPXXXXXXXXXXXXVLSESNAISMEKFSLIIGALNSKDNTTSEDSALQAPLTEN 262
            SG  G              VL +S AI    +SL +  L+                 E+
Sbjct: 321 -SGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLDDLD-----------------ES 362

Query: 263 KGLFIIGDLVEDLYTGDIHYASLIT---NENHYWQLKIDSVYVNSQAVNFSTSEAVTGSQ 319
            G  + G +    YTG ++   +I    N  +   ++ D         N   +  +T ++
Sbjct: 363 HGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGERNLTLTTTK 422

Query: 320 SSYIRSGIVDSGTTLLILPTQDALDLHTFFVNSVSDGTN--FAIPCNSTEI---LSLEIN 374
                + ++DSGTT+   PT   ++L    +N+        + +PC S      L  +  
Sbjct: 423 ----LAALLDSGTTISYFPT-SVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDFG 477

Query: 375 GVKWPISSEEYLGEAYPQDSYYYGYCVSNIQGLELDESWILGAVFLKDKYAVFDVQNQQF 434
           G       +++L +   Q       C+  +   E  +  ILG +FL   Y V+D+ N   
Sbjct: 478 GFHISGPLQDFLIQTSQQT------CILAMAPQE-SQHVILGDIFLTHAYVVYDLDNYVI 530

Query: 435 GLANKN 440
            LA  +
Sbjct: 531 ALAQAD 536

>KAFR0D04990 Chr4 (981180..982868) [1689 bp, 562 aa] {ON} Anc_5.419
           YHR109W
          Length = 562

 Score = 31.2 bits (69), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 293 WQLKIDSVYVNSQAVNFSTSEAVTGSQSSYIRSGI-VDSGTTLLILPTQDALDLHT 347
           W LK   +++N   V   T ++  G    +IR    +D+ T LL +P Q A+++HT
Sbjct: 7   WVLKNSKIFLNDNVV---TGKSNLGGSGLFIRGDTTIDADTILLRIPPQCAINIHT 59

>AGR240W Chr7 (1200736..1202094) [1359 bp, 452 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL015W (BAR1)
          Length = 452

 Score = 30.8 bits (68), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 21/32 (65%)

Query: 411 ESWILGAVFLKDKYAVFDVQNQQFGLANKNEN 442
           E++ LG  FLK+ Y VF++++ +  +A  N N
Sbjct: 362 ETFALGIPFLKEVYTVFNLEDNEISMARANTN 393

>Suva_10.212 Chr10 complement(396611..398848) [2238 bp, 745 aa] {ON}
           YLR121C (REAL)
          Length = 745

 Score = 31.2 bits (69), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 79/359 (22%), Positives = 138/359 (38%), Gaps = 38/359 (10%)

Query: 98  SNTQAYF-VNVTIG--DEIYPLVVDSGSAYLWV------YGXXXXXXXXXXXXLFSTDNV 148
           SN Q+++ V + +G   +   +++D+GSA LWV      Y               +  + 
Sbjct: 58  SNEQSFYSVELALGTPSQNVTVLLDTGSADLWVPSNANPYCGSAMNCDQYGVFDKANSST 117

Query: 149 KRAADESTFSLIYSSGT-ASGDVYEDRIIVNKLATTQNFTFGVANEVPDIFENYPVSGIF 207
             A   + F   Y  GT A G   +D++  +        +F VAN+      N  V G+ 
Sbjct: 118 FTANHSAPFYASYGDGTFAEGVFGQDKLHYSGGLDLSGLSFAVANK-----SNSTV-GVL 171

Query: 208 GLPXXXXXXXXXXXXVLSESNAISMEKFSLIIGALNSKDNTTSEDSALQAPLTENKGLFI 267
           G+              +++  +   + F L +    + D T    S      T+  G  +
Sbjct: 172 GIGLPMLEVTYSGKVAVADKRSYQYDNFPLFLKRSGAIDATAY--SLFLNDETQTSGSVL 229

Query: 268 IGDLVEDLYTGDIHYASLITNENHYWQLKIDSVYVNSQAVNFSTSEAVTGSQSSYIRSGI 327
            G +    Y G ++   L+         +  +  V  Q +   T    T   ++ I + +
Sbjct: 230 FGAVDHSKYLGQLYTIPLVNLYKAQGYQRPVAFDVTLQGLGLQTRAHNTTLTTTRIPA-L 288

