Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D01485g8.844ON1151115149870.0
ABL122C8.844ON104366611311e-135
Kwal_27.102398.844ON91468410821e-130
ZYRO0G14256g8.844ON125971710971e-129
KLTH0C03784g8.844ON99755110771e-128
TPHA0I002708.844ON103983010661e-126
TDEL0B005408.844ON111569210611e-125
SAKL0D01364g8.844ON108265310481e-123
CAGL0B02365g8.844ON105085310421e-123
Smik_13.178.844ON113181510041e-117
YML117W (NAB6)8.844ON11347349951e-115
Skud_13.248.844ON11287329671e-112
Ecym_46158.844ON10673208901e-101
KAFR0A028508.844ON10422538559e-97
NDAI0E002708.844ON11982428504e-95
Kpol_1068.58.844ON10322398302e-93
Suva_13.268.844ON11223558307e-93
TBLA0B032808.844ON13622348334e-92
KNAG0G034408.844ON10532347979e-89
NCAS0B002808.844ON10813357953e-88
AFL061C6.183ON5232064304e-44
TBLA0B052106.183ON7102014332e-43
Ecym_22336.183ON5762064273e-43
NCAS0H010406.183ON6292024142e-41
Kpol_1002.696.183ON5902054061e-40
KLLA0E19031g6.183ON6522084082e-40
NDAI0F022606.183ON6802014073e-40
TDEL0G016206.183ON5842024025e-40
SAKL0A05280g6.183ON5822054008e-40
Suva_16.1236.183ON5962013982e-39
KAFR0B066906.183ON5332013952e-39
Kwal_27.111586.183ON5672043962e-39
CAGL0C01419g6.183ON6392013974e-39
KLTH0H04906g6.183ON5692043935e-39
ZYRO0G08140g6.183ON6322023956e-39
Smik_6.3906.183ON6252013947e-39
Skud_16.946.183ON6142013947e-39
YPL184C (MRN1)6.183ON6122013938e-39
KNAG0M004306.183ON4432023812e-38
TPHA0J022106.183ON5932013761e-36
ZYRO0F07238g8.670ON3892061065e-04
Ecym_24038.670ON375252950.013
NDAI0E011908.670ON358211940.016
KAFR0A038308.670ON374210930.023
Smik_15.4268.670ON371248910.040
ACR135C8.670ON37671900.053
TDEL0A061608.670ON37873890.075
TPHA0D012108.670ON364201840.24
Kwal_55.219147.518ON264243850.32
ZYRO0C05060g6.104ON716105830.45
KLLA0C05522g6.104ON54085800.88
YOR242C (SSP2)8.670ON37171790.92
Suva_8.2928.670ON37071791.0
TBLA0C018208.670ON39471762.2
KAFR0D016608.797ON21286752.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D01485g
         (1151 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D01485g Chr4 (129351..132806) [3456 bp, 1151 aa] {ON} simil...  1925   0.0  
ABL122C Chr2 complement(167005..170136) [3132 bp, 1043 aa] {ON} ...   440   e-135
Kwal_27.10239 s27 (255440..258184) [2745 bp, 914 aa] {ON} YML117...   421   e-130
ZYRO0G14256g Chr7 complement(1136628..1140407) [3780 bp, 1259 aa...   427   e-129
KLTH0C03784g Chr3 (328834..331827) [2994 bp, 997 aa] {ON} simila...   419   e-128
TPHA0I00270 Chr9 complement(50298..53417) [3120 bp, 1039 aa] {ON...   415   e-126
TDEL0B00540 Chr2 (100637..103984) [3348 bp, 1115 aa] {ON} Anc_8....   413   e-125
SAKL0D01364g Chr4 (105477..108725) [3249 bp, 1082 aa] {ON} simil...   408   e-123
CAGL0B02365g Chr2 complement(224663..227815) [3153 bp, 1050 aa] ...   405   e-123
Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W ...   391   e-117
YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putati...   387   e-115
Skud_13.24 Chr13 (33966..37352) [3387 bp, 1128 aa] {ON} YML117W ...   377   e-112
Ecym_4615 Chr4 complement(1199802..1203005) [3204 bp, 1067 aa] {...   347   e-101
KAFR0A02850 Chr1 complement(590196..593324) [3129 bp, 1042 aa] {...   333   9e-97
NDAI0E00270 Chr5 (33295..36891) [3597 bp, 1198 aa] {ON} Anc_8.844     332   4e-95
Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp,...   324   2e-93
Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W ...   324   7e-93
TBLA0B03280 Chr2 complement(764832..768920) [4089 bp, 1362 aa] {...   325   4e-92
KNAG0G03440 Chr7 complement(736829..739990) [3162 bp, 1053 aa] {...   311   9e-89
NCAS0B00280 Chr2 (30005..33250) [3246 bp, 1081 aa] {ON} Anc_8.844     310   3e-88
AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON} S...   170   4e-44
TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa] ...   171   2e-43
Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}...   169   3e-43
NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {O...   164   2e-41
Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa] ...   160   1e-40
KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} simi...   161   2e-40
NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183    161   3e-40
TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {O...   159   5e-40
SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {...   158   8e-40
Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {...   157   2e-39
KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON} Anc_6...   156   2e-39
Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184...   157   2e-39
CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {...   157   4e-39
KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {...   155   5e-39
ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} simila...   156   6e-39
Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C ...   156   7e-39
Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {O...   156   7e-39
YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON} ...   155   8e-39
KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON...   151   2e-38
TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6....   149   1e-36
ZYRO0F07238g Chr6 complement(586327..587496) [1170 bp, 389 aa] {...    45   5e-04
Ecym_2403 Chr2 (785307..786434) [1128 bp, 375 aa] {ON} similar t...    41   0.013
NDAI0E01190 Chr5 (237093..238169) [1077 bp, 358 aa] {ON} Anc_8.6...    41   0.016
KAFR0A03830 Chr1 complement(779143..780267) [1125 bp, 374 aa] {O...    40   0.023
Smik_15.426 Chr15 complement(738453..739568) [1116 bp, 371 aa] {...    40   0.040
ACR135C Chr3 complement(585997..587127) [1131 bp, 376 aa] {ON} S...    39   0.053
TDEL0A06160 Chr1 complement(1078577..1079713) [1137 bp, 378 aa] ...    39   0.075
TPHA0D01210 Chr4 complement(253331..254425) [1095 bp, 364 aa] {O...    37   0.24 
Kwal_55.21914 s55 (1034239..1042167) [7929 bp, 2642 aa] {ON} YLR...    37   0.32 
ZYRO0C05060g Chr3 complement(397083..399233) [2151 bp, 716 aa] {...    37   0.45 
KLLA0C05522g Chr3 (494240..495862) [1623 bp, 540 aa] {ON} some s...    35   0.88 
YOR242C Chr15 complement(788742..789857) [1116 bp, 371 aa] {ON} ...    35   0.92 
Suva_8.292 Chr8 complement(527751..528863) [1113 bp, 370 aa] {ON...    35   1.0  
TBLA0C01820 Chr3 complement(429227..430411) [1185 bp, 394 aa] {O...    34   2.2  
KAFR0D01660 Chr4 (330013..330651) [639 bp, 212 aa] {ON} Anc_8.79...    33   2.4  

>KLLA0D01485g Chr4 (129351..132806) [3456 bp, 1151 aa] {ON} similar to
            uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
            Putative RNA-binding protein based on computational
            analysis of large-scale protein-protein interaction data
          Length = 1151

 Score = 1925 bits (4987), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 960/1151 (83%), Positives = 960/1151 (83%)

Query: 1    MNSGTSANHYQPSLIYGRPPVGYEQQVYDVAGRNGGSNHHPPQYIYYTHRXXXXXXXXXX 60
            MNSGTSANHYQPSLIYGRPPVGYEQQVYDVAGRNGGSNHHPPQYIYYTHR          
Sbjct: 1    MNSGTSANHYQPSLIYGRPPVGYEQQVYDVAGRNGGSNHHPPQYIYYTHRGGSMPGSIPG 60

Query: 61   XXXXXXXXXQTPFDPVYGITLLPSHLLVGSPFVNTPQTGGPMSAGTGANGVPVGSNNIMN 120
                     QTPFDPVYGITLLPSHLLVGSPFVNTPQTGGPMSAGTGANGVPVGSNNIMN
Sbjct: 61   SIPGTVSIPQTPFDPVYGITLLPSHLLVGSPFVNTPQTGGPMSAGTGANGVPVGSNNIMN 120

Query: 121  LRNSSYKSFYPPAPKLRPAPSGRLRRARRKDNKPQQQREHSRDNNKVEAEYDVEXXXXXX 180
            LRNSSYKSFYPPAPKLRPAPSGRLRRARRKDNKPQQQREHSRDNNKVEAEYDVE      
Sbjct: 121  LRNSSYKSFYPPAPKLRPAPSGRLRRARRKDNKPQQQREHSRDNNKVEAEYDVERGYSSR 180

Query: 181  XXXXXXXXXXXXXXXXXXXXXXXXXXKTIDSELKIQFQYSILPKGNDTYRSRSLLFTNVN 240
                                      KTIDSELKIQFQYSILPKGNDTYRSRSLLFTNVN
Sbjct: 181  SASRSQSFSASTSGSMSGSSGPKSIRKTIDSELKIQFQYSILPKGNDTYRSRSLLFTNVN 240

Query: 241  SELDIVEFLQKVAKNYPIESIYLIKDEDTGDDIENLNTSXXXXXXXXXXXXXXXXXSKRE 300
            SELDIVEFLQKVAKNYPIESIYLIKDEDTGDDIENLNTS                 SKRE
Sbjct: 241  SELDIVEFLQKVAKNYPIESIYLIKDEDTGDDIENLNTSNNDDDPNQNYNADNNNNSKRE 300

Query: 301  DDKDKESAPALTKQIAISPSSCSQQSYLLSFFTKESCLDFYNNLLQRYAEIKNAVKSDQL 360
            DDKDKESAPALTKQIAISPSSCSQQSYLLSFFTKESCLDFYNNLLQRYAEIKNAVKSDQL
Sbjct: 301  DDKDKESAPALTKQIAISPSSCSQQSYLLSFFTKESCLDFYNNLLQRYAEIKNAVKSDQL 360

Query: 361  AMNFVKIQDDEEWMANLKMNVISLGATRSLYVEFADDSVTSDTIWDTLPFLKNSGKYXXX 420
            AMNFVKIQDDEEWMANLKMNVISLGATRSLYVEFADDSVTSDTIWDTLPFLKNSGKY   
Sbjct: 361  AMNFVKIQDDEEWMANLKMNVISLGATRSLYVEFADDSVTSDTIWDTLPFLKNSGKYVVI 420

Query: 421  XXXXXXXXERRKNFGLHYCLLHFLSVTMALEVKELLETGDEAVSRVSFVTPANSADKEMR 480
                    ERRKNFGLHYCLLHFLSVTMALEVKELLETGDEAVSRVSFVTPANSADKEMR
Sbjct: 421  DVDVVTTDERRKNFGLHYCLLHFLSVTMALEVKELLETGDEAVSRVSFVTPANSADKEMR 480

Query: 481  RRRSSAISLKQEASPQMFSTDXXXXXXXXNVSLPLSEQVSTASTDISTPIYEEFDGNLTW 540
            RRRSSAISLKQEASPQMFSTD        NVSLPLSEQVSTASTDISTPIYEEFDGNLTW
Sbjct: 481  RRRSSAISLKQEASPQMFSTDSRSRSRSSNVSLPLSEQVSTASTDISTPIYEEFDGNLTW 540

Query: 541  STLIVDVSEYKEPIVNEFDHHLNSWSISKPTTLYMHESGTTNFXXXXXXXXXXXXXXXXX 600
            STLIVDVSEYKEPIVNEFDHHLNSWSISKPTTLYMHESGTTNF                 
Sbjct: 541  STLIVDVSEYKEPIVNEFDHHLNSWSISKPTTLYMHESGTTNFSSSNLSDDIDPLSISSH 600

Query: 601  XXVPQQMLLNEYPYIMEPLMPPQITQTIQNQYSKSIQAVNAGMEHRTVYIGNINPRSKAE 660
              VPQQMLLNEYPYIMEPLMPPQITQTIQNQYSKSIQAVNAGMEHRTVYIGNINPRSKAE
Sbjct: 601  DPVPQQMLLNEYPYIMEPLMPPQITQTIQNQYSKSIQAVNAGMEHRTVYIGNINPRSKAE 660

Query: 661  DICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTLEPIILHGNVLKVGWGQNP 720
            DICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTLEPIILHGNVLKVGWGQNP
Sbjct: 661  DICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTLEPIILHGNVLKVGWGQNP 720

Query: 721  GPLPKNIALAVTVGASRNVYVSLPDKAFKDKFINDPQFKEYQNRYKIPNIAQLKSDFGAY 780
            GPLPKNIALAVTVGASRNVYVSLPDKAFKDKFINDPQFKEYQNRYKIPNIAQLKSDFGAY
Sbjct: 721  GPLPKNIALAVTVGASRNVYVSLPDKAFKDKFINDPQFKEYQNRYKIPNIAQLKSDFGAY 780

Query: 781  GTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHKKTEGRYVGLIIGYGKDRC 840
            GTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHKKTEGRYVGLIIGYGKDRC
Sbjct: 781  GTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHKKTEGRYVGLIIGYGKDRC 840

Query: 841  GNINRNLVFNKNGKGXXXXXXXXXXXXXRGHRQRKQSATFSNASNIDLKHSSVANASIAN 900
            GNINRNLVFNKNGKG             RGHRQRKQSATFSNASNIDLKHSSVANASIAN
Sbjct: 841  GNINRNLVFNKNGKGSNHNRNSQNNNTSRGHRQRKQSATFSNASNIDLKHSSVANASIAN 900

Query: 901  GKLDRPMDNKNFLSLGVDADFSEGLGISISPQAERRHVLSDNXXXXXXXXXXXXXXCGNR 960
            GKLDRPMDNKNFLSLGVDADFSEGLGISISPQAERRHVLSDN              CGNR
Sbjct: 901  GKLDRPMDNKNFLSLGVDADFSEGLGISISPQAERRHVLSDNEDEREEHREEEQEECGNR 960

Query: 961  HSGVNGSNVANNEAINETLINGTYTADIPEDTLQVGXXXXXXXXXXXXXXXXIIVNAPSP 1020
            HSGVNGSNVANNEAINETLINGTYTADIPEDTLQVG                IIVNAPSP
Sbjct: 961  HSGVNGSNVANNEAINETLINGTYTADIPEDTLQVGSDSCSTYSGSSSSDVDIIVNAPSP 1020

Query: 1021 KAGDAKSFTHTRRNAXXXXXXXXXXXXXXXXXXXXXXXXXPLSHINAXXXXXXXXXXXXX 1080
            KAGDAKSFTHTRRNA                         PLSHINA             
Sbjct: 1021 KAGDAKSFTHTRRNAHHRQRNTNQTRQYNNHHHAQQHQFQPLSHINAPYQTPQPQYHPYP 1080

Query: 1081 XXXXRFSNSFVPVAQHEGANNGNPRKSSMKPIAGSDVMTRYLEQLHHNTFVYAANILGAT 1140
                RFSNSFVPVAQHEGANNGNPRKSSMKPIAGSDVMTRYLEQLHHNTFVYAANILGAT
Sbjct: 1081 QTPHRFSNSFVPVAQHEGANNGNPRKSSMKPIAGSDVMTRYLEQLHHNTFVYAANILGAT 1140

Query: 1141 QDPVFYDEDNA 1151
            QDPVFYDEDNA
Sbjct: 1141 QDPVFYDEDNA 1151

>ABL122C Chr2 complement(167005..170136) [3132 bp, 1043 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML117W
          Length = 1043

 Score =  440 bits (1131), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 268/666 (40%), Positives = 374/666 (56%), Gaps = 59/666 (8%)

Query: 325 QSYLLSFFTKESCLDFYNNLLQRYAEIKNAVKSDQLAMNFVKIQDDEEWMANLKMNVISL 384
            S LLSF TK +CLDFYNNLLQR++E K  + S +L+++FV  QD+  W   L+MNV++ 
Sbjct: 199 HSILLSFLTKATCLDFYNNLLQRFSEFKTKLHSPKLSVSFV-CQDESSWFKYLQMNVVTR 257

Query: 385 GATRSLYVEFADD--SVTSDTIWDTLPFLKNSGKYXXXXXXXXXXXERRKNFGLHYCLLH 442
           GATRSL VEF D    +  D +    P+L  S ++              ++FG  Y +LH
Sbjct: 258 GATRSLTVEFEDSVKELNEDFVRLKFPWLFCSQRFVLERIDLINATTVNQHFGTRYMILH 317

Query: 443 FLSVTMALEVKELLETGDEA----VSRVSFVTPANSADKEMRRRRSSAIS--LKQEASPQ 496
           F+S++MALEV + L+   +     +SR+ FV   N    ++    ++A +  L+Q++   
Sbjct: 318 FISISMALEVDDFLQQPSQKRQLNISRIQFVN-VNGHHSKLSDEEAAAAANGLQQDSRTS 376

Query: 497 MFSTDXXXXXXXXNVSLPL--------SEQVSTASTDISTPIYEEFDGNLTWSTLI---- 544
             S+         +++           +  +    ++  TP+ E+   +LT  T+     
Sbjct: 377 SVSSISLSISNTADLAALFHSLDLSLDTLSLQVVPSEYPTPLIEQHSEHLTSITISRPSK 436

Query: 545 -----VDVSEYKEPIVNEFDHHLNSWSISKPTTLYMHE---SGTTNFXXXX-----XXXX 591
                  + E      N  +HH  S S+S    L+M++   SG+T               
Sbjct: 437 TLGPSASLIEMDSNATNAGNHHGVSSSLSG--VLFMNDPSSSGSTPMIVPSELNLNTPVM 494

Query: 592 XXXXXXXXXXXVPQQMLLN--------EYPYIMEPLMPPQITQTIQNQYSKSIQAVNAGM 643
                       PQ M L+           Y M+P++   I QT+Q QY       N G+
Sbjct: 495 GGPMQGQLMPGPPQPMSLHNPSDGNGGSPSYFMDPMVGAPIGQTLQRQYLAGASQAN-GI 553

Query: 644 EHRTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTLE 703
            +RTVYIGNI+PRSK EDICNVVRGGILQ IKW+S KRICFVTFIETAAAVQFYAN +LE
Sbjct: 554 NNRTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANASLE 613

Query: 704 PIILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVYVSLPDKAFKDKFINDPQFKEYQN 763
           PI+LHGN+L+VGWGQ  G LPKNIALAVT+GASRNVYVSLP+ +FK+K+IN+P+FK Y  
Sbjct: 614 PIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKLYHG 673

Query: 764 RYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEY-SDTKDNL--F 820
           +YK+P   QL+ DF  YG +EQ+N+  DGHCCW+NFMNI+ AI+LVE+  S  + NL  F
Sbjct: 674 KYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSNSPIEKNLEKF 733

Query: 821 HKKTEGRYVGLIIGYGKDRCGNINRNLVFNKNGKGXXXXXXXXXXXXXRGHRQRKQSATF 880
           H + +GRY  LIIGYGKDRCGN+N+NL  NKN +              +G + RK+    
Sbjct: 734 HAQFDGRYKNLIIGYGKDRCGNVNKNLAANKNSR-FYKKIKKQSYSMKQGKQPRKEDGIV 792

Query: 881 SNASNIDLKHSSVANASIANGKLDRPMDNKNFLSLGVDADFSEGLGIS-----ISPQAER 935
            N+ ++   +  +    + + K     +++   SL  D + +EGLGIS     ISP    
Sbjct: 793 -NSDDLTKNNEVLPGVQMNSSKNGGVGESQ---SLVGDQELAEGLGISLTSAQISPDTGH 848

Query: 936 RHVLSD 941
            H  SD
Sbjct: 849 THHYSD 854

 Score = 61.6 bits (148), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/44 (65%), Positives = 37/44 (84%), Gaps = 4/44 (9%)

Query: 1110 KPIAGSDVMTRYLEQLHHNTFVYAANILGAT--QDPV--FYDED 1149
            KPIAG DVM++YLEQLHH+TF+YA NILGAT  Q+P+  +YD +
Sbjct: 995  KPIAGQDVMSQYLEQLHHSTFLYATNILGATTVQEPLGGYYDSN 1038

 Score = 55.8 bits (133), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 33/87 (37%), Positives = 47/87 (54%), Gaps = 6/87 (6%)

Query: 70  QTPFDPVYGITLLPSHLLVGSPFVNTPQTGGPMSAGTGANGVPVGSNNIMNLRNSSYKSF 129
           QTPFDP YG +LLPSH+L+GSPF++TP               P  S++ ++   S+  SF
Sbjct: 61  QTPFDPTYGASLLPSHMLMGSPFLSTPLR----PQAHFHPSTPGHSSHSLHHAQSARSSF 116

Query: 130 --YPPAPKLRPAPSGRLRRARRKDNKP 154
             YP  P L+P P  R +      ++P
Sbjct: 117 LYYPQPPMLKPIPPRRKKSVTLNHSEP 143

 Score = 52.0 bits (123), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 35/61 (57%), Gaps = 2/61 (3%)

Query: 208 TIDSELKIQFQYSILPKGNDTYRSRSLLFTNVN--SELDIVEFLQKVAKNYPIESIYLIK 265
           T++        + ILPKG D Y +RSLL TN+    +LDI  FL    K  P+ESIYL+ 
Sbjct: 137 TLNHSEPYHINFKILPKGKDEYMTRSLLLTNLEMLRDLDIHNFLNSFVKFGPVESIYLMD 196

Query: 266 D 266
           D
Sbjct: 197 D 197

>Kwal_27.10239 s27 (255440..258184) [2745 bp, 914 aa] {ON} YML117W -
           Hypothetical ORF [contig 38] PARTIAL
          Length = 914

 Score =  421 bits (1082), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 250/684 (36%), Positives = 371/684 (54%), Gaps = 138/684 (20%)

Query: 212 ELKIQFQYSILPK-GN---DTYRSRSLLFTNVNSELDIVEFLQKVAKNYPIESIYLIKDE 267
           ++  +  ++ILP+ GN   D +R+RSL F+N+N ++ + EFL    K   IES+Y++   
Sbjct: 60  QIPYKLTFNILPRNGNGDGDKFRTRSLYFSNLNPDVRLHEFLATFHKFDRIESVYVV--- 116

Query: 268 DTGDDIENLNTSXXXXXXXXXXXXXXXXXSKREDDKDKESAPALTKQIAISPSSCSQQSY 327
                                               D+E                 QQS 
Sbjct: 117 ------------------------------------DRE-----------------QQSV 123

Query: 328 LLSFFTKESCLDFYNNLLQRYAEIKNAVKSDQLAMNFVKIQDDEEW--MANLKMNVISLG 385
           L+SF TKE+CLDFYN +LQ+ +E K  ++S +L+++F   Q  E    +  +K  V+  G
Sbjct: 124 LVSFLTKETCLDFYNGILQKLSEFKKELRSKELSLSFASPQKVESGPTLQEIKFEVLRAG 183

Query: 386 ATRSLYVEFADDSVTSDTIWDTLPFLKNSG-KYXXXXXXXXXXXERRKNFGLHYCLLHFL 444
           ATRSL +EF D+ +   ++     F  NSG +Y           +  K FG +Y ++HF+
Sbjct: 184 ATRSLGLEFKDE-IDFASLLKKFDFFDNSGPRYVIESIETVNTDKPSKYFGSNYAIVHFI 242

Query: 445 SVTMALEVKELLETGDE---AVSRVSFVTPA-NSADKEMRRRRSSAISLKQEASPQMFST 500
           S+ MA+E  E L+        +++VS+V     S   E +   +S +S + +   Q    
Sbjct: 243 SIAMAVETMEYLKVQTPESFGLTKVSYVNSTFTSGKSEFQTFSNSELSDQNDVEVQD--- 299

Query: 501 DXXXXXXXXNVSLPLSEQVSTASTDISTPIYEEFDGNLTWSTLIVDVSEYKEPIVNEFDH 560
                      S+   E ++ +   +S    + F          V  S+Y  P+V E + 
Sbjct: 300 -----------SISSFEDITLSEGSMSVENEKAF---------TVLPSQYGPPVVEEHNQ 339

Query: 561 HLNSWSISKPTTLYMHESGTTNFXXXXXXXXXXXXXXXXXXXVPQQMLLNE--------- 611
           H +  +ISK  +  +  +G+++                     PQ++L++          
Sbjct: 340 HCSHITISKALSSKVSRNGSSS---------------SIASPQPQEVLVSNSEAPSSRNS 384

Query: 612 ------------------YPYIMEPLMPPQITQTIQNQYSKSIQ---AVNAGMEHRTVYI 650
                             Y Y M+  M   + QT+Q QY+ + Q   A+  G  +RTVYI
Sbjct: 385 IVSLLSARSQGPTYPVPGYHYYMD--MSKPLGQTLQQQYTATAQVATAMGGGAGNRTVYI 442

Query: 651 GNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTLEPIILHGN 710
           GNI+PRSK EDICNVVRGGILQ +K++  K ICFVTFIE A+AVQF+AN+++EPI+LHG+
Sbjct: 443 GNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSIEPIVLHGS 502

Query: 711 VLKVGWGQNPGPLPKNIALAVTVGASRNVYVSLPDKAFKDKFINDPQFKEYQNRYKIPNI 770
           +LKVGWG + G LP++I+LAVT+GASRNVYVSLP+ AFKDKFI DP+++ ++ ++K+P+ 
Sbjct: 503 LLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFREKFKLPSK 562

Query: 771 AQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHKKTEGRYVG 830
            QL  DF  +G +E +NF  DGHCCWINFMNIS+AIKLVE+ +++ +  FH+K E RY G
Sbjct: 563 QQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNNESFHEKFENRYRG 622

Query: 831 LIIGYGKDRCGNINRNLVFNKNGK 854
           L IGYGKDRCGN+N+NLV NKN K
Sbjct: 623 LFIGYGKDRCGNVNKNLVSNKNSK 646

 Score = 45.4 bits (106), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 21/39 (53%), Positives = 29/39 (74%), Gaps = 1/39 (2%)

Query: 1105 RKSSMKPIAGSDVMTRYLEQLHHNTFVYAANILGATQDP 1143
            R+ + + I GS+VM +YL QL H+TF+YAA+ILG   DP
Sbjct: 871  RQRNAQAIPGSNVMAQYLAQLQHSTFMYAADILG-VDDP 908

>ZYRO0G14256g Chr7 complement(1136628..1140407) [3780 bp, 1259 aa]
           {ON} similar to uniprot|Q03735 Saccharomyces cerevisiae
           YML117W NAB6 Putative RNA-binding protein based on
           computational analysis of large-scale protein-protein
           interaction data
          Length = 1259

 Score =  427 bits (1097), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 267/717 (37%), Positives = 372/717 (51%), Gaps = 139/717 (19%)

Query: 219 YSILPKGNDTYRSRSLLFTNVNSELDIVEFLQKVAKNYPIESIYLIKDEDTGDDIENLNT 278
           Y +LPKG+D YR+RSLLF NVN  +D+  F+ K ++  P+ESIY+ KD +          
Sbjct: 219 YRMLPKGDDEYRTRSLLFENVNGSVDLYSFVSKYSRYGPVESIYMFKDRN---------- 268

Query: 279 SXXXXXXXXXXXXXXXXXSKREDDKDKESAPALTKQIAISPSSCSQQSYLLSFFTKESCL 338
                                  DK K S                    LLSF +++ CL
Sbjct: 269 -----------------------DKTKHSV-------------------LLSFLSRKICL 286

Query: 339 DFYNNLLQRYAEIKNAVKSDQLAMNFVK-------------------------------- 366
           D YN++LQR AE K  +KS  L ++FV                                 
Sbjct: 287 DSYNSVLQRLAEFKTGLKSKSLTVSFVSLKYRKHVDENEVDQNDNSSSTPMNETDDTDAS 346

Query: 367 --------IQDDE---EWMANLKMNVISLGATRSLYVEFADDSVTSDTIWDTLPFLK--N 413
                   +QDD      +A+L+ ++++ GATRS+ +E   +   +  +   L FL   N
Sbjct: 347 KTPVATSNVQDDAYNVTVVASLQYDIVNRGATRSVALELDGEYDKTKLLDQELDFLSPAN 406

Query: 414 SGKYXXXXXXXXXXXERRKNFGLHYCLLHFLSVTMALEVKELL---ETGDEAVSRVSFVT 470
           + +Y           E  K+F  +Y +L FL+++MA+EV + +   ET      +  FV+
Sbjct: 407 NQRYVLESIYLINAKEPFKHFPKNYAILTFLNISMAVEVLDYVRNNETARSKFQKCFFVS 466

Query: 471 ----PANSADKEMRRRRSSAISLKQEASPQMFSTDXXXXXXXXNVSLPLSEQVSTASTDI 526
               P  S+D  +    +S   +    S  + +          N SL     +++  + I
Sbjct: 467 VSSCPQTSSDGGIVTTSNSITPVASGGSAGIATNGDLGGYTSKNASL---SSLNSVGSYI 523

Query: 527 STPIYEEFD---GNLTWS-TLIVDVSEYKEPIVNEFDHHLNSWSISKPTTLYMH------ 576
           S  + +E D    +L  S T+ V V EY +P   EF  HL++ S+ + + L         
Sbjct: 524 S--LDQEIDFLSSSLKGSHTITVAVDEYPKPFFAEFSDHLSNASVLEASALDTQISSPHP 581

Query: 577 --------ESGTTNFXXXXXXXXXXXXXXXXXXXVPQQ--MLLNEYPYIMEPL------M 620
                   +S                        +P Q  M +N   Y MEP       M
Sbjct: 582 QEVIVPSQDSPLVGGAPPLDAVHPAATPALSSQVLPLQPHMAMNSGIY-MEPFGRRNKTM 640

Query: 621 PPQITQTIQNQYSKSIQAVNA---GMEHRTVYIGNINPRSKAEDICNVVRGGILQHIKWV 677
              ITQ++Q Q++ S +  N+   G+ +RTVYIGNI+PRSK EDICNVVRGGILQ I+++
Sbjct: 641 IKPITQSLQKQFATSAEVANSMGGGIGNRTVYIGNIHPRSKPEDICNVVRGGILQSIRFL 700

Query: 678 SHKRICFVTFIETAAAVQFYANTTLEPIILHGNVLKVGWGQNPGPLPKNIALAVTVGASR 737
             K ICFVTFIE + AVQFY N  ++PI+LHGN+LKVGWG + GPLPK+++LAVTVGASR
Sbjct: 701 QDKHICFVTFIEASTAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSVSLAVTVGASR 760

Query: 738 NVYVSLPDKAFKDKFINDPQFKEYQNRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWI 797
           NVYVSLPD AFKDK+INDPQ++ Y + YK+P   QL++DF  +G +EQ+NF SDGHCCW+
Sbjct: 761 NVYVSLPDFAFKDKYINDPQYQRYSDEYKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWV 820

Query: 798 NFMNISSAIKLVEEYSDTKDNLFHKKTEGRYVGLIIGYGKDRCGNINRNLVFNKNGK 854
           NFMNISSAIKLVEE        FHK  + RY GLIIGYGKDRCGN+N+NL+  KN +
Sbjct: 821 NFMNISSAIKLVEEIKYNDGEAFHKSFDNRYRGLIIGYGKDRCGNVNKNLISGKNSR 877

 Score = 56.2 bits (134), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 1/50 (2%)

Query: 1102 GNPRKSSMKPIAGSDVMTRYLEQLHHNTFVYAANILGAT-QDPVFYDEDN 1150
            G  ++ + K I GSDVM +YL QL H+TF+YAANILGAT +  V Y EDN
Sbjct: 1207 GRNKRRNAKAIPGSDVMAQYLAQLQHSTFMYAANILGATAEGDVDYYEDN 1256

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 35/78 (44%), Gaps = 22/78 (28%)

Query: 19  PPVGYEQQVYDVAGRNGGSNHHPPQYIYYTHRXXXXXXXXXXXXXXXXXXXQTPFDPVYG 78
           PPVG  Q  Y            PPQ  YY                       TPFD  YG
Sbjct: 55  PPVGSLQAQY-----------APPQPAYYA-----------AAGPPLMNPPPTPFDTAYG 92

Query: 79  ITLLPSHLLVGSPFVNTP 96
           ITLLPSHLL+GSPFV++P
Sbjct: 93  ITLLPSHLLIGSPFVSSP 110

>KLTH0C03784g Chr3 (328834..331827) [2994 bp, 997 aa] {ON} similar
           to uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
           Putative RNA-binding protein based on computational
           analysis of large-scale protein-protein interaction data
          Length = 997

 Score =  419 bits (1077), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 232/551 (42%), Positives = 325/551 (58%), Gaps = 40/551 (7%)

Query: 324 QQSYLLSFFTKESCLDFYNNLLQRYAEIKNAVKSDQLAMNFVKIQDDEEW--MANLKMNV 381
           QQS L+SF TKE+CLDFYN +LQ+ +E K  +KS +L +NF  ++D +    +  +K+ V
Sbjct: 193 QQSVLVSFLTKETCLDFYNGVLQKLSEFKKELKSKELTLNFASLRDVKTGPTLQEIKIEV 252

Query: 382 ISLGATRSLYVEFADDSVTSDTIWDTLPFLKNSG-KYXXXXXXXXXXXERRKNFGLHYCL 440
           +  GATRSL +EF  D V    +  +L F+ N G +Y              K+FG HY +
Sbjct: 253 LRAGATRSLILEF-QDKVDLALLSKSLGFIVNEGPRYVVEAIEIVNAGRSSKHFGPHYAI 311

Query: 441 LHFLSVTMALEVKELLETGDEAVSRVSFVTPANSADKEMRRRRSSAISLKQEASPQMFST 500
           +HF+S+ MALE  E L++    ++ +            ++ R  +  S   ++  Q  S+
Sbjct: 312 IHFISIAMALETVEYLKSQSNKLAGL------------IKFRYVNTTSASGKSEFQTLSS 359

Query: 501 DXXXXXXXXNVS---LPLSEQVSTASTDISTPIYEEFDGNLTWSTLIVDVSEYKEPIVNE 557
                    N S   +   E V++  + +          +L   TL+VD ++Y  P+V E
Sbjct: 360 SQLNERALSNTSDSDISGGESVASLGSKLQ-------QTSLGEQTLVVDPTQYGRPLVEE 412

Query: 558 FDHHLNSWSISKP----TTLYMHESGTTNFXXXXXXXXXXXXXXXXXXXV---------P 604
              HL   +ISK     ++L    S TT+                    V         P
Sbjct: 413 RSEHLPHVTISKALNSKSSLNDLTSNTTSPQPQEVLVNDHEDSSSRGSMVSLKQANSHGP 472

Query: 605 QQMLLNEYPYIMEPLMPPQITQTIQNQYSKSIQ-AVNAGMEHRTVYIGNINPRSKAEDIC 663
               +  YP+ M    P   T   Q   +  +  A+  G+ +RTVYIGNI+PRSK EDIC
Sbjct: 473 AYPPIPGYPFYMNMSKPLGQTLQQQYTTTAQVATAMGGGLGNRTVYIGNISPRSKTEDIC 532

Query: 664 NVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTLEPIILHGNVLKVGWGQNPGPL 723
           NVVRGGILQ +K++  K ICFVTFIE A+AVQF+AN+T+EPI+LHGNVLKVGWG + G L
Sbjct: 533 NVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTIEPIVLHGNVLKVGWGHHSGNL 592

Query: 724 PKNIALAVTVGASRNVYVSLPDKAFKDKFINDPQFKEYQNRYKIPNIAQLKSDFGAYGTM 783
           P++I+LAVT+GASRNVYVSLP+ AFKDKFI DP+++E++ ++++P+  QL  DF  +G +
Sbjct: 593 PQSISLAVTIGASRNVYVSLPEHAFKDKFIKDPEYQEFKEKFQLPSKEQLYEDFSVFGDI 652

Query: 784 EQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHKKTEGRYVGLIIGYGKDRCGNI 843
           E VNF  DGHCCWINFMNIS+AIKLVE+ ++  ++ FH+K   RY GL IGYGKDRCGN+
Sbjct: 653 ELVNFLEDGHCCWINFMNISNAIKLVEDANNPNNDSFHEKFGNRYKGLFIGYGKDRCGNV 712

Query: 844 NRNLVFNKNGK 854
           N+NLV NKN K
Sbjct: 713 NKNLVANKNSK 723

 Score = 59.3 bits (142), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 35/48 (72%), Gaps = 1/48 (2%)

Query: 1103 NPRKSSMKPIAGSDVMTRYLEQLHHNTFVYAANILGATQ-DPVFYDED 1149
            +PR+   K I GSDVM +YL QL H+TF+YAANILG    + VFYDE+
Sbjct: 942  HPRRRKSKAIPGSDVMAQYLAQLQHSTFMYAANILGVDDGETVFYDEN 989

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/38 (60%), Positives = 27/38 (71%), Gaps = 2/38 (5%)

Query: 70  QTPFDPVYGITLLPSHLLVGSPFVNTPQTG--GPMSAG 105
           QTPFD  YG++LLPSHLL+ SPF+ TP  G   P  AG
Sbjct: 50  QTPFDTSYGVSLLPSHLLMSSPFLATPGMGSASPHRAG 87

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 33/53 (62%), Gaps = 4/53 (7%)

Query: 219 YSILPK----GNDTYRSRSLLFTNVNSELDIVEFLQKVAKNYPIESIYLIKDE 267
           + ILP+    G D Y +RSLLF+N+N +  + +FL K  K   +ES+YL+  +
Sbjct: 140 FHILPRSADGGGDEYMTRSLLFSNLNPDTHLHDFLTKFEKFDRVESVYLVDSQ 192

>TPHA0I00270 Chr9 complement(50298..53417) [3120 bp, 1039 aa] {ON}
           Anc_8.844 YML117W
          Length = 1039

 Score =  415 bits (1066), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 273/830 (32%), Positives = 402/830 (48%), Gaps = 161/830 (19%)

Query: 73  FDPVYGITLLPSHLLVGSPFVNTPQTGGPMSAGTGANGVPVGSNNIMNLRNSSYKSFYPP 132
           FD  YG TLLPSH+L+ SPFV+TP         + + G+        N RNS+   F  P
Sbjct: 112 FDYAYGTTLLPSHILMNSPFVSTPNKSYLSFQASPSRGIS------YNRRNSNQMVF--P 163

Query: 133 APKLRPAP---SGRLRRARRKDNKPQQQREHSRDNNKVEAEYDVEXXXXXXXXXXXXXXX 189
            P +  +P     +  RA+  + +     +  + N +V  E                   
Sbjct: 164 NPPIITSPHLVGDKSERAKSDNYEKVDTLDDEKRNREVFEE------------------- 204

Query: 190 XXXXXXXXXXXXXXXXXKTIDSELKIQFQYSILPKGNDTYRSRSLLFTNVNSELDIVEFL 249
                               +S +  +  Y ILPKG+DTY +RSLLF N+N  +D+  F+
Sbjct: 205 --------------------ESAIAYKISYQILPKGDDTYHTRSLLFENINESIDLHTFI 244

Query: 250 QKVAKNYPIESIYLIKDEDTGDDIENLNTSXXXXXXXXXXXXXXXXXSKREDDKDKESAP 309
           +K      IES+Y++   +T  +                                     
Sbjct: 245 EKFVNYGLIESVYVVPSYETHQN------------------------------------- 267

Query: 310 ALTKQIAISPSSCSQQSYLLSFFTKESCLDFYNNLLQRYAEIKNAVKSDQLAMNFVKI-- 367
                        S +S LLSF ++  CLDFYN++LQ+ +E K  + S+ L ++FV +  
Sbjct: 268 -------------SVKSILLSFTSRSICLDFYNSVLQKLSEYKTQLNSENLKLSFVSLCY 314

Query: 368 -------------------QDDEEWMANLKMNVISLGATRSLYVEFADDSV--TSDTIWD 406
                              + D E  + ++  V + GATRSL +EF D  V    D I  
Sbjct: 315 LQNNINKGNGKISVESQKNETDFELTSLIQYQVANFGATRSLCIEF-DKRVDKIDDFIET 373

Query: 407 TLPFLKNSG--KYXXXXXXXXXXXERRKNFGLHYCLLHFLSVTMALEVKELLETGDEAVS 464
            LPFL ++   +Y            +   F  HY +L FL+++M +EV   + + + + +
Sbjct: 374 YLPFLSSNANKRYIIESLYIVNNNGKDNEFPAHYVILSFLNISMVIEVLHYIRSKNLSKT 433

Query: 465 -----RVSFVTPANSADKEMRRRRSSAISLKQEASPQMFSTDXXXXXXXXNVSLPLSEQV 519
                 VSF    ++     R+      SL ++ +    +T          +  P++   
Sbjct: 434 IKNCLYVSFDRTKHAVSNSNRQ------SLSKKGTSDTLNT--------YTLESPINHNT 479

Query: 520 STASTDISTPIYEE---------FDGNLTWSTLIVDVSEYKEPIVNEFDHHLNSWSISKP 570
                DI + IY+E          +  +   T  +D+S Y  P +     HL + SIS+ 
Sbjct: 480 EVDMNDIPS-IYDENEIEIANKLSELEIQTHTFNLDISNYSNPHIEIRAEHLPNVSISRD 538

Query: 571 TTLY---MHESGTTNFXXXXXXXXXXXXXXXXXXXVPQQMLLNEYPYIMEPLMPPQITQT 627
             +Y   +++S  + +                        +     +    L    + QT
Sbjct: 539 PMIYANPIYQSPPSGYMENMWTTTPFLSSHIVHEEYANDRVDYNMKHYNNQLYNVPLPQT 598

Query: 628 IQNQYSKSIQ---AVNAGMEHRTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICF 684
           +Q+Q++ S +    +  G+ +RT++IGNINPRSK EDICNV RGGI+Q +K++  K ICF
Sbjct: 599 LQSQFATSAEMASKMGGGVGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICF 658

Query: 685 VTFIETAAAVQFYANTTLEPIILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVYVSLP 744
           V FI+  AA QFYAN+ ++PIILH N LK+GWG +PGPLPK I LAVT GASRNVYVSLP
Sbjct: 659 VIFIDPQAAAQFYANSFIDPIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVSLP 718

Query: 745 DKAFKDKFINDPQFKEYQNRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISS 804
           + AFKDK+INDP +KEY N+Y +P+  QL+ DF  +G MEQ+NF  D HCCWINF NI S
Sbjct: 719 EFAFKDKYINDPNYKEYHNKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRS 778

Query: 805 AIKLVEEYSDTKDNLFHKKTEGRYVGLIIGYGKDRCGNINRNLVFNKNGK 854
           AIKLVE   +  +N FH++ + RY GLIIGYGKDRCGN+N++LV NKN +
Sbjct: 779 AIKLVELVKNEDNNNFHERYKNRYKGLIIGYGKDRCGNVNKSLVSNKNSR 828

 Score = 55.1 bits (131), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 38/47 (80%), Gaps = 1/47 (2%)

Query: 1105 RKSSMKPIAGSDVMTRYLEQLHHNTFVYAANILGAT-QDPVFYDEDN 1150
            +++  K I GSDVM++YL Q+ H+TF+YAAN+L A+ ++P FYDE++
Sbjct: 987  KRTHKKIIPGSDVMSQYLAQVQHSTFMYAANVLNASIEEPEFYDEND 1033

>TDEL0B00540 Chr2 (100637..103984) [3348 bp, 1115 aa] {ON} Anc_8.844
           YML117W
          Length = 1115

 Score =  413 bits (1061), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 255/692 (36%), Positives = 361/692 (52%), Gaps = 117/692 (16%)

Query: 219 YSILPKGNDTYRSRSLLFTNVNSELDIVEFLQKVAKNYPIESIYLIKDEDTGDDIENLNT 278
           Y +LPKGND +R+RSLLF NV+  +D+  F+       P+ES+YL K E  GD +     
Sbjct: 170 YRVLPKGNDEFRTRSLLFENVDGSIDLHSFVTNFTNYGPVESVYLFKSE--GDHV----- 222

Query: 279 SXXXXXXXXXXXXXXXXXSKREDDKDKESAPALTKQIAISPSSCSQQSYLLSFFTKESCL 338
                                                          S LLSFF+K  CL
Sbjct: 223 -----------------------------------------------SILLSFFSKAICL 235

Query: 339 DFYNNLLQRYAEIKNAVKSDQLAMNFV----KIQDDEE-----------------WMANL 377
           DFYN++LQR +E K+ + S  L ++FV    K+ D  E                    +L
Sbjct: 236 DFYNSVLQRLSEYKSDLDSKALTLSFVSLEYKVSDTSEEDIDKEDDSKPDAFNITAAGSL 295

Query: 378 KMNVISLGATRSLYVEFADDSVTSDTIWDTLPFLK--NSGKYXXXXXXXXXXXERRKNFG 435
           + +VI+ GATRS+ + F       + I   L FLK  N+ +Y           E  K+F 
Sbjct: 296 RYDVINRGATRSIMITFKTPCSKDELIDKKLEFLKKENNTRYVLESIDLVTADEPSKHFP 355

Query: 436 LHYCLLHFLSVTMALEVKELLETGDEA--VSRVSFVTPANSADKEMRRRRSSAISLKQEA 493
            +Y +L FL++ MA+E+ + +    +   +S+  F++         R   SSA + +   
Sbjct: 356 QNYAVLTFLNIFMAVEILDYIRLHSQKLDISKCFFISIQPQIPDGKRLSVSSASNGRS-- 413

Query: 494 SPQMFSTDXXXXXXXXNV-SLPLSEQVSTASTDISTPIYEEFDGNLTWSTLIVDVSEYKE 552
              M S          +V SL  S  + +   +I    Y+    N   + L V  + YK+
Sbjct: 414 ---MESISGNYRSKNASVTSLESSGSIISLDQEIDEMTYKLQSVNSKKNILEVTTNNYKD 470

Query: 553 PIVNEFDHHLNSWSISK------------PTTLYMHESGTTNFXXXXXXXXXXXXXXXXX 600
           P       HL + ++S+            P  + ++E    N                  
Sbjct: 471 PSFEGHTDHLTNVTVSEAASLDSQLTMPSPQEVTVNEYVLPNQDMPLPNDMNYAPSVQDV 530