Query: 328 VDSGTTLLILPTQDALDLHTFFVNSVSDGT----NFAIPC---NSTEILSLEING--VKW 378
           +DSGTTL  LP  DA+ L    +N+          +A P    N+T ++  ++ G  +  
Sbjct: 289 LDSGTTLTYLPA-DAVALMAKSLNATFSKELGYYEYACPTSGDNATSVV-FDLGGFHINA 346

Query: 379 PISSEEYLGEAYPQDSYYYGYCVSNIQGLELDESWILGAVFLKDKYAVFDVQNQQFGLA 437
           P+S                G CV  I     + + ILG  FL+  Y V+D+ N +  LA
Sbjct: 347 PLSDFTMQTNV--------GTCVLAIVPQAGNATAILGDSFLRSAYVVYDLDNYEVSLA 397

>ZYRO0D01848g Chr4 complement(148657..150621) [1965 bp, 654 aa] {ON}
           similar to uniprot|P32569 Saccharomyces cerevisiae
           YER022W SRB4 subunit of RNA polymerase II
           holoenzyme/mediator complex
          Length = 654

 Score = 30.8 bits (68), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 30/48 (62%), Gaps = 2/48 (4%)

Query: 286 ITNENHYWQLKIDSVYVNSQAVNFSTSEAVTGSQSSYIRSGIVDSGTT 333
           + NE+ YW+ KI S Y++++ V F   +  TG +S  ++ G  DSG+T
Sbjct: 276 LKNEHRYWK-KI-SQYISNKDVIFKLRDKSTGLRSLGVKYGYEDSGST 321

>Kwal_14.1615 s14 (391651..393003) [1353 bp, 450 aa] {ON} YBR243C
           (ALG7) - UDP-N-acetyl-glucosamine-1-P transferase (GPT)
           [contig 238] FULL
          Length = 450

 Score = 30.8 bits (68), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 66/155 (42%), Gaps = 25/155 (16%)

Query: 317 GSQSSYIRSGIVDSGTTLLILPTQDALDL---HTFFVNSVSDGTNFAIPCNSTEILSLEI 373
           G  S Y+ S ++   +T+L+    D  DL   H FF+ ++S     AIP      +   +
Sbjct: 124 GKMSEYL-SAVLCLQSTVLLGVADDLFDLRWRHKFFLPAIS-----AIPLLIVYYVDFGV 177

Query: 374 NGVKWPISSEEYLGEAYPQ---DSYYYGY-------C------VSNIQGLELDESWILGA 417
             V  P   + ++G +         YY Y       C      ++ + GLE+ +S +LG 
Sbjct: 178 THVLIPEVVKTWIGTSKTSIDLGVLYYAYMGSMAIFCPNSINILAGVNGLEVGQSIVLGV 237

Query: 418 VFLKDKYAVFDVQNQQFGLANKNENAILVPYVNSA 452
           +FL +      + N+    A+     +++P++  A
Sbjct: 238 IFLMNDSLYLLLGNEASKEAHLFSAILIIPFLGVA 272

>Kwal_26.7665 s26 complement(463924..465579) [1656 bp, 551 aa] {ON}
           YKL124W (SSH4) - (putative) involved in ER functions
           [contig 55] FULL
          Length = 551

 Score = 30.8 bits (68), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 31/71 (43%), Gaps = 5/71 (7%)

Query: 317 GSQSSYIRSGIVDS----GTTLLILPTQDALD-LHTFFVNSVSDGTNFAIPCNSTEILSL 371
           G QS Y    I D+    G  L     QD LD L T F  S S   N+ +P N  E +  
Sbjct: 199 GVQSYYFLPSINDNVDHYGNFLPSFIVQDKLDVLFTKFNRSASTIMNYPLPQNKKEAVYF 258

Query: 372 EINGVKWPISS 382
           E+   K+P  S
Sbjct: 259 EVKVFKFPAKS 269

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,415,583
Number of extensions: 1996132
Number of successful extensions: 6000
Number of sequences better than 10.0: 124
Number of HSP's gapped: 6085
Number of HSP's successfully gapped: 125
Length of query: 515
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 401
Effective length of database: 40,409,475
Effective search space: 16204199475
Effective search space used: 16204199475
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)