Query: 601 XXVPQQML----LNEYPYIMEPLMPPQ-----------ITQTIQNQYSKSIQ---AVNAG 642
             VP  M+    +   PY     MPP            ITQ++Q QY+ S +   ++  G
Sbjct: 531 DAVPPSMVPMSTMPNTPYGC--YMPPPNVRQNGNMTKPITQSLQRQYATSAEVASSMGGG 588

Query: 643 MEHRTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTL 702
           + +RTVYIGNI+PRS+ EDICNVVRGGILQ++K+++ KRICFVTF+E +AAVQFY N  +
Sbjct: 589 IGNRTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFI 648

Query: 703 EPIILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVYVSLPDKAFKDKFINDPQFKEYQ 762
           +PI+LHGN+LKVGWG + GPLPK+IALAVTVGASRNVYVSLP+ AFKDK+I DPQ++EY 
Sbjct: 649 DPIVLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYN 708

Query: 763 NRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHK 822
            ++++P+  QL+ DF  YG +EQ+N+ +DGHCCW+NF NIS+AIKLVEE        F+K
Sbjct: 709 KKFRLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYK 768

Query: 823 KTEGRYVGLIIGYGKDRCGNINRNLVFNKNGK 854
              GRY GL+IGYGKDRCGN+N+N +  KN +
Sbjct: 769 MLGGRYDGLVIGYGKDRCGNVNKNFIAGKNSR 800

 Score = 53.1 bits (126), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/33 (69%), Positives = 27/33 (81%)

Query: 1110 KPIAGSDVMTRYLEQLHHNTFVYAANILGATQD 1142
            K I GSDVM +YL QL H+TF+YAANILGA+ D
Sbjct: 1071 KSIPGSDVMAQYLAQLQHSTFIYAANILGASND 1103

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/26 (76%), Positives = 24/26 (92%)

Query: 71 TPFDPVYGITLLPSHLLVGSPFVNTP 96
          TPFD  YG+TLLPSHLL+GSPFV++P
Sbjct: 59 TPFDTAYGVTLLPSHLLMGSPFVSSP 84

>SAKL0D01364g Chr4 (105477..108725) [3249 bp, 1082 aa] {ON} similar
           to uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
           Putative RNA-binding protein based on computational
           analysis of large-scale protein-protein interaction data
          Length = 1082

 Score =  408 bits (1048), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 247/653 (37%), Positives = 346/653 (52%), Gaps = 89/653 (13%)

Query: 325 QSYLLSFFTKESCLDFYNNLLQRYAEIKNAVKSDQLAMNFVKIQDDEEWMANLKMNVISL 384
           QS LLSF TK +CLDFYNN+LQ+ ++ K  + S  L +NFV +  ++     ++ +V+  
Sbjct: 262 QSILLSFLTKNTCLDFYNNVLQKLSDFKIDLNSKSLTLNFVSLTSED-----IRDDVLRK 316

Query: 385 GATRSLYVEFADDSVTSDTIWDTLPFLKNSG--KYXXXXXXXXXXXERRKNFGLHYCLLH 442
           GATRS+ +EF +   T     +++  L N+   ++              KNF  HY ++H
Sbjct: 317 GATRSIALEFKNSFTTKQ--LESIEILSNASNSRFVVEKIDIVNTESPNKNFNTHYAIIH 374

Query: 443 FLSVTMALEVKELLETGDE--AVSRVSFVTPANSADKEMRRRRSSAISLKQEASPQMFST 500
           F+S++MA+E    L   DE   +SR+ FVT  +S   +    RS+  S  Q+AS    S 
Sbjct: 375 FISISMAVEASSYLLNWDEKLGISRLFFVT--DSIINKSDYFRSAPAS--QDASRSSVSI 430

Query: 501 DXXXXXXXXNVSLPLSEQVSTASTDISTPIYEEFDGNLTWSTLIVDVSEYKEPIVNEFDH 560
           D               + +  A+  +   + +E        TL +    Y +  + E  H
Sbjct: 431 D---------------QTLEFATKKLQGLVLKE-------RTLSIKPKTYPQAEIEEHQH 468

Query: 561 HLNSWSISKPTT-------------------------LYMHESGTTNFXXXXXXXXXXXX 595
           HL S SISKP                           +Y+H++  +              
Sbjct: 469 HLTSISISKPLLSSNNNSSSVSLQGNQNLTSSPVTQEMYLHDTSNSTREDVMIQSSMASG 528

Query: 596 XXXXXXXVPQQMLLNEYPYIMEPLMPPQITQTIQNQYSKSIQA-VNAGMEHRTVYIGNIN 654
                   P         Y M+   P + T   Q   +  + + +  G+ +RTVY+GNIN
Sbjct: 529 TSNFVPPPPH--------YYMDVTKPIRQTLQQQLTTTAQVASNMGGGLGNRTVYLGNIN 580

Query: 655 PRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTLEPIILHGNVLKV 714
           PRSK EDICNVVRGGILQHIK+  HK +CFVTFIE AAAVQF+AN ++EPI+LHGNVLKV
Sbjct: 581 PRSKPEDICNVVRGGILQHIKFFEHKHVCFVTFIEAAAAVQFFANASIEPIVLHGNVLKV 640

Query: 715 GWGQNPGPLPKNIALAVTVGASRNVYVSLPDKAFKDKFINDPQFKEYQNRYKIPNIAQLK 774
           GWG +PG L ++IALAVT+GASRNVYVSLP+ AFKDKFI DP+F+E++ +Y++P+  QL+
Sbjct: 641 GWGHHPGDLAQSIALAVTIGASRNVYVSLPEYAFKDKFIKDPEFQEFREKYELPSKEQLR 700

Query: 775 SDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHKKTEGRYVGLIIG 834
            DF  +G +EQ+N+  DGHCCW+NFMNI+SAIKLVE+ +   +  FH   + RY GLIIG
Sbjct: 701 QDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNKKFHGSYQDRYKGLIIG 760

Query: 835 YGKDRCGNINRNLVFNKNGKGXXXXXXXXXXXXXRGHRQRKQ---------SATFSNASN 885
           YGKDRCGN+N+NLV NK  K              R H+Q K          S+   NA  
Sbjct: 761 YGKDRCGNVNKNLVANK--KSRFFKKVKKASYKIRMHKQNKAGGSNGQEPISSFQDNAFG 818

Query: 886 IDLKHSSVANASI-------ANGKLDRPMDNKNFLSLGVDADFSEGLGISISP 931
           I +    + +  +        N + ++   N   L L       EGLGI  SP
Sbjct: 819 ICISPRGIESEEVEALPDVPQNIEEEKNPQNNGLLKLANGNGIGEGLGIEFSP 871

 Score = 84.7 bits (208), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 88/195 (45%), Gaps = 30/195 (15%)

Query: 70  QTPFDPVYGITLLPSHLLVGSPFVNTPQTGGPMSAGTGANGVPVGSNNIMNLRNSSYKSF 129
           QTPFD  YG TLLPSHLL+GSPF++TPQ    M AG+                NSS + F
Sbjct: 68  QTPFDTSYGATLLPSHLLMGSPFISTPQNAAMMHAGSRG-------------LNSSQQQF 114

Query: 130 YPPAPKLRPAPSGRLRRARRKDNKPQQQREHSRDNNKVEAEYDVEXXXXXXXXXXXXXXX 189
           Y        + +G+ + + +K+N         RD  KVE  + +                
Sbjct: 115 Y----HYTYSNNGKNKGSSKKNN---------RDKKKVENGHVM----MTRYSYPPPPQL 157

Query: 190 XXXXXXXXXXXXXXXXXKTIDSELKIQFQYSILPKGNDTYRSRSLLFTNVNSELDIVEFL 249
                             +  S       + ILPKG+D Y +RSLL +NVN+ + + +F+
Sbjct: 158 NAPPMTHKRKTHLRHETNSQPSSEPYVINFKILPKGDDEYMTRSLLLSNVNASIKLHDFI 217

Query: 250 QKVAKNYPIESIYLI 264
            K  K  PIES+Y++
Sbjct: 218 TKFVKFGPIESVYVV 232

 Score = 53.1 bits (126), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/54 (53%), Positives = 36/54 (66%), Gaps = 6/54 (11%)

Query: 1100 NNGNPRKSSMKPIAGSDVMTRYLEQLHHNTFVYAANILGAT----QDPVFYDED 1149
            ++G  RKS  K I GS VM +YL QL H+TF+YAANILG T    +D   YDE+
Sbjct: 1024 HHGRHRKS--KAIPGSQVMAQYLAQLQHSTFMYAANILGVTNGDNEDSTLYDEN 1075

>CAGL0B02365g Chr2 complement(224663..227815) [3153 bp, 1050 aa]
           {ON} some similarities with uniprot|Q03735 Saccharomyces
           cerevisiae YML117w
          Length = 1050

 Score =  405 bits (1042), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 276/853 (32%), Positives = 416/853 (48%), Gaps = 161/853 (18%)

Query: 71  TPFDPVYGITLLPSHLLVGSPFVNTPQTGGPMSAGTGANGVPVGSNNIMNLRNSSY---- 126
           TPFD  YG +LLPSHLL+GSP ++T       +A   A G    + +    RNS +    
Sbjct: 52  TPFDTAYGASLLPSHLLMGSPMISTTNLPRDNNADLLAGGYNRNNRSFQFRRNSGFVLQS 111

Query: 127 --KSFYPPAPK--LRPAPSGRLRRARRKDNKPQQQREHSRDNNKVEAEYDVEXXXXXXXX 182
              + Y  + +  L  AP  + R  +   +         +  +K     DV         
Sbjct: 112 NGNTPYMSSKRSSLSQAPMSQKRAEKNSTDSSVGSHGKKKLQHKKRTPIDV--------- 162

Query: 183 XXXXXXXXXXXXXXXXXXXXXXXXKTIDSELKIQFQYSILPKGNDTYRSRSLLFTNVNSE 242
                                   K + S + I ++  +LP G+DTY++RSLLF NV   
Sbjct: 163 -----------------------TKKLISPISINYR--VLPSGDDTYKTRSLLFENVQKN 197

Query: 243 LDIVEFLQKVAKNYP-IESIYLIKDEDTGDDIENLNTSXXXXXXXXXXXXXXXXXSKRED 301
            +++    ++  NY  +ES+Y+ +  DT                             +E 
Sbjct: 198 DEMLSVFMRLIINYSQVESVYVFQQTDT-------------------------PSKDKES 232

Query: 302 DKDKESAPALTKQIAISPSSCSQQSYLLSFFTKESCLDFYNNLLQRYAEIKNAVKSDQLA 361
           DKD                +C  Q   LSF ++++ LDFYNN LQR  + K  + S +L+
Sbjct: 233 DKD----------------TCCLQ---LSFLSRQAALDFYNNFLQRLPDFKKKLSSPKLS 273

Query: 362 MNFVK-------------------------IQDDEEWMAN--LKMNVISLGATRSLYVEF 394
           ++FV                          I+  +E +    L   + S  ATRS+ +EF
Sbjct: 274 VSFVSFSYVTDEDKDKDKDKDKDINTEKRNIKRSQELLKEPALGEEIFSHDATRSIAIEF 333

Query: 395 ADDSVTSDTIWDTLPFL--KNSGKYXXXXXXXXXXXERRKNFGLHYCLLHFLSVTMALEV 452
               V  D +++ LPFL  K++ +Y           +   +F  +Y +L F+++ MA+EV
Sbjct: 334 Y-SQVEQDALFEKLPFLDDKDNKRYILEAVDIISAEDAADDFPANYVILTFINIKMAIEV 392

Query: 453 KELLETG--DEAVSRVSFVTPANSADKEMRRRRSSAISLKQEASPQMFSTDXXXXXXXXN 510
            + L+      +V+   FV+      +    R SS   +    S +   +          
Sbjct: 393 LDYLKANLMTYSVNECFFVSLPGCKSQ----RESSTTPVLGHISTEGSKSVSEVNLANGG 448

Query: 511 VSLPLSEQVSTASTDISTPIYEEFDGNLTWSTLIVDVSEYKEPIVNEFDHHL-------- 562
            ++ +  ++ + S ++++   EE         L +  S+Y +P +   D H+        
Sbjct: 449 NTVMIDRELESLSDELASLKLEE-------KCLKIIRSDYPKPEIRSHDDHIPGSTNFSM 501

Query: 563 ----NSWSISKPTTLYMHESGTTNFXXXXXXXXXXXXXXXXXXXVPQQML-------LNE 611
               +  +    + +Y+H++ T +                    +P   L         +
Sbjct: 502 YIFDDGMNPEGNSGMYLHDNLTDHSSIIGSPFSNYIDPSISHVMLPNNGLPVGGFDAPGK 561

Query: 612 YPYIMEPLMPPQ-------ITQTIQNQYSKSIQ---AVNAGMEHRTVYIGNINPRSKAED 661
           +P  +EP+  P        ITQ+I+++ + S +   A+    ++RTVYIGNINPRSK ED
Sbjct: 562 FP--IEPISGPPFNHTNKVITQSIEDRLNTSARIAAAMGGDADNRTVYIGNINPRSKVED 619

Query: 662 ICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTLEPIILHGNVLKVGWGQNPG 721
           ICNVVRGGILQ++K++  KRICFVTFIE +AA QF AN+ ++PI+LHGN L+VGWG   G
Sbjct: 620 ICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFIDPIVLHGNTLRVGWGNQSG 679

Query: 722 PLPKNIALAVTVGASRNVYVSLPDKAFKDKFINDPQFKEYQNRYKIPNIAQLKSDFGAYG 781
           PLPK+IALAVTVGA+RNVYVSLP+ AFKDKFINDP++KEY  RYK+P+  QL+ DF  YG
Sbjct: 680 PLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYHERYKLPSQEQLRKDFTTYG 739

Query: 782 TMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHKKTEGRYVGLIIGYGKDRCG 841
            +EQ+N+  D HCCW+NF+NI+SAI+LVE+ +      FHKK   RY GLII YGKDRCG
Sbjct: 740 EIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEEFHKKFNNRYEGLIINYGKDRCG 799

Query: 842 NINRNLVFNKNGK 854
           NIN+NL+  K  K
Sbjct: 800 NINKNLIAGKGSK 812

 Score = 55.5 bits (132), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 34/46 (73%)

Query: 1095 QHEGANNGNPRKSSMKPIAGSDVMTRYLEQLHHNTFVYAANILGAT 1140
            +++  +N  P +   +PI GSDVM +YL QL H+TF+YAANILGA+
Sbjct: 995  KYKRTHNNFPNQQPTRPIPGSDVMAQYLAQLQHSTFMYAANILGAS 1040

>Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W
           (REAL)
          Length = 1131

 Score =  391 bits (1004), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 276/815 (33%), Positives = 396/815 (48%), Gaps = 172/815 (21%)

Query: 209 IDSELKIQ----FQYSILPKGNDTYRSRSLLFTNVNSELDIVEFLQKVAKNYPIESIYLI 264
           I SEL +Q      Y ILP G+D YR+RSLL  NV+   D+   ++   K+  +ES Y+I
Sbjct: 186 ISSELLLQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSIVKNFVKSNTLESTYII 245

Query: 265 KDEDTGDDIENLNTSXXXXXXXXXXXXXXXXXSKREDDKDKESAPALTKQIAISPSSCSQ 324
            +E                              K +D KD+++               S 
Sbjct: 246 GNE------------------------------KSDDLKDEQT---------------SN 260

Query: 325 QSYLLSFFTKESCLDFYNNLLQRYAEIKNAVKSDQLAMNFVKIQDDEEWM---------- 374
            S L+SF T+  CL+FYNN+LQR +E K  +KS+ L + FV +  D + +          
Sbjct: 261 LSILISFLTRSDCLNFYNNILQRLSEFKTFLKSESLNLKFVCLNYDFKCLSTFIEDDALT 320

Query: 375 ----------------ANLKMNVISLGATRSLYVEFADDSVTSDTIWDTLPFL--KNSGK 416
                           A+L  ++ +  ATRS+ VEF     +++     L FL   N+ +
Sbjct: 321 ENVEQIDITNDSSMISASLHHDLENKDATRSIIVEFKSPLKSTELFNKKLQFLDRSNNKR 380

Query: 417 YXXXXXXXXXXXERRKNFGLHYCLLHFLSVTMALEVKELLETGDE--AVSRVSFVT---- 470
           Y                F  +Y +L FL++ MA+EV + L+   +   +S+  +V+    
Sbjct: 381 YILESIDIVNTDVPSNQFPENYAVLTFLNIFMAIEVLDYLKKYSKKLGISKCFYVSLAPL 440

Query: 471 --------PANSADKEMRRRRSSAISLKQEASPQMFS----------TDXXXXXXXXNVS 512
                    AN  + +    R S  S+  E +    +           +          S
Sbjct: 441 VISSTRSSVANIYEIKTSTHRLSVPSVPVENNNDNNNSNNHKSNISDANTHNSNNSTRAS 500

Query: 513 LPLSEQVSTASTDISTPIYEEFDG--------NLTWSTLIVDVSEYKEPIVNEFDHHLNS 564
           L  +  VS AS   S  + EE D          L  + L ++  +Y+ P V+E   HL++
Sbjct: 501 LYGNSNVSLASLPSSVSLNEEIDILTTKLQGIQLDGTDLEINYHDYQTPTVHEHSTHLSN 560

Query: 565 WSISK------------PTTLYMHESGTTNFXXXXXXXXXXXXXXXXXXXVPQQMLLNEY 612
             ISK            P+ L ++E    N                    VPQQ++    
Sbjct: 561 VKISKTVENSRQFPHDIPSPLPLNERMFMN-----------DSNHSNGSIVPQQLMATPS 609

Query: 613 PY-----IMEPLMPPQITQTIQNQY---SKSIQAVNAGMEHRTVYIGNINPRSKAEDICN 664
           P      + + ++P  ITQ+++  +   +K   ++ + + +RT+YIGNINPRS+AEDICN
Sbjct: 610 PVSSTIQMNQRVLPNPITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINPRSRAEDICN 669

Query: 665 VVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTLEPIILHGNVLKVGWGQNPGPLP 724
           VVRGGILQ IK++  KRICFVTFIE  +AVQFYAN+ ++PI+LHGN+L+VGWG   GPLP
Sbjct: 670 VVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLP 729

Query: 725 KNIALAVTVGASRNVYVSLPDKAFKDKFINDPQFKEYQNRYKIPNIAQLKSDFGAYGTME 784
           K+I+LAVT+GASRNVYVSLP+ AFK+KFI+DPQ+K+      +P+  QL+ DF  YG +E
Sbjct: 730 KSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIE 789

Query: 785 QVNFHSDGHCCWINFMNISSAIKLVEEYSD-----------TKDNLFHKKTEGRYVGLII 833
           Q+N+ SD HCCWINFMNISSAI LVEE +            T      KK  GRY GL+I
Sbjct: 790 QINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNEDGEMTHKTATEKKFGGRYEGLLI 849

Query: 834 GYGKDRCGNINRNLVFNKNGKGXXXXXXXXXXXXXRGHRQRKQSATFSNASNIDLKHSSV 893
            YGKDRCGNIN+NLV  KN                R +++ K+ +      NI L     
Sbjct: 850 NYGKDRCGNINKNLVAGKNS---------------RFYKKVKRPSY-----NIRLSKLEE 889

Query: 894 ANASIANGKLDRPMDNK-NFLSLGVDADFSEGLGI 927
                 N K +R  D   N  SLG+  D  + +GI
Sbjct: 890 RRRQNENDKKERAFDKALNLESLGISLDSHKDIGI 924

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 27/39 (69%)

Query: 71  TPFDPVYGITLLPSHLLVGSPFVNTPQTGGPMSAGTGAN 109
           TPFD  YG +LLPSHLL+GSPFV++P   G  S    +N
Sbjct: 66  TPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYSPARSSN 104

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/33 (60%), Positives = 27/33 (81%)

Query: 1110 KPIAGSDVMTRYLEQLHHNTFVYAANILGATQD 1142
            + I GSDVM +YL Q+ H+TF+YAANILGA+ +
Sbjct: 1092 RTIPGSDVMAQYLAQVQHSTFMYAANILGASAE 1124

>YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putative
           RNA-binding protein that associates with mRNAs encoding
           cell wall proteins in high-throughput studies; deletion
           mutants display increased sensitivity to some cell wall
           disrupting agents; expression negatively regulated by
           cAMP
          Length = 1134

 Score =  387 bits (995), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 251/734 (34%), Positives = 371/734 (50%), Gaps = 160/734 (21%)

Query: 219 YSILPKGNDTYRSRSLLFTNVNSELDIVEFLQKVAKNYPIESIYLIKDEDTGDDIENLNT 278
           Y +LP G+D YR+RSLL  NV+  +D+   ++   K+  +ES YLI+             
Sbjct: 201 YKVLPTGDDAYRTRSLLIENVDHSIDLHSIVKNFVKSNTLESAYLIEG------------ 248

Query: 279 SXXXXXXXXXXXXXXXXXSKREDDKDKESAPALTKQIAISPSSCSQQSYLLSFFTKESCL 338
                              K +D KD E     TK ++I          L+SF TK  CL
Sbjct: 249 ------------------GKSDDSKDVE-----TKNLSI----------LISFLTKGDCL 275

Query: 339 DFYNNLLQRYAEIKNAVKSDQLAMNFVKIQDDEEWM------------------------ 374
           +FYNN+LQR +E K  +KS+ L + FV +  D + +                        
Sbjct: 276 NFYNNILQRLSEFKTFLKSEALNLKFVCLNYDPKCLPTFIESEALTENAEEADITNGSTM 335

Query: 375 --ANLKMNVISLGATRSLYVEFADDSVTSDTIWDTLPFLKNSG--KYXXXXXXXXXXXER 430
             A+L  N+ +  ATRS+ +EF      SD     L FL  S   +Y             
Sbjct: 336 ISASLHHNIANKDATRSIIIEFKSPVEKSDLFKKKLQFLDRSKNKRYILESIDLVNTDVP 395

Query: 431 RKNFGLHYCLLHFLSVTMALEVKELLE--TGDEAVSRVSFVTPA----NSADKEMRRRRS 484
              F  +Y +L FL+++MA+EV + L+  + +  +S+  +V+ A    +SA   +     
Sbjct: 396 SNQFPENYAVLTFLNISMAIEVLDYLKKYSKNLGISKCFYVSLAPLVVSSARSSVANIYE 455

Query: 485 SAISLKQEASPQMFSTDXXXXXXXXNVSLPLSEQVSTAS--TDISTPIY----------- 531
              S  + + P + + +        N +      ++T +  + I   +Y           
Sbjct: 456 GKTSTHRLSVPSVTAGNNNDSNNNGNNNKSNMSGITTLNNNSSIGVSVYGHSNMSLTSLS 515

Query: 532 ------EEFDG--------NLTWSTLIVDVSEYKEPIVNEFDHHLNSWSISKPTT----- 572
                 EE D          L  + L ++  +Y+ P + E   HL++  ISK T      
Sbjct: 516 SSVSLNEEIDMLATKLQGVELDGTYLEINYRDYQTPTIEEHSTHLSNVKISKTTENSRQF 575

Query: 573 -------------LYMHESGTTNFXXXXXXXXXXXXXXXXXXXVPQQMLLNEYPY----- 614
                        ++M++S  +N                    +PQQ++    P      
Sbjct: 576 SQDIPSPLPLNEHMFMNDSNQSN-----------------GAIIPQQLIATPSPVSPNLQ 618

Query: 615 IMEPLMPPQITQTIQNQY---SKSIQAVNAGMEHRTVYIGNINPRSKAEDICNVVRGGIL 671
           + + ++P  ITQ+++  +   +K   ++ + + +RT+YIGNINPRSKAEDICNVVRGGIL
Sbjct: 619 MNQRVLPNPITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNINPRSKAEDICNVVRGGIL 678

Query: 672 QHIKWVSHKRICFVTFIETAAAVQFYANTTLEPIILHGNVLKVGWGQNPGPLPKNIALAV 731
           Q IK++  K+ICFVTFIE  +AVQFYAN+ ++PI+LHGN+L+VGWG   GPLPK I+LAV
Sbjct: 679 QSIKYIPEKKICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKLISLAV 738

Query: 732 TVGASRNVYVSLPDKAFKDKFINDPQFKEYQNRYKIPNIAQLKSDFGAYGTMEQVNFHSD 791
           T+GASRNVYVSLP+ AFK+KFI+DPQ+K+      +P+  QL+ DF  YG +EQ+N+ SD
Sbjct: 739 TIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQINYLSD 798

Query: 792 GHCCWINFMNISSAIKLVEEY-------SDTKDNLFHKKTE----GRYVGLIIGYGKDRC 840
            HCCWINFMNISSAI LVEE        +++ +    + TE    GRY GL+I YGKDRC
Sbjct: 799 SHCCWINFMNISSAISLVEEMNKESTVQNESGEVTLKRATEEKFGGRYKGLLINYGKDRC 858

Query: 841 GNINRNLVFNKNGK 854
           GNIN+NL+  KN +
Sbjct: 859 GNINKNLIAGKNSR 872

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 34/49 (69%), Gaps = 3/49 (6%)

Query: 1097 EGANNGNPRKSSM---KPIAGSDVMTRYLEQLHHNTFVYAANILGATQD 1142
            E ANN   ++ S    + I GSDVM +YL Q+ H+TF+YAANILGA+ +
Sbjct: 1079 ETANNRKKKRGSFARHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAE 1127

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/31 (64%), Positives = 25/31 (80%), Gaps = 2/31 (6%)

Query: 71 TPFDPVYGITLLPSHLLVGSPFVNTP--QTG 99
          TPFD  YG +L PSHLL+GSPFV++P  Q+G
Sbjct: 66 TPFDTAYGASLFPSHLLMGSPFVSSPNMQSG 96

>Skud_13.24 Chr13 (33966..37352) [3387 bp, 1128 aa] {ON} YML117W
           (REAL)
          Length = 1128

 Score =  377 bits (967), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 250/732 (34%), Positives = 362/732 (49%), Gaps = 150/732 (20%)

Query: 215 IQFQYSILPKGNDTYRSRSLLFTNVNSELDIVEFLQKVAKNYPIESIYLIKDEDTGDDIE 274
            +  Y ILP G+D YR+RSLL  NV+   D+   ++   K   +ES Y + D D  DD+E
Sbjct: 196 FRINYKILPTGDDAYRTRSLLIENVDRSTDLHSLVKNFVKFNTLESAYFV-DNDKNDDLE 254

Query: 275 NLNTSXXXXXXXXXXXXXXXXXSKREDDKDKESAPALTKQIAISPSSCSQQSYLLSFFTK 334
           +  T                                               S L+SF T+
Sbjct: 255 DGETENL--------------------------------------------SVLISFLTR 270

Query: 335 ESCLDFYNNLLQRYAEIKNAVKSDQLAMNFVKIQDDEEWM-------------------- 374
             CL+FYNN+LQR +E K  +KS  L + FV +  + E +                    
Sbjct: 271 SDCLNFYNNILQRLSEFKIFLKSKSLNLKFVCLNYESECLSTFVEGEKPKEVDEQVHAAN 330

Query: 375 ------ANLKMNVISLGATRSLYVEFADDSVTSDTIWDTLPFLKNSG--KYXXXXXXXXX 426
                 A+L  +V +  ATRS+ +EF      ++     L FL  S   +Y         
Sbjct: 331 DSMMISASLHHDVENKDATRSIIIEFKSALEKTELFRKRLQFLDESKNKRYILESIDLVN 390

Query: 427 XXERRKNFGLHYCLLHFLSVTMALEVKELLETGDEA--VSRVSFV--TP--ANSADKEMR 480
                  F  +Y +L FL++ MA+EV + L+   ++  +S+  +V  TP   +S    + 
Sbjct: 391 TDVPSNQFPENYAVLTFLNIFMAVEVLDYLKKFSKSLEISKCFYVSLTPLMVSSTRSSVA 450

Query: 481 RRRSSAISLKQEASPQMFSTDXXXXXXXXNVSLPLSEQVSTASTDISTPIY--------- 531
               S  + ++ + P + +          N     S      ++ I + IY         
Sbjct: 451 NIYESKTTTRRLSVPSVPAGIKNDNNNNSNKGNISSINAQNNNSSIGSSIYGNSNISLTS 510

Query: 532 --------EEFDG--------NLTWSTLIVDVSEYKEPIVNEFDHHLNSWSISK------ 569
                   EE D          L  ++L +   +Y  P +NE   HL++  ISK      
Sbjct: 511 LSSSVSLNEEIDLLTTKLQGIELDGTSLEITSHDYSTPTINEHSTHLSNIKISKTVENSR 570

Query: 570 ------PTTLYMHESGTTNFXXXXXXXXXXXXXXXXXXXVPQQMLLNEYPY-----IMEP 618
                 P+ L ++E    N                    +PQQ++    P      I + 
Sbjct: 571 HFPQDIPSPLPLNEQMFMN-----------DSNQSNGAVIPQQLIAAPSPLSSNLQINQR 619

Query: 619 LMPPQITQTIQNQY---SKSIQAVNAGMEHRTVYIGNINPRSKAEDICNVVRGGILQHIK 675
           ++P  ITQ+++  +   +K   ++ + + +RT+YIGNINPRS+AEDICNVVRGGILQ IK
Sbjct: 620 VLPNAITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIK 679

Query: 676 WVSHKRICFVTFIETAAAVQFYANTTLEPIILHGNVLKVGWGQNPGPLPKNIALAVTVGA 735
           ++  KRI FVTFIE  +AVQFYAN+ ++PI+LHGN+L+VGWG   GPLPK+I+LAVT+GA
Sbjct: 680 YIPEKRISFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGA 739

Query: 736 SRNVYVSLPDKAFKDKFINDPQFKEYQNRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCC 795
           SRNVYVSLP+ AFK+KFI+DPQ+K+      +P+  QL+ DF  YG +EQ+N+ SD HCC
Sbjct: 740 SRNVYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQINYLSDSHCC 799

Query: 796 WINFMNISSAIKLVEEYSDTKDNLFH-------------KKTEGRYVGLIIGYGKDRCGN 842
           WINFMNISSAI LVEE +  K+++ H             +K +GRY GL+I YGKDRCGN
Sbjct: 800 WINFMNISSAIGLVEEMN--KESMAHHDGGEVIVKTAGEEKFDGRYKGLLINYGKDRCGN 857

Query: 843 INRNLVFNKNGK 854
           IN+NLV  KN +
Sbjct: 858 INKNLVAGKNSR 869

 Score = 53.9 bits (128), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 40/64 (62%), Gaps = 3/64 (4%)

Query: 1089 SFVPVAQHEGANNGNPRKSSM---KPIAGSDVMTRYLEQLHHNTFVYAANILGATQDPVF 1145
            SF      E ANN   ++ S+   + I GSDVM +YL Q+ H+TF+YAANILGA+ +   
Sbjct: 1065 SFQDSRNAETANNRERKRGSLPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNA 1124

Query: 1146 YDED 1149
            Y E+
Sbjct: 1125 YSEE 1128

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 27/39 (69%)

Query: 71  TPFDPVYGITLLPSHLLVGSPFVNTPQTGGPMSAGTGAN 109
           TPFD  YG +LLPSHLL+GSPFV++P   G  S    +N
Sbjct: 66  TPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYSPARSSN 104

>Ecym_4615 Chr4 complement(1199802..1203005) [3204 bp, 1067 aa] {ON}
           similar to Ashbya gossypii ABL122C
          Length = 1067

 Score =  347 bits (890), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 173/320 (54%), Positives = 220/320 (68%), Gaps = 8/320 (2%)

Query: 614 YIMEPLMPPQITQTIQNQYSKSIQAVNAGMEHRTVYIGNINPRSKAEDICNVVRGGILQH 673
           Y M+P+    I Q +Q QY      V  G  +RTVYIGNI+PRSK EDICNVVRGGILQ+
Sbjct: 538 YFMDPMSGAPINQALQRQYLTGTGQV-GGSNNRTVYIGNIHPRSKPEDICNVVRGGILQN 596

Query: 674 IKWVSHKRICFVTFIETAAAVQFYANTTLEPIILHGNVLKVGWGQNPGPLPKNIALAVTV 733
           IKW+  KRICFVTFIE AAA+QFYAN +LEPI+LHGN+L+VGWGQ  G LPKNIALAVT+
Sbjct: 597 IKWIHSKRICFVTFIEAAAAIQFYANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTI 656

Query: 734 GASRNVYVSLPDKAFKDKFINDPQFKEYQNRYKIPNIAQLKSDFGAYGTMEQVNFHSDGH 793
           GASRNVYVSLP+ +FK+K+IN+P+FKEY  +YK+P+  QL+ DF  YG +EQ+N+  DGH
Sbjct: 657 GASRNVYVSLPEYSFKEKYINNPEFKEYHGKYKLPSEEQLRQDFTKYGQVEQINYLDDGH 716

Query: 794 CCWINFMNISSAIKLVEEY-SDTKDNL--FHKKTEGRYVGLIIGYGKDRCGNINRNLVFN 850
           CCW+NFMNI+ AI+LVE+  S ++ NL  FH + +GRY  LIIGYGKDRCGN+N+NL  N
Sbjct: 717 CCWVNFMNIAHAIRLVEDCNSLSQRNLEKFHAQFDGRYKNLIIGYGKDRCGNVNKNLTAN 776

Query: 851 KNGKGXXXXXXXXXXXXXRGHRQRKQSATFSNASNIDLKHSSVANASIANGKLDRPMDNK 910
           KN +                 +Q K+    S+AS+ D +    +   +     +   D  
Sbjct: 777 KNSRFFKKIKKLNCTTKPNKRQQSKRGT--SSASSDDARKDDASTEKVPVSSKEPVCD-- 832

Query: 911 NFLSLGVDADFSEGLGISIS 930
             L L  D   +EGLGIS+S
Sbjct: 833 EILGLNDDNALAEGLGISLS 852

 Score =  133 bits (335), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 90/255 (35%), Positives = 143/255 (56%), Gaps = 25/255 (9%)

Query: 325 QSYLLSFFTKESCLDFYNNLLQRYAEIKNAVKSDQLAMNFVKIQDDEEWMANLKMNVISL 384
            S LLSF TK +CLDFYNNLLQR++E K+ + S +L+++FV  QD+  W   L+MNV++ 
Sbjct: 214 HSILLSFLTKATCLDFYNNLLQRFSEFKSKLHSTKLSVSFV-CQDETNWFRLLQMNVVTR 272

Query: 385 GATRSLYVEFADDS--VTSDTIWDTLPFLKNSGKYX-XXXXXXXXXXERRKNFGLHYCLL 441
           G TRSL +EF D S  +TSD I + +P+L  S ++             + +NF   Y L+
Sbjct: 273 GVTRSLCIEFEDQSMELTSDLIHEKIPWLFFSHRFVIERIDLVNAAAPKNQNFNNRYLLI 332

Query: 442 HFLSVTMALEVKELLETGDE----AVSRVSFV-TPANSADKEMRRRRSSAISLKQEASPQ 496
           HF+ ++MALEV+E L+   +     +S++ FV    +S+D       ++A  L++E+   
Sbjct: 333 HFICISMALEVEEYLQQASQKKQLGISKIQFVNVNGHSSDLSDEDAVAAANGLQRESRTS 392

Query: 497 MFSTDXXXXXXXXNVSLPLSEQVSTASTDISTPIYEEFDGNLTWSTLIVDVSEYKEPIVN 556
             S+          +SLP+S      S+D+   ++   D  L   +L V  SEY  P++ 
Sbjct: 393 SVSS----------ISLPISN-----SSDL-VELFHSLDLALGIISLQVIPSEYPVPLIE 436

Query: 557 EFDHHLNSWSISKPT 571
             D HL+S +IS+P+
Sbjct: 437 SHDDHLHSVTISRPS 451

 Score = 61.6 bits (148), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/41 (70%), Positives = 35/41 (85%), Gaps = 3/41 (7%)

Query: 1110 KPIAGSDVMTRYLEQLHHNTFVYAANILGAT--QDPV-FYD 1147
            KPIAG DVM++YLEQLHH+TF+Y+ NILGAT   DP+ FYD
Sbjct: 1021 KPIAGQDVMSQYLEQLHHSTFLYSTNILGATTVHDPLGFYD 1061

 Score = 57.0 bits (136), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 47/87 (54%), Gaps = 10/87 (11%)

Query: 70  QTPFDPVYGITLLPSHLLVGSPFVNTPQTGGPMSAGTGANGVPVGSNNIMNLRNSSYKSF 129
           QTPFDP YG +LLPSH+L+GSPFV+TP            +  P  S++  + R+  Y   
Sbjct: 84  QTPFDPTYGASLLPSHMLMGSPFVSTPMR-------PQGHFHPSASSHSNHSRSFLY--- 133

Query: 130 YPPAPKLRPAPSGRLRRARRKDNKPQQ 156
           YP  P L+P P  R +      ++P Q
Sbjct: 134 YPQPPILKPIPPRRRKSFSLNHSEPYQ 160

 Score = 52.4 bits (124), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 27/53 (50%), Positives = 33/53 (62%), Gaps = 2/53 (3%)

Query: 216 QFQYSILPKGNDTYRSRSLLFTNVNSE--LDIVEFLQKVAKNYPIESIYLIKD 266
           Q  + ILPKG D Y +RSLLF+N+  +   DI  FL    K  PIESIYL+ D
Sbjct: 160 QVNFKILPKGKDEYMTRSLLFSNLERQENFDIHNFLTNFIKFGPIESIYLLDD 212

>KAFR0A02850 Chr1 complement(590196..593324) [3129 bp, 1042 aa] {ON}
           Anc_8.844 YML117W
          Length = 1042

 Score =  333 bits (855), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 156/253 (61%), Positives = 196/253 (77%), Gaps = 5/253 (1%)

Query: 605 QQMLLNEYPYIMEPLMPPQITQTIQNQYSKSIQ---AVNAGMEHRTVYIGNINPRSKAED 661
           Q   + E P+     + P IT +++NQ S S +   A+ +   +RT+YIGNINPRSKAED
Sbjct: 566 QNTQIQEAPFRSNSFIHP-ITDSLENQLSTSAKVASAMGSDAGNRTIYIGNINPRSKAED 624

Query: 662 ICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTLEPIILHGNVLKVGWGQNPG 721
           ICNVVRGGILQ IK++  K ICFVTFIE AAAVQFYAN  ++PI+LHGN LK+GWG   G
Sbjct: 625 ICNVVRGGILQSIKFIESKHICFVTFIEAAAAVQFYANAFIDPIVLHGNTLKLGWGNYSG 684

Query: 722 PLPKNIALAVTVGASRNVYVSLPDKAFKDKFINDPQFKEYQNRYKIPNIAQLKSDFGAYG 781
           PLPK+IALAVT+GASRNVYVSLP+ AFKDK+INDP+FKEY  ++K+P+  QL+ DF +YG
Sbjct: 685 PLPKSIALAVTIGASRNVYVSLPEFAFKDKYINDPEFKEYHEKFKLPDPEQLRIDFSSYG 744

Query: 782 TMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHKKTEGRYVGLIIGYGKDRCG 841
             EQ+N+ SD HCCW+NFMNISSAIKLVEE ++  D  F++K + RY GL+I YGKDRCG
Sbjct: 745 PTEQINYLSDSHCCWVNFMNISSAIKLVEEATNDFDR-FNEKFDERYNGLVINYGKDRCG 803

Query: 842 NINRNLVFNKNGK 854
           NIN+NL+  KN +
Sbjct: 804 NINKNLIAGKNSR 816

 Score =  107 bits (266), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 74/271 (27%), Positives = 123/271 (45%), Gaps = 67/271 (24%)

Query: 215 IQFQYSILPKGNDTYRSRSLLFTNVNSELDIVEFLQKVAKNYPIESIYLIKDEDTGDDIE 274
           I   Y ILPKG+D YR+RSLLF NV++ +++  F+    KN  IESIYL+ +++  +   
Sbjct: 181 INISYVILPKGDDAYRTRSLLFENVDNAINLHSFITNFVKNNSIESIYLVPNKNDSN--- 237

Query: 275 NLNTSXXXXXXXXXXXXXXXXXSKREDDKDKESAPALTKQIAISPSSCSQQSYLLSFFTK 334
                                                         +C     +LSF ++
Sbjct: 238 ----------------------------------------------TCD---IILSFLSR 248

Query: 335 ESCLDFYNNLLQRYAEIKNAVKSDQLAMNFVKIQDDEEWMAN----LKMNVISLGATRSL 390
             CLDFYNN+LQR  E K  + S+ L +NFV ++ ++    N    L+ N+++  ATRSL
Sbjct: 249 HICLDFYNNVLQRLKEFKKHLNSESLNLNFVSLKYNKTTRDNQGPSLEFNIVTRDATRSL 308

Query: 391 YVEFADDSVTS---------DTIWDTLPFLKNSGKYXXXXXXXXXXXERRKNFGLHYCLL 441
            +E   +   S         + I + +     + +Y           +  K FG +Y +L
Sbjct: 309 AIELCSNENDSLILEKEQLFEKILNEILRTDENKRYVLESIDLVSTDKSNKEFGKNYAIL 368

Query: 442 HFLSVTMALEVKELLE--TGDEAVSRVSFVT 470
            FL++TMA+E+ + ++  +    + + SFVT
Sbjct: 369 SFLNITMAIEIMDYIQVISSKLNIGKCSFVT 399

 Score = 55.1 bits (131), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 24/37 (64%), Positives = 30/37 (81%)

Query: 1112 IAGSDVMTRYLEQLHHNTFVYAANILGATQDPVFYDE 1148
            I GSDVM +YL QL H+TF+YAANILGA+ +  +YDE
Sbjct: 997  IPGSDVMAQYLAQLQHSTFMYAANILGASGEEEYYDE 1033

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/31 (64%), Positives = 24/31 (77%)

Query: 71  TPFDPVYGITLLPSHLLVGSPFVNTPQTGGP 101
           TPFD  YG TLLPSHLL+GSPF+++P    P
Sbjct: 76  TPFDTAYGATLLPSHLLMGSPFISSPNVPTP 106

>NDAI0E00270 Chr5 (33295..36891) [3597 bp, 1198 aa] {ON} Anc_8.844
          Length = 1198

 Score =  332 bits (850), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 153/242 (63%), Positives = 197/242 (81%), Gaps = 5/242 (2%)

Query: 617 EPLMPPQITQTIQNQYSKSIQ-AVNAGME--HRTVYIGNINPRSKAEDICNVVRGGILQH 673
           +P M P I +T++++++ S Q A + G+E  +RT+YIGN+NPRSKAED+CNVVRGGILQ 
Sbjct: 697 DPTMYP-IVRTLEDKFNTSAQVASSMGVEMGNRTIYIGNLNPRSKAEDVCNVVRGGILQS 755

Query: 674 IKWVSHKRICFVTFIETAAAVQFYANTTLEPIILHGNVLKVGWGQNPGPLPKNIALAVTV 733
           IK ++ KRICFVTFIE +AAVQFYAN+ ++P+ILHGN LK+GWG    PL K+IALAVT+
Sbjct: 756 IKLIASKRICFVTFIEASAAVQFYANSFIDPLILHGNTLKIGWGNYYEPLSKSIALAVTI 815

Query: 734 GASRNVYVSLPDKAFKDKFINDPQFKEYQNRYKIPNIAQLKSDFGAYGTMEQVNFHSDGH 793
           GASRNVYVSLP+ AFKDKF+NDP++KE+  +YK+P+  QL+ DF  YG +EQ+N+ SD H
Sbjct: 816 GASRNVYVSLPEFAFKDKFLNDPEYKEFHEKYKLPSEQQLRFDFNKYGPIEQINYLSDSH 875

Query: 794 CCWINFMNISSAIKLVEEYSDT-KDNLFHKKTEGRYVGLIIGYGKDRCGNINRNLVFNKN 852
           CCW+NFMNI+SAIKLVE+ ++  KDN F KK   RY GLII YGKDRCGN+NRNL+ NKN
Sbjct: 876 CCWVNFMNITSAIKLVEDVNNNPKDNTFSKKFNHRYDGLIINYGKDRCGNVNRNLISNKN 935

Query: 853 GK 854
            +
Sbjct: 936 SR 937

 Score = 84.7 bits (208), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 53/147 (36%), Positives = 72/147 (48%), Gaps = 43/147 (29%)

Query: 219 YSILPKGNDTYRSRSLLFTNVNSELDIVEFLQKVAKNYPIESIYLIKDEDTGDDIENLNT 278
           Y +LP G+D YR+RSLLF+NV S +D+  F+    +   IESIYLI + D   D +N   
Sbjct: 189 YKLLPTGDDAYRTRSLLFSNVASSIDLHSFIYDFVQYSSIESIYLISNTDDEKDQDN--- 245

Query: 279 SXXXXXXXXXXXXXXXXXSKREDDKDKESAPALTKQIAISPSSCSQQSYLLSFFTKESCL 338
                                E+DK+K                   +S LLSF ++E CL
Sbjct: 246 ---------------------ENDKNK-------------------RSILLSFLSREICL 265

Query: 339 DFYNNLLQRYAEIKNAVKSDQLAMNFV 365
            FYNN+LQR  E K  ++S  L +NFV
Sbjct: 266 SFYNNVLQRLNEFKTNLQSKSLTLNFV 292

 Score = 52.8 bits (125), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 39/59 (66%), Gaps = 5/59 (8%)

Query: 1098 GANNGNPRKSS----MKPIAGSDVMTRYLEQLHHNTFVYAANILGAT-QDPVFYDEDNA 1151
            G  + +P  SS     + I G+DVM +YL QL H+TF+YAANILG + +D  +YDE++ 
Sbjct: 1139 GIQDQDPHLSSTGKQQRVIPGADVMAQYLTQLQHSTFMYAANILGVSAEDNTYYDEEDT 1197

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/33 (66%), Positives = 25/33 (75%)

Query: 71  TPFDPVYGITLLPSHLLVGSPFVNTPQTGGPMS 103
           TPFD  YG TLLPSHLL+GSP+V+TP    P S
Sbjct: 85  TPFDTAYGATLLPSHLLMGSPYVSTPNGIVPSS 117

>Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp,
           1032 aa] {ON} (7832..9475,9855..9863,10320..11765) [3099
           nt, 1033 aa]
          Length = 1032

 Score =  324 bits (830), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 151/239 (63%), Positives = 183/239 (76%), Gaps = 4/239 (1%)

Query: 620 MPPQITQTIQNQYSKSIQAVN---AGMEHRTVYIGNINPRSKAEDICNVVRGGILQHIKW 676
           M  Q+ +  ++Q++ S +  N    G  +RTVYIGNINPRSKAEDICNVVRGG LQ IK+
Sbjct: 552 MLHQLLRASKHQFATSAEIANTMGGGAGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKF 611

Query: 677 VSHKRICFVTFIETAAAVQFYANTTLEPIILHGNVLKVGWGQNPGPLPKNIALAVTVGAS 736
              K ICFVTFIE A+A QFYAN+ ++PIILH N L+VGWG + GPLPK+I+LAVTVGAS
Sbjct: 612 FKEKGICFVTFIEAASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGAS 671

Query: 737 RNVYVSLPDKAFKDKFINDPQFKEYQNRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCW 796
           RNVYVSLP+ AFKDKFINDP++KEY N+Y +P   +L+ DF  +G MEQVNF +DGHCCW
Sbjct: 672 RNVYVSLPEYAFKDKFINDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCW 731

Query: 797 INFMNISSAIKLVEEY-SDTKDNLFHKKTEGRYVGLIIGYGKDRCGNINRNLVFNKNGK 854
           INFMNI SAIKLVE   S      FH++   RY GLIIGYGKDRCGN+N++L+  KN K
Sbjct: 732 INFMNIRSAIKLVESVNSSNGGKTFHERYANRYKGLIIGYGKDRCGNVNKSLISGKNSK 790

 Score =  100 bits (248), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 79/275 (28%), Positives = 126/275 (45%), Gaps = 44/275 (16%)

Query: 214 KIQFQYSILPKGNDTYRSRSLLFTNVNSELDIVEFLQKVAKNYPIESIYLIKDEDTGDDI 273
           +    Y +LPKGND Y++RSLLF NV+  +D+  F++K     PIES+YLI         
Sbjct: 250 RFTISYKVLPKGNDEYQTRSLLFENVDKSVDLHCFIKKFVNFGPIESVYLINSNGI---- 305

Query: 274 ENLNTSXXXXXXXXXXXXXXXXXSKREDDKDKESAPALTKQIAISPSSCSQQSYLLSFFT 333
                                  +   +D D  +    T+ I +S            F +
Sbjct: 306 ----------YDNNKNNDDYDDDNDNNNDNDDNANNHDTQSILLS------------FLS 343

Query: 334 KESCLDFYNNLLQRYAEIKNAVKSDQLAMNFVKIQ-------DDEE------WMANLKMN 380
           +  CLDFYN++LQR +E K  + S+ L ++FV ++       DDEE         +L+ +
Sbjct: 344 RPICLDFYNSVLQRLSEFKTQLNSNDLTLSFVLLKYKNQDRPDDEESDFSPALPLSLEYD 403

Query: 381 VISLGATRSLYVEFADDSVTSDTIWDT-LPFL--KNSGKYXXXXXXXXXXXERRKNFGLH 437
           +I  GATRS+ VEF     + +   ++ L FL    + +Y           ER  N   +
Sbjct: 404 IIKRGATRSIAVEFNQPITSKEGFMNSKLSFLLSPENKRYIIESVDIINAAERDANLPKN 463

Query: 438 YCLLHFLSVTMALEVKE--LLETGDEAVSRVSFVT 470
             +L FL+++M ++V +   LE  D  +S+  FVT
Sbjct: 464 TVILTFLNISMTVDVMDRIRLERKDSGISKCVFVT 498

 Score = 59.7 bits (143), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 36/45 (80%), Gaps = 1/45 (2%)

Query: 1106 KSSMKPIAGSDVMTRYLEQLHHNTFVYAANILGATQD-PVFYDED 1149
            K + K + GSDVM++YL QL H+TF+YAANILGA+ D P FYDE+
Sbjct: 981  KKNKKLLPGSDVMSQYLAQLQHSTFMYAANILGASSDEPEFYDEN 1025

 Score = 56.6 bits (135), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 38/73 (52%), Gaps = 5/73 (6%)

Query: 71  TPFDPVYGITLLPSHLLVGSPFVNTPQTGGPMSAGTGANGVPVGSNNIMNLRNSSYKSFY 130
           TPFD  YG +LLPSHLL+GSPFV+TP  G   S          G N++  L      S Y
Sbjct: 124 TPFDSAYGASLLPSHLLMGSPFVSTPTMGQSYSQQFARPSPSKGGNSMGRL-----SSAY 178

Query: 131 PPAPKLRPAPSGR 143
           P  P +   PS R
Sbjct: 179 PAPPTINLPPSSR 191

>Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W
           (REAL)
          Length = 1122

 Score =  324 bits (830), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 170/355 (47%), Positives = 225/355 (63%), Gaps = 54/355 (15%)

Query: 537 NLTWSTLIVDVSEYKEPIVNEFDHHLNSWSISK------------PTTL------YMHES 578
           +L  + L V   +Y  P++NE   HL++  ISK            P+ L      +M +S
Sbjct: 526 DLDGTILEVTCHDYPTPVINEHSAHLSNIKISKTVDNSRQFTQDIPSPLPLNEHMFMTDS 585

Query: 579 GTTNFXXXXXXXXXXXXXXXXXXXVPQQMLLNEYPYIMEPLM-----PPQITQTIQNQY- 632
             +N                    V QQ++    P    P M     P  ITQ+++  + 
Sbjct: 586 NQSN-----------------GTIVSQQLITAPSPQSPNPQMNQRVLPNPITQSLEQNFN 628

Query: 633 --SKSIQAVNAGMEHRTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIET 690
             +K   ++ + + +RT+YIGNINPRS+AEDICNVVRGGILQ+IK+++ KRICFVTFIE 
Sbjct: 629 VSAKVASSMGSDIGNRTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEA 688

Query: 691 AAAVQFYANTTLEPIILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVYVSLPDKAFKD 750
           A+AVQFYAN+ ++PI+LHGN+L+VGWG   GPLPK+I+LAVT+GASRNVYVSLP+ AFK+
Sbjct: 689 ASAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKE 748

Query: 751 KFINDPQFKEYQNRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVE 810
           KFI+DPQ+K+      +P+  QL+ DF  YG +EQ+N+ SD HCCWINFMNISSAI LVE
Sbjct: 749 KFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVE 808

Query: 811 EYS------DTKDNLFHK-----KTEGRYVGLIIGYGKDRCGNINRNLVFNKNGK 854
           E +      D    L  K     K +GRY GL+I YGKDRCGNIN+NLV  KN +
Sbjct: 809 EMNEEPTGHDDSGELIPKTATEEKFDGRYKGLLINYGKDRCGNINKNLVAGKNSR 863

 Score =  108 bits (271), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 112/425 (26%), Positives = 169/425 (39%), Gaps = 104/425 (24%)

Query: 71  TPFDPVYGITLLPSHLLVGSPFVNTPQTGGPMSAGTG------ANGVPVGSNNIMNLRNS 124
           TPFD  YG +LLPSHLL+GSPFV++P   G  + G        A   P+ S N  N  ++
Sbjct: 66  TPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYNLGRSSKFNRKAYSRPISSQNSYNANHN 125

Query: 125 SYKSFYPPAPKLRPAPSGRLRRARRKDNKPQQQREHSRDNNKVEAEYDVEXXXXXXXXXX 184
           +  +       +   PS   R  R   ++        +DNN V   +++           
Sbjct: 126 NNNNNSNSNNGMM-TPSSYYRNGRTLFSR--------KDNNAVNVTHNIHKGYETRNSSG 176

Query: 185 XXXXXXXXXXXXXXXXXXXXXXKTIDSELKIQ----FQYSILPKGNDTYRSRSLLFTNVN 240
                                   ID E  +Q      Y ILP G+D YR+RSLL  NV+
Sbjct: 177 RRTSSRINIF------------DEIDPETLLQKPFRINYKILPAGDDAYRTRSLLIENVD 224

Query: 241 SELDIVEFLQKVAKNYPIESIYLIKDEDTGDDIENLNTSXXXXXXXXXXXXXXXXXSKRE 300
              D+   ++   K+  +ES Y++                                SK  
Sbjct: 225 DSADLHSLVKNFVKSNALESAYIV-------------------------------GSKET 253

Query: 301 DDKDKESAPALTKQIAISPSSCSQQSYLLSFFTKESCLDFYNNLLQRYAEIKNAVKSDQL 360
           D+ +KE     TK ++I          L+SF T+  CL+FYNN+LQR +E K  +KS  L
Sbjct: 254 DNLEKEE----TKNLSI----------LISFLTRGDCLNFYNNILQRLSEFKTFLKSKSL 299

Query: 361 AMNFVKIQ----------DDEEW----------------MANLKMNVISLGATRSLYVEF 394
            + FV +           +DEE                  A+L  +V +  ATRS+ +EF
Sbjct: 300 NLKFVCLNYDSKSLPTPVEDEELSRSEEQAATDDASTMISASLHHDVENKDATRSIIIEF 359

Query: 395 ADDSVTSDTIWDTLPFLKNS--GKYXXXXXXXXXXXERRKNFGLHYCLLHFLSVTMALEV 452
                 ++   + L FL  S   +Y                F  +Y +L FL++ MA+EV
Sbjct: 360 KSPLEKAELFKEKLQFLDRSKNKRYILESIDIVDTDVPSNQFPENYVVLTFLNIFMAIEV 419

Query: 453 KELLE 457
            + L+
Sbjct: 420 LDYLK 424

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/40 (57%), Positives = 31/40 (77%), Gaps = 1/40 (2%)

Query: 1110 KPIAGSDVMTRYLEQLHHNTFVYAANILGAT-QDPVFYDE 1148
            + I GSDVM +YL Q+ H+TF+YAANILGA+ +D  + DE
Sbjct: 1083 RTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNAYSDE 1122

>TBLA0B03280 Chr2 complement(764832..768920) [4089 bp, 1362 aa] {ON}
            Anc_8.844 YML117W
          Length = 1362

 Score =  325 bits (833), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 146/234 (62%), Positives = 184/234 (78%), Gaps = 3/234 (1%)

Query: 624  ITQTIQNQYSKSIQ---AVNAGMEHRTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHK 680
            +TQT++N ++ S +    +  G  +RTVYIGNINPRSK ED+CNVVRGGILQ I ++  K
Sbjct: 801  LTQTLENHFNTSTELSAVLGGGPGNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDK 860

Query: 681  RICFVTFIETAAAVQFYANTTLEPIILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVY 740
             ICFVTFIE   A QF+AN  ++PI+LHGN+LKVGWG + GPLPK+I+LAVT+GA+RNVY
Sbjct: 861  HICFVTFIEATNAAQFFANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVY 920

Query: 741  VSLPDKAFKDKFINDPQFKEYQNRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFM 800
            VSLP+ AFKDKFIN+P +++Y   YK+PN  QL+ DF  YG +EQ+N+ +DGHCCWINFM
Sbjct: 921  VSLPEFAFKDKFINNPDYEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFM 980

Query: 801  NISSAIKLVEEYSDTKDNLFHKKTEGRYVGLIIGYGKDRCGNINRNLVFNKNGK 854
            NI+SAI LVEE ++     FH K +GRY GLIIGYGKDRCGN+N+NLV  KN K
Sbjct: 981  NINSAITLVEEVNEDDGIRFHNKFDGRYNGLIIGYGKDRCGNVNKNLVATKNSK 1034

 Score = 73.2 bits (178), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 67/157 (42%), Gaps = 52/157 (33%)

Query: 212 ELKIQFQYSILPKGNDTYRSRSLLFTNVNSELDIVEFLQKVAKNYPIESIYLIKDEDTGD 271
           E+ +   Y ILPKG D +R+RSLL  N+N  +D    ++      PIES+YLIK      
Sbjct: 258 EIPLVVSYKILPKGTDEFRTRSLLLENINQSIDTRTLVKNFINFGPIESVYLIK------ 311

Query: 272 DIENLNTSXXXXXXXXXXXXXXXXXSKREDDKDKESAPALTKQIAISPSSCSQQSYLLSF 331
                                                        ++P S    S LLSF
Sbjct: 312 ---------------------------------------------LNPGS-KYNSILLSF 325

Query: 332 FTKESCLDFYNNLLQRYAEIKNAVKSDQLAMNFVKIQ 368
            ++E CLDFYNN+LQR  E K  + S  L ++FV ++
Sbjct: 326 VSREICLDFYNNVLQRLMEFKTELSSKSLTLSFVILK 362

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 33/45 (73%)

Query: 1098 GANNGNPRKSSMKPIAGSDVMTRYLEQLHHNTFVYAANILGATQD 1142
            G  N N  +++ K I GSDVM++YL QL H+TF+YAANILG + +
Sbjct: 1304 GPRNKNKNRNTRKTIPGSDVMSQYLTQLQHSTFMYAANILGVSAE 1348

 Score = 53.9 bits (128), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/43 (55%), Positives = 28/43 (65%)

Query: 71  TPFDPVYGITLLPSHLLVGSPFVNTPQTGGPMSAGTGANGVPV 113
           TPFDP YG TLLPSHLL+GSPFV+TP       + T  +  P 
Sbjct: 107 TPFDPSYGATLLPSHLLMGSPFVSTPNIHSFPYSATSISSTPT 149

>KNAG0G03440 Chr7 complement(736829..739990) [3162 bp, 1053 aa] {ON}
           Anc_8.844 YML117W
          Length = 1053

 Score =  311 bits (797), Expect = 9e-89,   Method: Compositional matrix adjust.
 Identities = 144/234 (61%), Positives = 182/234 (77%), Gaps = 4/234 (1%)

Query: 624 ITQTIQNQYSKSIQ---AVNAGMEHRTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHK 680
           IT ++++Q   S Q   A+ +   +RT+YIGNINPRS+AEDICNVVRGGILQ+IK++  K
Sbjct: 578 ITDSLESQMKTSTQVATAMGSDFNNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAK 637

Query: 681 RICFVTFIETAAAVQFYANTTLEPIILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVY 740
            ICF+TFIE +AAVQFYAN  ++PI+LHGN LK+GWG   GPLPK IALAVT+GASRNVY
Sbjct: 638 HICFITFIEASAAVQFYANAFIDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVY 697

Query: 741 VSLPDKAFKDKFINDPQFKEYQNRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFM 800
           +SLP+ AFKDK+I DP+FK Y   +K+P    L+ DF  YG++EQ+N  +D HCCW+NFM
Sbjct: 698 ISLPEIAFKDKYIKDPKFKIYHESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFM 757

Query: 801 NISSAIKLVEEYSDTKDNLFHKKTEGRYVGLIIGYGKDRCGNINRNLVFNKNGK 854
           NISSAI+LVE+ S TK + F++  + RY GL+I YGKDRCGNINRNLV  K  K
Sbjct: 758 NISSAIRLVEDAS-TKQDHFNQLFDHRYEGLVINYGKDRCGNINRNLVAGKTSK 810

 Score = 98.2 bits (243), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 99/387 (25%), Positives = 161/387 (41%), Gaps = 79/387 (20%)

Query: 212 ELKIQFQYSILPKGNDTYRSRSLLFTNVNSELDIVEFLQKVAKNYPIESIYLIKDEDTGD 271
           ++  +  Y ILPKG+D YR+RSLL  N+                               D
Sbjct: 157 QIPFEISYKILPKGDDLYRTRSLLLGNI-------------------------------D 185

Query: 272 DIENLNTSXXXXXXXXXXXXXXXXXSKREDDKDKESAPALTKQIAISPSSCSQQSYLLSF 331
           D+ +L+T                  SK   +   ES   +TK+         +  +LLSF
Sbjct: 186 DMVDLHT----------------FVSKFVQNNSVESV-YITKE----GQQPEKYGFLLSF 224

Query: 332 FTKESCLDFYNNLLQRYAEIKNAVKSDQLAMNFVKIQ----------------DDEEWMA 375
            + + CL+FYNN+LQR  E K  +K+  L ++FV ++                DD + MA
Sbjct: 225 LSVQICLNFYNNVLQRLKEFKEQLKASSLELSFVSMRQRPTKVEGKIYRRFAADDGDGMA 284

Query: 376 NLKMNVIS-LGATRSLYVEFADDSV--TSDTIWD-TLPFL-KNSGKYXXXXXXXXXXXER 430
           NL  ++ +  GATRS+ +EF D  V  T D + +  L FL + + +Y             
Sbjct: 285 NLHFDMAAQTGATRSIAIEFVDKDVILTRDELLNKKLKFLSEGNNRYILEHIAVFKTQHG 344

Query: 431 RKNFGLHYCLLHFLSVTMALEVKELLETGDEAVSRVSFV------TPANSADKEMRRRRS 484
            K FG +Y ++ FLS+ MA+E+ + L+   + +    F        P  S     ++  +
Sbjct: 345 TKVFGKNYAIITFLSIPMAMEIMDYLKLNIKQLHLTKFFYVQVTHPPQQSPAASQKKPHA 404

Query: 485 SAISLKQEASPQMFSTDXXXXXXXXNVSLPLSEQVSTASTDISTPIYEEFDGNLTWSTLI 544
           +     ++ SP     D         +SL  SE  ++ + D+   + +     L  STL 
Sbjct: 405 NDTESNRDTSPPNSKKDQEFFPNNSMLSLVSSESSTSLADDVDGLVNKLKSIELQESTLK 464

Query: 545 VDVSEYKEPIVNEFDHHLNSWSISKPT 571
           + V +Y EP+  +F  H N    S P 
Sbjct: 465 LRVEDYPEPLFEQFSEHSNGIVQSLPV 491

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/26 (80%), Positives = 23/26 (88%)

Query: 71  TPFDPVYGITLLPSHLLVGSPFVNTP 96
           TPFD  YG TLLPSHLL+GSPFV+TP
Sbjct: 92  TPFDTAYGATLLPSHLLMGSPFVSTP 117

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 3/47 (6%)

Query: 1099 ANNGNPRKS---SMKPIAGSDVMTRYLEQLHHNTFVYAANILGATQD 1142
            A NG  R+    + + I GSDVM +YL QL H+TF+YAAN+LGA+ +
Sbjct: 999  AENGRHRQQLPRNARTIPGSDVMAQYLAQLQHSTFMYAANVLGASNE 1045

>NCAS0B00280 Chr2 (30005..33250) [3246 bp, 1081 aa] {ON} Anc_8.844
          Length = 1081

 Score =  310 bits (795), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 154/335 (45%), Positives = 216/335 (64%), Gaps = 18/335 (5%)

Query: 624 ITQTIQNQYSKSIQAVN---AGMEHRTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHK 680
           I++T++   + + Q VN   A   +RT+YIGNIN RSK EDICNVVRGGILQ++K++ HK
Sbjct: 596 ISKTLEQHATTTSQVVNSLGADAGNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHK 655

Query: 681 RICFVTFIETAAAVQFYANTTLEPIILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVY 740
            ICF+TFIE +AA+ FYAN+ ++PI+LH + LK+GWG    PLPK +ALAVTVGASRNVY
Sbjct: 656 HICFITFIEASAAIHFYANSFIDPIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVY 715

Query: 741 VSLPDKAFKDKFINDPQFKEYQNRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFM 800
           VSLP+ AFKDKFINDP+++EY  +YK+P   QL+ DF  YG +EQ+N+  D HCCW+NF+
Sbjct: 716 VSLPEFAFKDKFINDPEYQEYHQKYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFL 775

Query: 801 NISSAIKLVEEYSDTKDNLFHKKTEGRYVGLIIGYGKDRCGNINRNLVFNKNGK------ 854
           NIS+AI+LVE+  +  ++ F +K   RY GLII YGKDRCGN+N++L+ NKN +      
Sbjct: 776 NISAAIRLVEDAHNPVESKFSEKFNNRYDGLIINYGKDRCGNVNKSLMSNKNSRFYKKVK 835

Query: 855 ------GXXXXXXXXXXXXXRGHRQRKQSATFSNASNIDLKHSSVANASIANGKLDRPMD 908
                               R +  RK S++    S +D     +   +++N + D  ++
Sbjct: 836 SISNNVKLKELEEKRKADTERLNSLRKTSSSDGQLSKLDA--FGIGIDTVSNNEEDGNIE 893

Query: 909 NKNFLS-LGVDADFSEGLGISISPQAERRHVLSDN 942
             N LS +  D +    LG  I P+ +  +   DN
Sbjct: 894 KGNTLSKIDTDVNGFNALGFKIEPKHDMMNETMDN 928

 Score =  143 bits (360), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 142/521 (27%), Positives = 214/521 (41%), Gaps = 117/521 (22%)

Query: 71  TPFDPVYGITLLPSHLLVGSPFVNTPQTGGPMSAGTGANGVPVGSNNIMNLRNSSYKSFY 130
           TPFD  YG TLLPSHLL+GSPFV TP TG   SA        +     M   N +  S  
Sbjct: 81  TPFDTAYGATLLPSHLLMGSPFVATPTTGHSQSA--------IFQQPYMMTPNRASFSQI 132

Query: 131 PPAPKLRPAPSGRLRRARRKDNKPQQQREHSRDNNKVEAEYDVEXXXXXXXXXXXXXXXX 190
           P    +   PS     ARR+ N+    R  S   +KV  E D                  
Sbjct: 133 PSMLNVGNPPS-----ARRQGNQNDPNRRRSSYRSKV-PETD------------------ 168

Query: 191 XXXXXXXXXXXXXXXXKTIDSELKIQFQYSILPKGNDTYRSRSLLFTNVNSELDIVEFLQ 250
                           KT+  +   +  Y ILP G+D YR+RSLLF NV + +++  F+ 
Sbjct: 169 ---------------PKTLFLQ-PFRMSYKILPSGDDAYRTRSLLFENVVNSIELHTFMT 212

Query: 251 KVAKNYPIESIYLIKDEDTGDDIENLNTSXXXXXXXXXXXXXXXXXSKREDDKDKESAPA 310
           +  +  PIES+YLI   D+                            K +DD        
Sbjct: 213 EFVRFSPIESVYLINHHDS---------------------------DKPDDD-------- 237

Query: 311 LTKQIAISPSSCSQQSYLLSFFTKESCLDFYNNLLQRYAEIKNAVKSDQLAMNFVKIQ-- 368
                    + C  +S LLSF T+E CL FYNN+LQR  E K  +KS+ L ++FV I+  
Sbjct: 238 ---------TEC--RSILLSFLTREVCLTFYNNVLQRLKEFKAKLKSENLRLSFVSIKYQ 286

Query: 369 -DDEEWMANL------------KMNVISLGATRSLYVEFADDSVTSDTIWDTLPFL--KN 413
            ++EE   N+               + +  ATRS+ ++F +     +     L FL  +N
Sbjct: 287 DENEEEETNIVDEPSFYTKESVYFELSNPQATRSILIQFKNPCSEQELFDKKLKFLNQEN 346

Query: 414 SGKYXXXXXXXXXXXERRKNFGLHYCLLHFLSVTMALEVKELLETGDE--AVSRVSFVTP 471
           + +Y           +    F  HY +L F+++ MA+E+ + L+       +    FV  
Sbjct: 347 NSRYILESIDLVNVTQTENEFPKHYAILTFINILMAMEICDYLKIHGPRYGIQDCMFVQV 406

Query: 472 ANSADKEMRRRRSSAISLKQEASPQMFSTDXXXXXXXXN---VSLPLSEQVSTASTDIST 528
              A   +  +R+S IS   + + +  S+         N   +SLP +E    +  +   
Sbjct: 407 IPKAVSCVSSKRASIISKDNDNNDETLSSQQKKNDILKNSSIISLPSAENDQVSDEEKLD 466

Query: 529 PIYEEFDG-NLTWSTLIVDVSEYKEPIVNEFDHHLNSWSIS 568
            + E+    N+    LIVD + Y  P     D HL + ++S
Sbjct: 467 KLSEKLKSTNIEELILIVDTATYPRPSFLSHDEHLPNATLS 507

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/61 (50%), Positives = 40/61 (65%), Gaps = 2/61 (3%)

Query: 1093 VAQHEGANNG-NPRKSSMKPIAGSDVMTRYLEQLHHNTFVYAANILGAT-QDPVFYDEDN 1150
            V +H+  N   N      + I GSDVM +YL QL H+TF+YAANILGA+ +D  +YDE N
Sbjct: 1021 VDEHQKNNKKHNTNDKEARVIPGSDVMAQYLAQLQHSTFMYAANILGASAEDGSYYDESN 1080

Query: 1151 A 1151
            A
Sbjct: 1081 A 1081

>AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL184C
          Length = 523

 Score =  170 bits (430), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 126/206 (61%), Gaps = 21/206 (10%)

Query: 643 MEHRTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTL 702
           + +RT+Y+GN+    K E+ICN VRGG+LQHIK +S + +CFVTFI+  AA QFYA ++L
Sbjct: 339 LGNRTIYLGNLPKDVKLEEICNSVRGGLLQHIKLLSDRHVCFVTFIDPTAAAQFYAMSSL 398

Query: 703 EPIILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVYVSLPDKAFKDKFINDPQFKEYQ 762
             + +H    K+GWG++ GPLP  +ALAV+ GASRN+Y+   D A  DK    P F E  
Sbjct: 399 HGLTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLGNIDFA-ADKKSQHPIFTE-- 455

Query: 763 NRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHK 822
                   A L++ F  +G +EQ+NF  + +CC+INF NISSAI  +++           
Sbjct: 456 --------AALRAVFQEFGEVEQINFLYERNCCFINFANISSAILAIDKI---------- 497

Query: 823 KTEGRYVGLIIGYGKDRCGNINRNLV 848
           K+   +  L I +GKDRCGN+ R   
Sbjct: 498 KSIPTFKDLKINFGKDRCGNVPRQFC 523

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 105/203 (51%), Gaps = 20/203 (9%)

Query: 646 RTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTLEPI 705
           RTVY+GN+ P    +++ + VR G+++ +K +  K   F++F+E  +A+ F+++  L+ +
Sbjct: 103 RTVYLGNVPPYITTKELLDHVRSGVVEEVKILPEKMCAFISFVEENSALLFHSDAILKRL 162

Query: 706 ILHGNVLKVGWGQNPGPLPKNIALAVT-VGASRNVYVSL--PDKAFKDKFINDPQFKEYQ 762
            +    +K+GWG+ P  +   +A  +T  GA+RNVY+     +K    ++  DP      
Sbjct: 163 NIDDRDIKIGWGK-PTQIDPIVAAGITNDGATRNVYIGKLNTNKDICAQWGVDPN----- 216

Query: 763 NRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHK 822
              ++    +L++D   +G +E V    +    +++F +I +AIK+V   ++       K
Sbjct: 217 --EEVITEEKLRNDLSDFGEVENVKIVPEKGIAFVHFSSIFAAIKVVANLANINPYYAQK 274

Query: 823 KTEGRYVGLIIGYGKDRCGNINR 845
           K         I YGKDRC  I +
Sbjct: 275 K---------IFYGKDRCAFITK 288

>TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa]
           {ON} Anc_6.183 YPL184C
          Length = 710

 Score =  171 bits (433), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 122/201 (60%), Gaps = 20/201 (9%)

Query: 643 MEHRTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTL 702
           + +RTVY+GN+    K ++ICN VRGG+LQHIK ++ + +CFVTFI+  AA QFYA ++L
Sbjct: 525 LGNRTVYLGNLPVDVKIDEICNAVRGGLLQHIKLLTDRHVCFVTFIDPTAAAQFYAMSSL 584

Query: 703 EPIILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVYVSLPDKAFKDKFINDPQFKEYQ 762
             + +     KVGWG++ GPLP  IALAV+ GASRNVY+   D     K  N P F E  
Sbjct: 585 HGLSIQKKRCKVGWGKHSGPLPNLIALAVSNGASRNVYLGNIDFENDIKLHNPPIFTEL- 643

Query: 763 NRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHK 822
                     L++ F  YG +EQ+NF  + +CC+INF NIS+AI  +E+  +  D     
Sbjct: 644 ---------SLRNIFQQYGDVEQINFLPEKNCCFINFTNISNAILAIEKIKNNPD----- 689

Query: 823 KTEGRYVGLIIGYGKDRCGNI 843
                +  L I +GKDRCGNI
Sbjct: 690 -----FKDLKINFGKDRCGNI 705

 Score = 88.2 bits (217), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 63/226 (27%), Positives = 107/226 (47%), Gaps = 46/226 (20%)

Query: 646 RTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTLEPI 705
           RTVY+GNI      +D+ + VR G++++IK +  K   F++F++ ++A+ F+++  L+ +
Sbjct: 268 RTVYLGNIPSDLSVKDLLDHVRSGVVENIKILPDKMCAFISFVDESSALLFHSDAILKRL 327

Query: 706 ILHGNVLKVGWGQNPGPLPKNIALA-VTVGASRNVYVS---------------------- 742
            + G  +K+GWG+ P P+   +A + VT GA+RNVY+                       
Sbjct: 328 NIGGRDIKIGWGK-PTPIDPIVATSIVTDGATRNVYIGQLSNSSNNNTSSSSSSTSPSSP 386

Query: 743 ---LPDKAFKDKFINDPQFKEYQNRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINF 799
                D   K K I+D    E           +L+ D   YG ++ V    D    +++ 
Sbjct: 387 SNNTSDDLEKKKNIDDSPLTE----------EKLREDLKDYGEIDCVKIVQDKGFAFVHM 436

Query: 800 MNISSAIKLVEEYSDTKDNLFHKKTEGRYVGLIIGYGKDRCGNINR 845
            +I SAIK+V   + T     +K+         I YGKDRC  I +
Sbjct: 437 SSILSAIKVVNNLAQTNPYYQNKR---------IFYGKDRCAFITK 473

>Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}
           similar to Ashbya gossypii AFL061C
          Length = 576

 Score =  169 bits (427), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 86/206 (41%), Positives = 125/206 (60%), Gaps = 21/206 (10%)

Query: 643 MEHRTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTL 702
           + +RT+Y+GN+    K E+ICN VRGG+LQHIK ++ + +CFVTFI+  AA QFYA ++L
Sbjct: 392 LGNRTIYLGNLPKDVKLEEICNSVRGGLLQHIKLLNDRHVCFVTFIDPTAAAQFYAMSSL 451

Query: 703 EPIILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVYVSLPDKAFKDKFINDPQFKEYQ 762
             + +H    K+GWG++ GPLP  +ALAV+ GASRN+Y+   D    D+ +  P F E  
Sbjct: 452 HGLTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLGNIDFE-DDRKLEQPIFTE-- 508

Query: 763 NRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHK 822
                     L+S F  +G +EQ+NF  + +CC+INF NISSAI  +++           
Sbjct: 509 --------TSLRSVFQEFGEVEQINFLYERNCCFINFANISSAILAIDKI---------- 550

Query: 823 KTEGRYVGLIIGYGKDRCGNINRNLV 848
           K+   +  L I +GKDRCGN+ R   
Sbjct: 551 KSIPTFKDLKINFGKDRCGNVPRQFC 576

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 56/205 (27%), Positives = 103/205 (50%), Gaps = 24/205 (11%)

Query: 646 RTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTLEPI 705
           RTVY+GN+ P     ++ + VR G+++ +K +  K   F++F++  +A+ F+++  L+ +
Sbjct: 156 RTVYLGNVPPYITTRELLDHVRSGVVEDVKILPEKMCAFISFVDENSALLFHSDAILKRL 215

Query: 706 ILHGNVLKVGWGQNPGPLPKNIALAV-TVGASRNVYVSLPDKAFKDKFINDP----QFKE 760
            +    +K+GWG+ P  +   +A  +   GA+RNVY+         K   +P    Q+  
Sbjct: 216 NIDDRDIKIGWGK-PTQIDPIVAAGINNDGATRNVYLG--------KLNTNPKMCAQWGA 266

Query: 761 YQNRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLF 820
             N   I    +L++D   +G +E V   ++    +++F +I SAIK+V   ++      
Sbjct: 267 DPNEETITE-EKLRNDLADFGEVESVKIVTEKGIAFVHFSSIFSAIKVVANLANVNPYYA 325

Query: 821 HKKTEGRYVGLIIGYGKDRCGNINR 845
            KK         I YGKDRC  I +
Sbjct: 326 QKK---------IFYGKDRCAFITK 341

>NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {ON}
           Anc_6.183
          Length = 629

 Score =  164 bits (414), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 86/202 (42%), Positives = 124/202 (61%), Gaps = 23/202 (11%)

Query: 643 MEHRTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTL 702
           + +RTVY+GN+    K E+ICNVVRGG+LQ +K +S + +CFVTFI+  AA QFYA ++L
Sbjct: 445 LGNRTVYLGNLPKDIKIEEICNVVRGGLLQSVKLLSDRYVCFVTFIDPTAAAQFYAMSSL 504

Query: 703 EPIILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVYVSLPDKAFKDKFINDPQ-FKEY 761
             + +     KVGWG++ GPLP  +ALAV+ GASRNVY+   +  F+   + DP+ F E 
Sbjct: 505 HGLTIQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYIG--NINFEKDAMRDPRIFTE- 561

Query: 762 QNRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFH 821
                      L+  F  YG +EQ+NF  + +CC+INF NIS+AI  +++          
Sbjct: 562 ---------DSLRKLFRQYGEVEQINFLPEKNCCFINFTNISNAILALDKI--------- 603

Query: 822 KKTEGRYVGLIIGYGKDRCGNI 843
            K+   +  L I +GKDRCGN+
Sbjct: 604 -KSNPHFEDLKINFGKDRCGNV 624

 Score = 90.5 bits (223), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 99/200 (49%), Gaps = 20/200 (10%)

Query: 646 RTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTLEPI 705
           RTVY+GNI      +++ + VR G+++ +K +  K   F++F++ ++A+ F+++  L+ +
Sbjct: 214 RTVYLGNIPSNLTVKELLDHVRSGVVEDVKIIPEKLCAFISFVDESSALLFHSDAILKRL 273

Query: 706 ILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVYVSLPDKAFKDKFINDPQFKEYQNRY 765
            + G  +K+GWG+     P   A  +   A+RNV++   +K   D    +P  +      
Sbjct: 274 NIGGKDIKIGWGKPTTVDPMISARIINDDATRNVFIGHLNKTDNDSCTKEPITE------ 327

Query: 766 KIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHKKTE 825
                A+L+ D   +G +E V    +    +++F +I+SAIK V           +KK  
Sbjct: 328 -----AKLREDLEDFGEIETVKIIPEKGIAFVHFSSITSAIKCVHNLRSMNPYYENKK-- 380

Query: 826 GRYVGLIIGYGKDRCGNINR 845
                  I YGKDRC  I +
Sbjct: 381 -------IAYGKDRCAFITK 393

>Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa]
           {ON} complement(185133..186905) [1773 nt, 591 aa]
          Length = 590

 Score =  160 bits (406), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 90/205 (43%), Positives = 122/205 (59%), Gaps = 21/205 (10%)

Query: 643 MEHRTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTL 702
           + +RTVY+GN+    K E+ICN VR G+LQ +K +S + +CFVTFI+  AA QFYA ++L
Sbjct: 406 LGNRTVYLGNLPKGIKIEEICNTVRSGLLQSVKLLSDRHVCFVTFIDPTAAAQFYAMSSL 465

Query: 703 EPIILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVYVSLPDKAFKDKFINDPQFKEYQ 762
             +IL     KVGWG++ GPLP  IALAV+ GASRNVY+   D   +D   N+  F E  
Sbjct: 466 HGLILQRKRCKVGWGKHSGPLPNLIALAVSNGASRNVYIGNIDFE-EDSKRNERVFTE-- 522

Query: 763 NRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHK 822
                     L+  F  YG +EQ+NF    +CC+IN+ NIS+AI  +++    K N + K
Sbjct: 523 --------DNLRKLFQEYGEVEQINFLPSKNCCFINYTNISNAISAIDK---IKSNPYFK 571

Query: 823 KTEGRYVGLIIGYGKDRCGNINRNL 847
                   L I +GKDRCGNI   L
Sbjct: 572 D-------LKINFGKDRCGNIPHQL 589

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 68/248 (27%), Positives = 126/248 (50%), Gaps = 25/248 (10%)

Query: 605 QQMLLNEYPYIMEPLMPPQITQT-----IQNQYSKSIQAVNAGMEHRTVYIGNINPRSKA 659
           +Q  + E PY++       I++T     +QN +   +   +A    RTVY+GNI      
Sbjct: 125 EQDQIAESPYLVAAAAAAAISKTENNLPLQNSFESPVNFTSA--PSRTVYLGNIPTTLTV 182

Query: 660 EDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTLEPIILHGNVLKVGWGQN 719
           +++ + VR G+++ +K +  K   F++F++ ++A+ F+++  L+ + + G  +K+GWG+ 
Sbjct: 183 KELLDHVRSGVVEDVKILPEKMCAFISFVDDSSALLFHSDAILKRLNIEGRDIKIGWGK- 241

Query: 720 PGPLPKNIALAVTV-GASRNVYVS-LPDKAFKDKFINDPQFKEYQNRYKIPNIAQLKSDF 777
           P  +   +A  +T  GA+RNVY+  L   A   + +N P+  E      I    +L +D 
Sbjct: 242 PTKIDPIVANGITTDGATRNVYIGQLYTDAEVAESLNIPKESE------IVTEERLIADL 295

Query: 778 GAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHKKTEGRYVGLIIGYGK 837
             YG ++ V    +    +I+F +I SAIK+V   + +     ++K         I YGK
Sbjct: 296 EIYGDIDSVKIVKEKGIAFIHFASILSAIKVVNNLAASNRYYQNRK---------IFYGK 346

Query: 838 DRCGNINR 845
           DRC  I +
Sbjct: 347 DRCAFITK 354

>KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 652

 Score =  161 bits (408), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 83/208 (39%), Positives = 128/208 (61%), Gaps = 27/208 (12%)

Query: 643 MEHRTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTL 702
           + +RTVY+GN+    K E+ICN +RGG+LQ+IK ++ + +CFVTFI+  AA QFYA ++L
Sbjct: 469 LGNRTVYLGNLPKNVKLEEICNAIRGGLLQNIKLLNDRHVCFVTFIDPTAAAQFYAMSSL 528

Query: 703 EPIILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVY---VSLPDKAFKDKFINDPQFK 759
             + +H    K+GWG++ GPLP  IALAV+ GASRN+Y   ++  + A +++ +    F 
Sbjct: 529 HGLTIHNKRCKIGWGKHSGPLPNPIALAVSRGASRNIYLGNINFEEDAKQEESV----FA 584

Query: 760 EYQNRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNL 819
           E            L++ F  +GT+EQ+NF  + +CC+INF NIS+AI  +++        
Sbjct: 585 E----------DTLRAIFEEFGTVEQINFLYEKNCCFINFANISNAILAIDKI------- 627

Query: 820 FHKKTEGRYVGLIIGYGKDRCGNINRNL 847
              K+   +  L I +GKDRCGN+ R  
Sbjct: 628 ---KSNPHFNNLKINFGKDRCGNVPRQF 652

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 60/203 (29%), Positives = 101/203 (49%), Gaps = 20/203 (9%)

Query: 646 RTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTLEPI 705
           RTVY+GNI      + + + VR G+++ +K +S K   FV+F++   A+ F+++  L+ +
Sbjct: 233 RTVYLGNIPATITYKALLDYVRTGVVEEVKILSEKMCAFVSFVDENDALLFHSDAILKRL 292

Query: 706 ILHGNVLKVGWGQNPGPL-PKNIALAVTVGASRNVYVSL--PDKAFKDKFINDPQFKEYQ 762
            + G  +K+GWG+ P P+ P   A     GA+RNVY+     +K   +K+  DP  KE  
Sbjct: 293 NIDGRDIKIGWGK-PQPIDPIVRAGIANDGATRNVYIGKLNTNKDSCEKWGADP--KEI- 348

Query: 763 NRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHK 822
               +    +L  D   +G +E +    D    +++F +I +AIK V           +K
Sbjct: 349 ----LVTKEKLYDDLSQFGEIESIKLVEDRGIAFVHFTSIFAAIKAVANIGSIDPYYSNK 404

Query: 823 KTEGRYVGLIIGYGKDRCGNINR 845
           K         + YGKDRC  I +
Sbjct: 405 K---------VFYGKDRCAFITK 418

>NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183
          Length = 680

 Score =  161 bits (407), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 84/201 (41%), Positives = 122/201 (60%), Gaps = 21/201 (10%)

Query: 643 MEHRTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTL 702
           + +RT+Y+GN+    + E+ICNVVRGG+LQ +K +  + +CFVTFI+  AA QF+A ++L
Sbjct: 496 LGNRTIYLGNLPKDIRVEEICNVVRGGLLQSVKLLGDRYVCFVTFIDPTAAAQFFAMSSL 555

Query: 703 EPIILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVYVSLPDKAFKDKFINDPQFKEYQ 762
             + +     KVGWG++ GPL   +ALAV+ GASRN+Y+   D A  DK  ++P F E  
Sbjct: 556 HGLTIQKKRCKVGWGKHSGPLSNALALAVSHGASRNIYIGNIDFA-TDKKRDNPIFTE-- 612

Query: 763 NRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHK 822
                     L+  F  YG MEQ+NF  + +CC+INF NIS+AI  +++           
Sbjct: 613 --------DSLRKMFSMYGEMEQINFLPEKNCCFINFTNISNAILALDKI---------- 654

Query: 823 KTEGRYVGLIIGYGKDRCGNI 843
           K+   +  L I +GKDRCGNI
Sbjct: 655 KSNPVFKDLKINFGKDRCGNI 675

 Score = 85.9 bits (211), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 60/232 (25%), Positives = 106/232 (45%), Gaps = 41/232 (17%)

Query: 646 RTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTLEPI 705
           RTVY+GNI      +++ + VR G+++ +K +  K   F++F++  +A+ F+++  L+ +
Sbjct: 222 RTVYLGNIPSDLTVKELLDHVRSGVIEDVKIIPEKLCAFISFLDENSALLFHSDAILKRL 281

Query: 706 ILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVYVS-LPDKAF---KDKFINDPQFKEY 761
            ++G  +K+GWG++    P      +  GA+RNV++  L  K+F   K K    P  + +
Sbjct: 282 NINGKDIKIGWGKSTAVDPMIATRIINDGATRNVFIGQLKTKSFDPNKAKVTKMPPSRNH 341

Query: 762 QNRYKIPN----------------------------IAQLKSDFGAYGTMEQVNFHSDGH 793
                I N                             A+L+ D   +G ++ +    D  
Sbjct: 342 DINATISNENDEKENGVDTAHVEGEVEVGEEEEPISDAKLRKDLADFGDIDCIKIVEDKG 401

Query: 794 CCWINFMNISSAIKLVEEYSDTKDNLFHKKTEGRYVGLIIGYGKDRCGNINR 845
             +I+F +I+SAIK V   +   D    KK         I YGKDRC  I +
Sbjct: 402 IAFIHFASITSAIKCVHNLNSMNDYYSTKK---------IFYGKDRCAFITK 444

>TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {ON}
           Anc_6.183 YPL184C
          Length = 584

 Score =  159 bits (402), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 87/202 (43%), Positives = 123/202 (60%), Gaps = 23/202 (11%)

Query: 643 MEHRTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTL 702
           + +RTVY+GN+    K E+ICNVVRGGILQ IK +S + +CFVTFI+  AA QFYA ++L
Sbjct: 400 LGNRTVYLGNLPKDVKIEEICNVVRGGILQAIKVLSDRHVCFVTFIDPIAAAQFYAMSSL 459

Query: 703 EPIILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVYVSLPDKAFKDKFINDPQF-KEY 761
             I +     +VGWG++PGPLP  IALAV+ GASRNVY+   D  ++D    +P F  +Y
Sbjct: 460 HGITIQKRRCRVGWGKHPGPLPNAIALAVSNGASRNVYIGNID-FYEDSKRQEPIFTADY 518

Query: 762 QNRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFH 821
                      L+  F  YG +EQ+NF  + +C ++N+ NIS+AI  +++          
Sbjct: 519 -----------LRKIFQEYGEVEQLNFLPEKNCAFVNYTNISNAISAIDKI--------- 558

Query: 822 KKTEGRYVGLIIGYGKDRCGNI 843
            K+   +  L I +GKDRCG I
Sbjct: 559 -KSNPLFKNLKINFGKDRCGTI 579

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 103/202 (50%), Gaps = 18/202 (8%)

Query: 646 RTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTLEPI 705
           +TVY+GNI P     ++ + VR G+++ +K +  K   F+TF++ +AA+ F+++  L+ +
Sbjct: 163 KTVYLGNIPPSLTVRELLDHVRSGVVEEVKILPEKTCAFLTFVDESAALLFHSDAILKRL 222

Query: 706 ILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVYVSL--PDKAFKDKFINDPQFKEYQN 763
            + G  +K+GWG+     P       + GA+RNVY+ L   D     +   DP      N
Sbjct: 223 HIDGRDIKIGWGKATPVDPLVTTAIASDGATRNVYIGLLNTDSDIALQVGADP------N 276

Query: 764 RYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHKK 823
             KI    +L+SD G +G ++ V    +    +I+F +I SA+K+V   +       +KK
Sbjct: 277 DEKITE-EKLRSDLGEFGEIDCVKIVEEKGIAFIHFASILSAVKVVANLAGINPYYENKK 335

Query: 824 TEGRYVGLIIGYGKDRCGNINR 845
                    I YGKDRC  I +
Sbjct: 336 ---------IYYGKDRCAFITK 348

>SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 582

 Score =  158 bits (400), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 84/205 (40%), Positives = 122/205 (59%), Gaps = 21/205 (10%)

Query: 643 MEHRTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTL 702
           + +RTVY+GN+    K E+ICN VRGG+LQ +K +S + +CFVTFI+  AA QFYA ++L
Sbjct: 398 LGNRTVYLGNLPKDVKIEEICNAVRGGLLQSVKLLSDRHVCFVTFIDPTAAAQFYAMSSL 457

Query: 703 EPIILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVYVSLPDKAFKDKFINDPQFKEYQ 762
             + +H    K+GWG++ G LP  +ALAV+ GASRN+YV   D    D+   +  F E Q
Sbjct: 458 HGLTIHNKRCKIGWGKHSGSLPNALALAVSHGASRNIYVGNIDFNAIDE-TGETIFTE-Q 515

Query: 763 NRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHK 822
           N         L+  F  +G +EQ+NF  + +CC+INF NIS+AI  +++           
Sbjct: 516 N---------LRETFQEFGEVEQINFLHEKNCCFINFTNISNAILAIDKI---------- 556

Query: 823 KTEGRYVGLIIGYGKDRCGNINRNL 847
           K    +  L + +GKDRCGN+ R  
Sbjct: 557 KCNPYFKNLKVNFGKDRCGNVPRQF 581

 Score = 97.4 bits (241), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 60/203 (29%), Positives = 106/203 (52%), Gaps = 20/203 (9%)

Query: 646 RTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTLEPI 705
           RTVY+GNI P   A+ + + VR G+++ +K +  +   F++F++ ++A+ F+++  L+ +
Sbjct: 161 RTVYLGNIPPFLPAKQLLDHVRSGVIEELKILPDRMCAFISFVDESSALLFHSDAILKRL 220

Query: 706 ILHGNVLKVGWGQNPGPLPKNIALAVTV-GASRNVYVSL--PDKAFKDKFINDPQFKEYQ 762
            + G  +KVGWG+ P P+   +A  +   GA+RNVY+     D     +F  DP      
Sbjct: 221 NIEGRDIKVGWGK-PTPIDPIVAAGIASDGATRNVYIGRLNTDPQLAPQFGTDPN----- 274

Query: 763 NRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHK 822
              +I +  +L+ D   +G +E +    D    +++F +I SAIK+V   +       +K
Sbjct: 275 --EEIVSEEKLRKDLNDFGEIESIKIVRDKGIAFVHFSSIFSAIKVVSNLASVNPYYTNK 332

Query: 823 KTEGRYVGLIIGYGKDRCGNINR 845
           K         I YGKDRC  I +
Sbjct: 333 K---------IFYGKDRCAFITK 346

>Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {ON}
           YPL184C (REAL)
          Length = 596

 Score =  157 bits (398), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 87/201 (43%), Positives = 122/201 (60%), Gaps = 21/201 (10%)

Query: 643 MEHRTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTL 702
           + +RTVY+G++    K E+ICN VRGG+LQ IK ++ + +CFVTFI+  AA QFYA ++L
Sbjct: 412 LGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSL 471

Query: 703 EPIILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVYVSLPDKAFKDKFINDPQFKEYQ 762
               +     KVGWG++ GPLP  +ALAV+ GASRNVYV   D  F    +ND +     
Sbjct: 472 YGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVGNID--FASDSLNDERIFTEN 529

Query: 763 NRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHK 822
           N         L+S F  YG +EQ+NF  + +CC+IN+ NIS+AI  +++    K N + K
Sbjct: 530 N---------LRSIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDK---IKSNPYFK 577

Query: 823 KTEGRYVGLIIGYGKDRCGNI 843
                   L I +GKDRCGN+
Sbjct: 578 D-------LKINFGKDRCGNV 591

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 100/200 (50%), Gaps = 24/200 (12%)

Query: 646 RTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTLEPI 705
           RTVY+GN+ P    +++ + VR G+++ +K +  K   F++F++ +AA+ F+++  L+ +
Sbjct: 185 RTVYLGNVPPHLTVKELLDHVRSGVVEDVKIIPEKMCAFISFVDESAALLFHSDAILKRL 244

Query: 706 ILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVYVSLPDKAFKDKFINDPQFKEYQNRY 765
            +    +K+GWG+     P   A   T GA+RNVY+       ++  +++          
Sbjct: 245 NIGDRDIKIGWGKPTRIDPIVAARITTDGATRNVYIGRMTVEGEESHLSE---------- 294

Query: 766 KIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHKKTE 825
                 QL++D   YG ++ +    +    +I+F +I +AIK+V      ++  +  K  
Sbjct: 295 -----EQLRADLQEYGEIDCIKIIKEKGIAFIHFASILNAIKVVTNLP-IRNPYYQNKR- 347

Query: 826 GRYVGLIIGYGKDRCGNINR 845
                  I YGKDRC  I +
Sbjct: 348 -------IFYGKDRCAFITK 360

>KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON}
           Anc_6.183 YPL184C
          Length = 533

 Score =  156 bits (395), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 79/201 (39%), Positives = 120/201 (59%), Gaps = 25/201 (12%)

Query: 643 MEHRTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTL 702
           + +RT+Y+GN+    K E+ICNVVRGG+LQ+IK +S +  CF+TFI+  AA QFYA ++L
Sbjct: 353 LGNRTIYLGNLPKGVKIEEICNVVRGGLLQNIKLLSDRFACFITFIDPTAAAQFYAMSSL 412

Query: 703 EPIILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVYVSLPDKAFKDKFINDPQFKEYQ 762
             + +  N  KVGWG++ GPL   +ALA++ GASRN+Y+   D   K+++ N+   +E  
Sbjct: 413 HGLTIQKNRCKVGWGKHSGPLSNALALAISNGASRNIYIGNVDFEKKNEYFNEEHLREI- 471

Query: 763 NRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHK 822
                         F  +G +EQ+NF  +  CC++NF NI+ AI  +++           
Sbjct: 472 --------------FEEFGEVEQINFLREKGCCFVNFTNINHAILALDKI---------- 507

Query: 823 KTEGRYVGLIIGYGKDRCGNI 843
           K+   +  L I +GKDRCGNI
Sbjct: 508 KSLPEFEDLKINFGKDRCGNI 528

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 56/201 (27%), Positives = 102/201 (50%), Gaps = 28/201 (13%)

Query: 646 RTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTLEPI 705
           RTVY+GNI      +++ + VR G+++ +K +  K   F++FI+   A+ F+++  L+ +
Sbjct: 128 RTVYLGNIPQGLTIKELLDHVRSGVVESVKILPTKLCAFISFIDERGALLFHSDAILKRL 187

Query: 706 ILHGNVLKVGWGQNPGPLPKNIALAVT-VGASRNVYVSLPDKAFKDKFINDPQFKEYQNR 764
            + G  +K+GWG++   +   +A  +T  GA+RNVY+         +  +DP     Q  
Sbjct: 188 NIRGKDIKIGWGKS-NHIDSIVAARITNDGATRNVYIG--------QLNDDPTITTEQ-- 236

Query: 765 YKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHKKT 824
                  +L+ D   +G ++ + F S+    +++F +IS AI +V+  S         K 
Sbjct: 237 -------ELEKDMQKFGEIDCIKFLSNKGIAFVHFASISVAIYVVQNLS---------KL 280

Query: 825 EGRYVGLIIGYGKDRCGNINR 845
             +Y    I YGKDRC  I +
Sbjct: 281 NEKYKNKRIFYGKDRCAFITK 301

>Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184C -
           Hypothetical ORF [contig 30] FULL
          Length = 567

 Score =  157 bits (396), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 85/204 (41%), Positives = 123/204 (60%), Gaps = 23/204 (11%)

Query: 643 MEHRTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTL 702
           + +RT+Y+GN+    K E+ICNVVRGG+LQ IK ++ + +CFVTFI+  AA Q YA  +L
Sbjct: 383 LGNRTIYLGNLPKDVKIEEICNVVRGGLLQSIKLLTDRHVCFVTFIDPTAAAQLYAMASL 442

Query: 703 EPIILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVYVSLPDKAFK-DKFINDPQFKEY 761
             + +H    K+GWG++ G L   +ALAV+ GASRN+Y+   D  FK D     P F E 
Sbjct: 443 HGLTIHNKRCKIGWGKHSGALSNALALAVSHGASRNIYLGNID--FKADSETEHPIFTE- 499

Query: 762 QNRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFH 821
           QN         L+S F  +G +EQ+NF  + +CC++NF NIS+AI  +++          
Sbjct: 500 QN---------LRSIFEEFGEVEQINFLIERNCCFVNFTNISNAILAIDKI--------- 541

Query: 822 KKTEGRYVGLIIGYGKDRCGNINR 845
            K   ++  L I +GKDRCGN+ R
Sbjct: 542 -KNNPQFSDLKINFGKDRCGNVPR 564

 Score =  100 bits (249), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 62/203 (30%), Positives = 108/203 (53%), Gaps = 20/203 (9%)

Query: 646 RTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTLEPI 705
           RTVY+GNI P  +A  + + VR G+++ I+ +  K   F++F++ ++A+ F+++  L+ +
Sbjct: 146 RTVYLGNIPPNLEARQLLDHVRSGVVEDIRILREKMCAFISFLDESSALLFHSDAILKRL 205

Query: 706 ILHGNVLKVGWGQNPGPLPKNIALAVT-VGASRNVYVSL--PDKAFKDKFINDPQFKEYQ 762
            + G  +K+GWG+ P P+   +  AV   GA+RNVY+     D +F  +   DP      
Sbjct: 206 NIDGRDIKIGWGK-PTPIDPVVTSAVANDGATRNVYIGRLNTDSSFAPQIGADP------ 258

Query: 763 NRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHK 822
            R ++    +L+ D   YG +E V   ++    +++F +I SAIK+V   +       +K
Sbjct: 259 -RDEVVTEQKLRDDLSFYGEIESVKIITEKGIAFVHFCSIFSAIKVVSSLAAVNPYYANK 317

Query: 823 KTEGRYVGLIIGYGKDRCGNINR 845
           K         I YGKDRC  I +
Sbjct: 318 K---------IFYGKDRCAFITK 331

>CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184c
          Length = 639

 Score =  157 bits (397), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 84/201 (41%), Positives = 117/201 (58%), Gaps = 21/201 (10%)

Query: 643 MEHRTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTL 702
           + +RTVY+GN+    K E+ICN VRGG+LQ IK +  + +CFVTFI+  AA QFYA ++L
Sbjct: 455 LGNRTVYLGNLPKGVKIEEICNAVRGGLLQSIKLLDDRHVCFVTFIDPTAAAQFYAMSSL 514

Query: 703 EPIILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVYVSLPDKAFKDKFINDPQFKEYQ 762
               +     KVGWG++ GPLP  +ALAV+ GASRNVY+   D    D     P F E  
Sbjct: 515 YGFTIQRQRCKVGWGKHSGPLPNALALAVSNGASRNVYLGNIDFE-ADSKKEQPIFNE-- 571

Query: 763 NRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHK 822
                     L++ F  YG +EQ+NF  +  CC+INF NI++AI  +++           
Sbjct: 572 --------TALRAIFQEYGEVEQINFLVEKKCCFINFTNINNAIFAMDKI---------- 613

Query: 823 KTEGRYVGLIIGYGKDRCGNI 843
           K+   +  L I +GKDRCGN+
Sbjct: 614 KSNPHFKSLKINFGKDRCGNV 634

 Score = 90.5 bits (223), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 107/201 (53%), Gaps = 22/201 (10%)

Query: 646 RTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTLEPI 705
           RTVY+GNI P    +++ + VR G+++  K +  K   F++F+E ++A+ F+++  L+ +
Sbjct: 224 RTVYLGNIPPSLTIKELLDHVRSGVVEEAKILPEKMCAFISFVEESSALLFHSDAILKRL 283

Query: 706 ILHGNVLKVGWGQNPGPLPKNIA-LAVTVGASRNVYVSLPDKAFKDKFINDPQFKEYQNR 764
            +    +KVGWG+ P  L  +IA   +  GA+RNVY+   +     K   +P  +E    
Sbjct: 284 NIDNRDIKVGWGK-PTVLDPSIASRIINDGATRNVYIGQGNNDRSSKENKEPLTEE---- 338

Query: 765 YKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHKKT 824
                  +L+ D   YG ++ +    +    +++F +I++AIK+V   +  + N F+++ 
Sbjct: 339 -------KLREDLKEYGEIDSIKIIPEKDIAFVHFSSIATAIKVVSTLA--QKNPFYQEK 389

Query: 825 EGRYVGLIIGYGKDRCGNINR 845
           +       I YGKDRC  I +
Sbjct: 390 K-------IFYGKDRCAFITK 403

>KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 569

 Score =  155 bits (393), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 85/204 (41%), Positives = 123/204 (60%), Gaps = 23/204 (11%)

Query: 643 MEHRTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTL 702
           + +RT+Y+GN+    K E+ICN VRGG+LQ IK ++ + +CFVTFI+  AA Q YA T+L
Sbjct: 385 LGNRTIYLGNLPKDVKIEEICNAVRGGLLQSIKLLTDRHVCFVTFIDPTAAAQLYAMTSL 444

Query: 703 EPIILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVYVSLPDKAFK-DKFINDPQFKEY 761
             + +H    K+GWG++ G L   +ALAV+ GASRN+Y+   D  FK D   + P F E 
Sbjct: 445 HGLTIHNKRCKIGWGKHSGALSNALALAVSHGASRNIYLGNID--FKADSERDVPVFTE- 501

Query: 762 QNRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFH 821
           QN         L+  F  YG +EQ+NF  +  CC++NF NIS+AI  +++          
Sbjct: 502 QN---------LRKLFEEYGEVEQINFLPERSCCFVNFTNISNAILAIDKI--------- 543

Query: 822 KKTEGRYVGLIIGYGKDRCGNINR 845
            K+  ++  L I +GKDRCGN+ R
Sbjct: 544 -KSNEQFKDLKINFGKDRCGNVPR 566

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 61/203 (30%), Positives = 108/203 (53%), Gaps = 20/203 (9%)

Query: 646 RTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTLEPI 705
           RTVY+GNI P  +  ++ + VR G+++ ++ +  K   F++F++ ++A+ F+++  L+ +
Sbjct: 148 RTVYLGNIPPNLEVRELLDHVRSGVVEDVRILREKMCAFISFLDESSALLFHSDAILKRL 207

Query: 706 ILHGNVLKVGWGQNPGPLPKNIALAVT-VGASRNVYVSL--PDKAFKDKFINDPQFKEYQ 762
            + G  +KVGWG+ P P+   +  AV+  GA+RNVY+     D+    +F  DP      
Sbjct: 208 NIGGRDIKVGWGK-PTPIDPVVTAAVSNDGATRNVYIGRLNTDRDLAPQFGADP------ 260

Query: 763 NRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHK 822
            R  I    +L++D   YG +E V    +    +++F +I SAIK+V   +       +K
Sbjct: 261 -RDLIATEEKLRADLDFYGEIESVKIIVEKGIAFVHFSSIFSAIKVVSSLATVNPYYSNK 319

Query: 823 KTEGRYVGLIIGYGKDRCGNINR 845
           K         I YGKDRC  + +
Sbjct: 320 K---------IFYGKDRCAFVTK 333

>ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 632

 Score =  156 bits (395), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 84/202 (41%), Positives = 124/202 (61%), Gaps = 23/202 (11%)

Query: 643 MEHRTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTL 702
           + +RTVY+GN+    K E+ICNVVRGG+LQ++K +S + +CFVTFI+  AA QFYA ++L
Sbjct: 448 LGNRTVYLGNLPKDVKVEEICNVVRGGLLQNVKVLSDRHVCFVTFIDPTAAAQFYAMSSL 507

Query: 703 EPIILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVYVSLPDKAF-KDKFINDPQFKEY 761
             I +     +VGWG++PG L   +ALAV+ GASRNVYV   +  F +D    DP F E 
Sbjct: 508 HGITIQKRRCRVGWGKHPGSLENALALAVSNGASRNVYVG--NINFDEDSKREDPIFTE- 564

Query: 762 QNRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFH 821
                    + L+S F  +G +EQ+N+  + +CC++N+ NIS+AI  +++          
Sbjct: 565 ---------SSLRSIFQQWGEVEQINYLPERNCCFVNYTNISNAILAIDKI--------- 606

Query: 822 KKTEGRYVGLIIGYGKDRCGNI 843
            K    +  L I +GKDRCGN+
Sbjct: 607 -KGHPVFKDLKINFGKDRCGNV 627

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 53/205 (25%), Positives = 103/205 (50%), Gaps = 23/205 (11%)

Query: 646 RTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTLEPI 705
           +TVY+GN       +++ + VR G+++ ++ +  K   FV+F++ +AA+ F+++  L+ +
Sbjct: 210 KTVYLGNTPITLTVKELLDHVRSGVVEDVRILPDKMCAFVSFVDESAALLFHSDAILKRL 269

Query: 706 ILHGNVLKVGWGQNPGPLPKNIALAVT-VGASRNVYVSLPDKAFKDKFINDPQFKEYQNR 764
            + G  +K+GWG+ P P+   +A AV    A+RNVY+         +    P+     + 
Sbjct: 270 HIDGRDIKIGWGK-PTPIDPVVATAVANDNATRNVYIG--------QLNTGPKLSSQVSP 320

Query: 765 YKI--PNIAQ--LKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLF 820
             +  P I +  L+ D   +G ++ +    +    +++F +I +AIK V   ++      
Sbjct: 321 VDVTEPVITEDKLRLDLQEFGEIDCIKIVEEKGIAFVHFASILNAIKAVANLANINPYYR 380

Query: 821 HKKTEGRYVGLIIGYGKDRCGNINR 845
           +KK         I YGKDRC  I +
Sbjct: 381 NKK---------IFYGKDRCAFITK 396

>Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C
           (REAL)
          Length = 625

 Score =  156 bits (394), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 85/201 (42%), Positives = 123/201 (61%), Gaps = 21/201 (10%)

Query: 643 MEHRTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTL 702
           + +RTVY+G++    K E+ICN VRGG+LQ IK ++ + +CFVTFI+  AA QFYA ++L
Sbjct: 441 LGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSL 500

Query: 703 EPIILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVYVSLPDKAFKDKFINDPQFKEYQ 762
               +     KVGWG++ GPLP  +ALAV+ GASRNVYV   D      F++D    E  
Sbjct: 501 YGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVGNID------FVSDSLRDE-- 552

Query: 763 NRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHK 822
              +I   + L+  F  YG +EQ+NF  + +CC++N+ NIS+AI  +++    K N + K
Sbjct: 553 ---RIFTESNLRHVFQQYGEVEQINFLPEKNCCFVNYTNISNAILALDK---IKSNPYFK 606

Query: 823 KTEGRYVGLIIGYGKDRCGNI 843
                   L I +GKDRCGN+
Sbjct: 607 D-------LKINFGKDRCGNV 620

 Score = 84.7 bits (208), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 53/200 (26%), Positives = 100/200 (50%), Gaps = 24/200 (12%)

Query: 646 RTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTLEPI 705
           RTVY+GN+ P    +++ + VR G+++ +K +S K   F++F++ +AA+ F+++  L+ +
Sbjct: 214 RTVYLGNVPPNLSVKELLDHVRSGVVEDVKIISEKMCAFISFVDESAALLFHSDAILKRL 273

Query: 706 ILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVYVSLPDKAFKDKFINDPQFKEYQNRY 765
            +    +K+GWG+     P   A   T GA+RNVY+       ++  +++          
Sbjct: 274 NIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTIDGEESHLSE---------- 323

Query: 766 KIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHKKTE 825
                 QL+ D   YG ++ +    +    +I+F +I +AIK+V      ++  +  K  
Sbjct: 324 -----EQLRIDLKEYGEIDCIKVIKEKGIAFIHFASILNAIKVVTNLP-IRNPYYQNKR- 376

Query: 826 GRYVGLIIGYGKDRCGNINR 845
                  I YGKDRC  I +
Sbjct: 377 -------IFYGKDRCAFITK 389

>Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {ON}
           YPL184C (REAL)
          Length = 614

 Score =  156 bits (394), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 85/201 (42%), Positives = 123/201 (61%), Gaps = 21/201 (10%)

Query: 643 MEHRTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTL 702
           + +RTVY+G++    K E+ICN VRGG+LQ IK ++ + +CFVTFI+  AA QFYA ++L
Sbjct: 430 LGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSL 489

Query: 703 EPIILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVYVSLPDKAFKDKFINDPQFKEYQ 762
               +     KVGWG++ GPLP  +ALAV+ GASRNVYV   D      +++D    E  
Sbjct: 490 YGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVGNID------YVSDSVRDE-- 541

Query: 763 NRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHK 822
              +I    +L+  F  YG +EQ+NF  + +CC+IN+ NIS+AI  +++    K N + K
Sbjct: 542 ---RIFTEGKLRGIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDK---IKSNPYFK 595

Query: 823 KTEGRYVGLIIGYGKDRCGNI 843
                   L I +GKDRCGN+
Sbjct: 596 D-------LKINFGKDRCGNV 609

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 53/202 (26%), Positives = 101/202 (50%), Gaps = 24/202 (11%)

Query: 644 EHRTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTLE 703
           + RTVY+GN+ P    +++ + VR G+++ +K +  K   F++F++ +AA+ F+++  L+
Sbjct: 201 QSRTVYLGNVPPNLSVKELLDHVRSGVVEDVKIIPEKMCAFISFVDESAALLFHSDAILK 260

Query: 704 PIILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVYVSLPDKAFKDKFINDPQFKEYQN 763
            + +    +K+GWG+     P   A   T GA+RNVY+       ++  ++         
Sbjct: 261 RLNIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTIEGEESHLSG-------- 312

Query: 764 RYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHKK 823
                   QL++D   YG ++ +    +    +I+F +I +AIK+V        NL+++ 
Sbjct: 313 -------EQLRADLEEYGEIDCIKIIKEKGVAFIHFASILNAIKVVTNLPIR--NLYYQN 363

Query: 824 TEGRYVGLIIGYGKDRCGNINR 845
                    I YGKDRC  I +
Sbjct: 364 KR-------IFYGKDRCAFITK 378

>YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON}
           MRN1RNA-binding protein proposed to be involved in
           translational regulation; binds specific categories of
           mRNAs, including those that contain upstream open
           reading frames (uORFs) and internal ribosome entry sites
           (IRES)
          Length = 612

 Score =  155 bits (393), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 85/201 (42%), Positives = 122/201 (60%), Gaps = 21/201 (10%)

Query: 643 MEHRTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTL 702
           + +RTVY+G++    K E+ICN VRGG+LQ IK ++ + +CFVTFI+  AA QFYA ++L
Sbjct: 428 LGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSL 487

Query: 703 EPIILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVYVSLPDKAFKDKFINDPQFKEYQ 762
               +     KVGWG++ GPLP  +ALAV+ GASRNVYV   D      F+ D    E  
Sbjct: 488 YGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVGNID------FVGDSLRDE-- 539

Query: 763 NRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHK 822
              ++   + L+  F  YG +EQ+NF  + +CC+IN+ NIS+AI  +++    K N + K
Sbjct: 540 ---RVFTESNLRHIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDK---IKSNPYFK 593

Query: 823 KTEGRYVGLIIGYGKDRCGNI 843
                   L I +GKDRCGN+
Sbjct: 594 D-------LKINFGKDRCGNV 607

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 99/200 (49%), Gaps = 24/200 (12%)

Query: 646 RTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTLEPI 705
           RTVY+GN+ P    +++ + VR G+++ +K +  K   FV+FI+ +AA+ F+++  L+ +
Sbjct: 201 RTVYLGNVPPNLSVKELLDHVRSGVVEDVKIIPEKMCAFVSFIDESAALLFHSDAILKRL 260

Query: 706 ILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVYVSLPDKAFKDKFINDPQFKEYQNRY 765
            +    +K+GWG+     P   A   T GA+RNVY+       ++  +++          
Sbjct: 261 NIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTIEGEESHLSE---------- 310

Query: 766 KIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHKKTE 825
                 QL+ D   YG ++ +    +    +I+F +I +AIK+V      ++  +  K  
Sbjct: 311 -----EQLRVDLEEYGEIDCIKIIKEKGIAFIHFASILNAIKVVTNLP-IRNPYYQNKR- 363

Query: 826 GRYVGLIIGYGKDRCGNINR 845
                  I YGKDRC  I +
Sbjct: 364 -------IFYGKDRCAFITK 376

>KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON}
           Anc_6.183 YPL184C
          Length = 443

 Score =  151 bits (381), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 77/202 (38%), Positives = 118/202 (58%), Gaps = 25/202 (12%)

Query: 643 MEHRTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTL 702
           + +RT+Y+GN++ R + E++CNVVRGG+LQ +K++  + +CFVTF +  AA QFYA  +L
Sbjct: 262 LGNRTIYVGNLSARCRIEEVCNVVRGGLLQSVKFLPDRHVCFVTFADPTAAAQFYAMASL 321

Query: 703 EPIILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVYVSLPDKAFKDKFINDPQFKE-Y 761
             + +     K+GWG++ GPLP ++A A++ GASRNVY       F +    DP   E +
Sbjct: 322 HGLTIQRRRCKIGWGKHSGPLPAHLADAISHGASRNVY-------FGNVNWQDPAVAEFF 374

Query: 762 QNRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFH 821
           + R+       L+     +G MEQVN   +  C ++NF N+ SAI  VE+          
Sbjct: 375 EERH-------LRQAMSHFGEMEQVNAVPERRCVFVNFTNLESAIAAVEQV--------- 418

Query: 822 KKTEGRYVGLIIGYGKDRCGNI 843
            K   ++  L + YGKDRCGN+
Sbjct: 419 -KKWPQFQQLKVNYGKDRCGNV 439

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 87/201 (43%), Gaps = 31/201 (15%)

Query: 646 RTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTLEPI 705
           RTVY+GNI P     ++ + V+ G+++  +    K   FV+F++  +A+ F+++  L  +
Sbjct: 39  RTVYLGNIAPEVTLRELLDHVQSGVVEDARLFPAKSCAFVSFVDENSALLFHSDAILNRL 98

Query: 706 ILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVYVS-LPDKAFKDKFINDPQFKEYQNR 764
            +    +K+GW       P       + GA+RNVY+  LPD                 +R
Sbjct: 99  RIGDRDVKIGWATATLMDPLVATRIQSEGATRNVYLGNLPDGV---------------SR 143

Query: 765 YKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHKKT 824
           Y      +L  D   YG ++ V   S     +++  +I  AI  V      +DN  +   
Sbjct: 144 Y------ELTKDLSVYGEIDSVKLLSSKGVAFVHMASIGQAIHAVANLQ--RDNKIYSDR 195

Query: 825 EGRYVGLIIGYGKDRCGNINR 845
                   + +GKDRC  + +
Sbjct: 196 R-------VSFGKDRCAYVTK 209

>TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6.183
           YPL184C
          Length = 593

 Score =  149 bits (376), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 80/201 (39%), Positives = 118/201 (58%), Gaps = 21/201 (10%)

Query: 643 MEHRTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTL 702
           + +RTVY+GN+    + EDICN +R G+LQ+IK +S + +CFVTFI+  +A QFYA +++
Sbjct: 412 LGNRTVYLGNLPNDIRIEDICNTIRCGLLQNIKLLSDRHVCFVTFIDPVSAAQFYAMSSI 471

Query: 703 EPIILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVYVSLPDKAFKDKFINDPQFKEYQ 762
              +L     KVGWG++ GPL   + LAV+ GASRNVY+   D      F  D   +E  
Sbjct: 472 YGFVLQKKRCKVGWGKHSGPLSNPLTLAVSNGASRNVYIGNID------FTADGTKRE-- 523

Query: 763 NRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHK 822
            RY     + L+  F  YG +EQ+NF    +CC++N+ NI++AI  +++           
Sbjct: 524 -RYFTD--SNLRRIFSEYGEVEQINFLYSKNCCFVNYTNINNAISAIDKI---------- 570

Query: 823 KTEGRYVGLIIGYGKDRCGNI 843
           K    +  L I +GKDRCGNI
Sbjct: 571 KNNPTFKNLKINFGKDRCGNI 591

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 61/203 (30%), Positives = 111/203 (54%), Gaps = 13/203 (6%)

Query: 646 RTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTLEPI 705
           RTVY+GNI P   A D+ + VR G+++ +K +  K   F++F++  +++ F+++  L+ +
Sbjct: 168 RTVYLGNIPPTLTASDLLDHVRSGVIEEVKILPEKMCAFISFLDENSSLLFHSDAILKRL 227

Query: 706 ILHGNVLKVGWGQNPGPLPKNIALAV-TVGASRNVYVS-LPDKAFKDKFINDPQFKEYQN 763
            + G  +K+GWG+ P PL   IA +V T GA+RN+++  L       +  ND       +
Sbjct: 228 NIDGKDIKIGWGK-PSPLSPIIATSVATDGATRNIFIGQLNTTDHNKQKDNDATIYHGSD 286

Query: 764 RYK-IPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHK 822
            ++ I    +L+ D   YG ++ +    +    +++F +I SAIK+V   S++  N ++ 
Sbjct: 287 DFEDIMTEEKLRKDLEEYGDIDCIKIFKEKGFAFVHFTSILSAIKVVNNLSNS--NPYYS 344

Query: 823 KTEGRYVGLIIGYGKDRCGNINR 845
           K +       I YGKDRC  I +
Sbjct: 345 KKK-------IYYGKDRCAFITK 360

>ZYRO0F07238g Chr6 complement(586327..587496) [1170 bp, 389 aa] {ON}
           similar to uniprot|Q96US5 Saccharomyces cerevisiae
           YOR242C SSP2 Sporulation SPecific involved in
           sporulation
          Length = 389

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 86/206 (41%), Gaps = 21/206 (10%)

Query: 646 RTVYIGNINPRSKAEDICNVVRGGILQHIKWVSH-------KRICFVTFIETAAAVQFYA 698
           + + +GNI  R+    I   +  G L++I  + H       K+I  + F+   AA  F  
Sbjct: 183 KAIVLGNIPKRTGIASILAQIHAGPLENI--IVHTDDEQALKKI-ELDFLTHEAAYSFMK 239

Query: 699 NTTLEPIILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVYVSLPDKAFKDKFINDPQF 758
                   ++G  L   WG++     K          S +            K+IN  + 
Sbjct: 240 YGRTNMFKINGQHLTPEWGKSSEHKTKK-GNEWDDQQSSSDDQDFCRSLIMKKYINCTKR 298

Query: 759 KEYQNRYKIP-----NIAQLKSDFGAYGTMEQVN-FHSDGHCCWINFMNISSAIKLVEEY 812
            +Y   YK       N++++K DFG +G + ++    S   C  INF N+ SA+K ++EY
Sbjct: 299 TKYSEAYKESPLEPLNLSEIKQDFGTFGEILEITPVVSRKLCISINFFNMESAMKAMKEY 358

Query: 813 SDTKDNLFHKKTEGRYVGLIIGYGKD 838
            +   +L HK     +    I YGKD
Sbjct: 359 ENPNSDL-HK---AYFNNWAIWYGKD 380

>Ecym_2403 Chr2 (785307..786434) [1128 bp, 375 aa] {ON} similar to
           Ashbya gossypii ACR135C
          Length = 375

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 62/252 (24%), Positives = 106/252 (42%), Gaps = 30/252 (11%)

Query: 603 VPQQMLLNEYPYIMEPLMPPQITQTIQNQYSKSIQAVNAGMEHRTVYIGNINPRSKA-ED 661
           VPQ     +Y  ++  L+   I  + +++ S+ +++   G++ R + +    P     + 
Sbjct: 129 VPQLKYDGDYDPVLGKLL---INSSSEDEDSEWLES---GLQDRNLVVIRDFPNGTGLKS 182

Query: 662 ICNVVRGGILQHI-----KWVSHKRICFVTFIETAAAVQFYANTTLEPIILHGNVLKVGW 716
           + N V+GG L+HI     K  +  +   + F+    A  F          ++G  L+  W
Sbjct: 183 VLNQVQGGPLKHIAPQYRKESNQLKSVELEFLSPEDAQHFMEYGRHAVFQINGVHLRPKW 242

Query: 717 GQNPGPLPKNIALAV-TVGASRNVYV-SLPDKAFKDKFINDPQFKEYQNRYKIP------ 768
           G     L +N   ++ T   S NVY  S      K +   +P  K     Y  P      
Sbjct: 243 GIQS--LSENFEASLNTHKDSLNVYTPSSRCLLLKKQGSRNP--KHSTCHYPSPRSHICD 298

Query: 769 -NIAQLKSDFGAYGTMEQVN-FHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHKKTEG 826
            NI  LK+DFG +G +  ++   S   C  INF +I +A+  ++ Y +    L  K  + 
Sbjct: 299 LNIQDLKNDFGQFGDILDISPMISRKLCVQINFFDIKTAVDALQAYKNINSPLNRKYAD- 357

Query: 827 RYVGLIIGYGKD 838
                 IGYGKD
Sbjct: 358 ---TWTIGYGKD 366

>NDAI0E01190 Chr5 (237093..238169) [1077 bp, 358 aa] {ON} Anc_8.670
           YOR242C
          Length = 358

 Score = 40.8 bits (94), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 52/211 (24%), Positives = 87/211 (41%), Gaps = 37/211 (17%)

Query: 644 EHRTVYIGNINPRSKAEDICNVVRGG------ILQHIKWVSHKRICFVTFIETAAAVQF- 696
           + R + I NI   +    I   + GG        Q  K  S   +  + FI +  A QF 
Sbjct: 160 QRRMIIIRNIPKETGIHSIVAQISGGPIENFNFYQQHKLSSPSNVLKIAFIASEGAQQFM 219

Query: 697 -YANTTLEPIILHGNVLKVGWGQNPG-PLPKNIALAVTV----GASRNVYVS-LPDKAFK 749
            Y NT L  +  +G  LK  W  +    +P     + T+    G  R +++  LP    K
Sbjct: 220 KYGNTNLFKV--NGIHLKPEWFVDSNLCIPSKTVPSKTLLNYNGKCRCLFMKQLP---LK 274

Query: 750 DKFINDPQFKEYQNRYKIPNIAQLKSDFGAYGTMEQVN-FHSDGHCCWINFMNISSAIKL 808
           D  + +  +           + +++SDF  +G +  ++   S   C +I F +I SA+++
Sbjct: 275 DHLVLNSLY-----------LKRIRSDFECFGEIVDISPLISRRPCLYIQFYDIYSAVRV 323

Query: 809 VEEYSDTKDNLFHKKTEGRYV-GLIIGYGKD 838
           +E Y D      H +   +Y     I YGKD
Sbjct: 324 LEAYEDR-----HSRIHQQYFEKWSIYYGKD 349

>KAFR0A03830 Chr1 complement(779143..780267) [1125 bp, 374 aa] {ON}
           Anc_8.670 YOR242C
          Length = 374

 Score = 40.4 bits (93), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 55/210 (26%), Positives = 88/210 (41%), Gaps = 28/210 (13%)

Query: 646 RTVYIGNINPRSKAEDICNVVRGGILQHIKW---------VSHKRICFVTFIETAAAVQF 696
           R + I NI   +    + + V GG L++I +         + + R+ F+T  + A A   
Sbjct: 167 RNIVIKNIPSGTGLASVMSQVCGGPLENISFQTAEKSINILENVRLSFLT-ADAADAFMN 225

Query: 697 YANTTLEPIILHGNVLKVGWGQNPGPLPKNIALAVTVGA-------SRNVYVSLPDKAFK 749
           Y+ T L  +  +G  L   W     PL +     +  G        S N+  SL  K + 
Sbjct: 226 YSKTRLFKV--NGFNLITEWA----PLKQQPINNIYSGLEKQQAQFSTNICRSLIMKKYP 279

Query: 750 DKFINDPQFKEYQNRYKIPNIAQLKSDFGAYGTMEQVN-FHSDGHCCWINFMNISSAIKL 808
            K       K  +N     + + +  DFG +G +++V    S   C  +N+ NI SA+K 
Sbjct: 280 QKKEIKKYCKWMENTMDDFDPSIIVEDFGQFGRIQEVTPIISRKLCVAVNYYNILSALKA 339

Query: 809 VEEYSDTKDNLFHKKTEGRYVGLIIGYGKD 838
           +E Y D    L H+K    Y    I +GKD
Sbjct: 340 IESYEDPNSEL-HRKY---YKSWAIWFGKD 365

>Smik_15.426 Chr15 complement(738453..739568) [1116 bp, 371 aa] {ON}
           YOR242C (REAL)
          Length = 371

 Score = 39.7 bits (91), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 58/248 (23%), Positives = 100/248 (40%), Gaps = 27/248 (10%)

Query: 603 VPQQMLLNEYPYIMEPLMPPQITQTIQNQYSKSIQAVNAGMEHRTVYIGNINPRSKAEDI 662
           + Q  +  +  Y ME     +    IQN          A ++ R+V I +I   +    +
Sbjct: 130 INQNSVAKDKRYAMETTFANEKIAGIQNP---------AFLKTRSVSISDIPRGTGIASV 180

Query: 663 CNVVRGGILQHI--------KWVSHKRICFVTFIETAAAVQFYANTTLEPIILHGNVLKV 714
            + VRGG L+ I        +   HK   F    + A +   YANT++  +  +G  LK 
Sbjct: 181 LSQVRGGSLERIIVYRYDTPERSLHKVDLFFLNYDGAQSFMRYANTSVFKV--NGVRLKP 238

Query: 715 GW---GQNPGPLPKNIALAVTVGASRNVYVSLPDKAFKDKFINDPQFKEYQNRYKIPNIA 771
            W         + K  ++   V   + +   L  K    K + +   ++     +  N+ 
Sbjct: 239 EWIFLESTYENVIKEQSVNRIVEEEKLISRCLIVKKSSTKTVFNKSNQDRSQNLETINVR 298

Query: 772 QLKSDFGAYGTMEQVN-FHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHKKTEGRYVG 830
           +L+ DF  +G + ++    S   C  I F +ISSA++ +EEY      L +K     +  
Sbjct: 299 ELEKDFQNFGEILEITPIVSRKLCVSIFFYDISSAMRAMEEYEQKGSGLNNK----YFKT 354

Query: 831 LIIGYGKD 838
             I YGKD
Sbjct: 355 WTIWYGKD 362

>ACR135C Chr3 complement(585997..587127) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR242C
           (SSP2)
          Length = 376

 Score = 39.3 bits (90), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 35/71 (49%), Gaps = 5/71 (7%)

Query: 769 NIAQLKSDFGAYGTMEQVN-FHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHKKTEGR 827
           N+ +LK DF  +G +  ++   S   C  INF +I SA+  ++ Y +    L  K  E  
Sbjct: 301 NVQELKKDFSQFGNILDISPMISRKLCVQINFYDIKSAMDALQSYKNANSPLNRKYAE-- 358

Query: 828 YVGLIIGYGKD 838
                IGYGKD
Sbjct: 359 --SWTIGYGKD 367

>TDEL0A06160 Chr1 complement(1078577..1079713) [1137 bp, 378 aa]
           {ON} Anc_8.670 YOR242C
          Length = 378

 Score = 38.9 bits (89), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 40/73 (54%), Gaps = 5/73 (6%)

Query: 767 IPNIAQLKSDFGAYGTMEQVN-FHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHKKTE 825
           + ++A+++ DFG +G ++ +    S   C  I+F ++ SAI+ +++Y D    L+ K   
Sbjct: 301 VLDVAEIRHDFGIFGKVQDIAPIVSRKLCISISFYSVHSAIRAMDDYEDPSSALYKKY-- 358

Query: 826 GRYVGLIIGYGKD 838
             +    + YGKD
Sbjct: 359 --FKNWAVWYGKD 369

>TPHA0D01210 Chr4 complement(253331..254425) [1095 bp, 364 aa] {ON}
           Anc_8.670 YOR242C
          Length = 364

 Score = 37.0 bits (84), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 50/201 (24%), Positives = 85/201 (42%), Gaps = 16/201 (7%)

Query: 646 RTVYIGNINPRSKAEDICNVVRGGILQHIKWVSH------KRICFVTFIETAAAVQFYAN 699
           R +YI +I      + I + + GG L+ +K + H       +   + F++ A A  F   
Sbjct: 163 RVIYIRDIPSNVSMKSIISQIYGGPLESLKLIKHDESRSRNQDMELVFLKKADATNFLRY 222

Query: 700 TTLEPIILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVYVSLPDKAFKDKFINDPQF- 758
           +      ++G  L    G N   L  N A   T+    N+  +L  K +        Q  
Sbjct: 223 SRTHLFHINGKRLYSEPGSNNNLLNSNKAFDSTIN--NNISRTLIMKRYNKTTEKQEQVS 280

Query: 759 KEYQNRYKIPNIAQLKSDFGAYGTMEQVN-FHSDGHCCWINFMNISSAIKLVEEYSDTKD 817
           KE+   Y   +I +++ DF  +G +  +    S   C  I++ NI +A+  ++ Y D   
Sbjct: 281 KEFLIDY--FDIEEVRKDFFQFGNIVDITPIVSRKVCLSISYYNIKAAMDAMKAYDDPYS 338

Query: 818 NLFHKKTEGRYVGLIIGYGKD 838
             FHKK    +V   + YGKD
Sbjct: 339 E-FHKKYSEEWV---VWYGKD 355

>Kwal_55.21914 s55 (1034239..1042167) [7929 bp, 2642 aa] {ON} YLR454W
            - Hypothetical ORF [contig 124] FULL
          Length = 2642

 Score = 37.4 bits (85), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 26/43 (60%), Gaps = 4/43 (9%)

Query: 520  STASTDISTPIYEEFDGNLTWSTLIVDVSEYKEPIVNEFDHHL 562
            S    D +  I+E FDG++TW     D+++YKE +   FD+H+
Sbjct: 1744 SVYGDDCTRSIFEIFDGDMTW----FDITDYKEVLYGGFDNHI 1782

>ZYRO0C05060g Chr3 complement(397083..399233) [2151 bp, 716 aa] {ON}
           similar to uniprot|Q75EC3 Ashbya gossypii AAR151W
           AAR151Wp and weakly similar to YBR212W uniprot|P32831
           Saccharomyces cerevisiae YBR212W NGR1 negative growth
           regulatory protein
          Length = 716

 Score = 36.6 bits (83), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 48/105 (45%), Gaps = 11/105 (10%)

Query: 620 MPPQITQTIQNQYSKSIQAVNAGMEHRTVYIGNINPRSKAEDICNVVR--GGILQHIKWV 677
           +PP I+      +S S QA      + TV+IG + P+     +  +    G IL  +K  
Sbjct: 395 LPPPISTQQLPDFSSSAQAYTTDPNNTTVFIGGLTPKINENQLQTLFSPFGNIL-TVKIP 453

Query: 678 SHKRICFVTF---IETAAAVQFYANTTLEPIILHGNVLKVGWGQN 719
             K   FV F   I+  AA+Q      ++  ++ G  +++ WG+N
Sbjct: 454 QGKNCGFVKFEKRIDAEAAIQ-----GMQGFVVGGCPIRLSWGRN 493

>KLLA0C05522g Chr3 (494240..495862) [1623 bp, 540 aa] {ON} some
           similarities with uniprot|P32831 Saccharomyces
           cerevisiae YBR212W NGR1 negative growth regulatory
           protein
          Length = 540

 Score = 35.4 bits (80), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 43/85 (50%), Gaps = 9/85 (10%)

Query: 638 AVNAGMEHRTVYIGNINPRSKAEDICNVVRG-GILQHIKWVSHKRICFVTF---IETAAA 693
           A+NAG+   TV++G +NP      +  + +  G +  +K    K+  FV +   +E  AA
Sbjct: 437 AMNAGVSSTTVFVGGLNPNINELQLFELFKPFGTITDVKIPPGKQCGFVKYNERLEAEAA 496

Query: 694 VQFYANTTLEPIILHGNVLKVGWGQ 718
           +       L+  I+ G+ +++ WG+
Sbjct: 497 I-----NGLQGFIIMGSPIRLSWGR 516

>YOR242C Chr15 complement(788742..789857) [1116 bp, 371 aa] {ON}
           SSP2Sporulation specific protein that localizes to the
           spore wall; required for sporulation at a point after
           meiosis II and during spore wall formation; SSP2
           expression is induced midway in meiosis
          Length = 371

 Score = 35.0 bits (79), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 37/71 (52%), Gaps = 5/71 (7%)

Query: 769 NIAQLKSDFGAYGTMEQVN-FHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHKKTEGR 827
           +I +L+ DF  +G + ++    S   C  I F +ISSA++ +EEY      L++K     
Sbjct: 296 DIQELEKDFQNFGEVLEITPIVSRKLCVSIFFYDISSAMRAMEEYEQKGSYLYNK----Y 351

Query: 828 YVGLIIGYGKD 838
           +    I YGKD
Sbjct: 352 FKTWTIWYGKD 362

>Suva_8.292 Chr8 complement(527751..528863) [1113 bp, 370 aa] {ON}
           YOR242C (REAL)
          Length = 370

 Score = 35.0 bits (79), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 37/71 (52%), Gaps = 5/71 (7%)

Query: 769 NIAQLKSDFGAYGTMEQVN-FHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHKKTEGR 827
           +I +L+ DF  +G + ++    S   C  I F +ISSA++ +EEY      L++K     
Sbjct: 295 DIQELEKDFQNFGEVLEITPIVSRKLCVSIFFYDISSAMRAMEEYEQKGSYLYNK----Y 350

Query: 828 YVGLIIGYGKD 838
           +    I YGKD
Sbjct: 351 FKTWTIWYGKD 361

>TBLA0C01820 Chr3 complement(429227..430411) [1185 bp, 394 aa] {ON}
           Anc_8.670 YOR242C
          Length = 394

 Score = 33.9 bits (76), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 39/71 (54%), Gaps = 5/71 (7%)

Query: 769 NIAQLKSDFGAYGTMEQVN-FHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHKKTEGR 827
           ++  LK+DF  YGT+  V    S   C  ++F N++SAI+ ++ + + K    +KK   R
Sbjct: 319 SVCGLKNDFKKYGTILDVTPIVSRKLCFAVHFANVASAIRAMQAF-ELKGTELNKKYYKR 377

Query: 828 YVGLIIGYGKD 838
           +    + YGKD
Sbjct: 378 WA---MWYGKD 385

>KAFR0D01660 Chr4 (330013..330651) [639 bp, 212 aa] {ON} Anc_8.797
           YOR319W
          Length = 212

 Score = 33.5 bits (75), Expect = 2.4,   Method: Composition-based stats.
 Identities = 24/86 (27%), Positives = 45/86 (52%), Gaps = 12/86 (13%)

Query: 644 EHRTVYIGNINPRSKAEDICNV-VRGGILQHIKWV------SHKRICFVTFIETAA---A 693
           + RTVY+GNI+PR   ED+  + V+ G ++ I +       +H+   F+ F+  +     
Sbjct: 5   KERTVYVGNIDPRVNKEDLYELFVQFGRIKKINYPRDKVLDTHQGYAFIEFLNDSTVDYV 64

Query: 694 VQFYANTTLEPIILHGNVLKVGWGQN 719
           ++ + NT L  + L+   LK+   +N
Sbjct: 65  LKLFGNTNL--VSLYERSLKIRKSEN 88

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 109,794,669
Number of extensions: 4518908
Number of successful extensions: 12864
Number of sequences better than 10.0: 58
Number of HSP's gapped: 12910
Number of HSP's successfully gapped: 151
Length of query: 1151
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1030
Effective length of database: 39,606,813
Effective search space: 40795017390
Effective search space used: 40795017390
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.5 bits)
S2: 71 (32.0 bits)