Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D01452g8.845ON1445144563660.0
SAKL0D01342g8.845ON127094825920.0
ABL121C8.845ON1285100323370.0
KLTH0C03762g8.845ON120694622560.0
TDEL0B005308.845ON130197421820.0
Kwal_27.102328.845ON120994921440.0
ZYRO0G14278g8.845ON125077017890.0
Ecym_46168.845ON157786918020.0
Suva_13.4688.845ON1418100816470.0
Skud_13.4528.845ON143288716030.0
YMR280C (CAT8)8.845ON143390016000.0
Smik_13.4938.845ON143388915960.0
KAFR0B039508.845ON124675314900.0
NCAS0C003908.845ON116464114631e-179
KNAG0J002508.845ON123774614501e-177
NDAI0K003908.845ON149583613871e-165
CAGL0M03025g8.845ON125476712671e-150
Kpol_1016.201.277ON1086482277e-18
AFR096W1.277ON852482222e-17
Ecym_63401.277ON952482161e-16
TPHA0I028201.277ON1044482161e-16
KLTH0D03564g1.277ON862482152e-16
KAFR0A014801.277ON725492142e-16
SAKL0D05654g1.277ON919482152e-16
ZYRO0G15136g1.277ON1027482124e-16
KLLA0F14322g1.277ON717482096e-16
Smik_10.1531.277ON829482099e-16
YJL089W (SIP4)1.277ON829482071e-15
Kwal_26.7397singletonOFF201481922e-15
Skud_10.1251.277ON833482052e-15
Suva_6.1611.277ON832482043e-15
KNAG0B018401.277ON1072491991e-14
TDEL0D014501.277ON945481991e-14
NDAI0G055301.277ON1186481972e-14
CAGL0L03377g1.277ON1209481945e-14
TBLA0D054201.277ON757481919e-14
NCAS0A094101.277ON932481713e-11
KLLA0C10923g5.235ON775491392e-07
TBLA0G026102.231ON1000421347e-07
NDAI0F012206.279ON960451283e-06
KLLA0E13993gsingletonON678441274e-06
KNAG0D006906.279ON875451274e-06
KAFR0F014901.128ON6581211264e-06
KLLA0F04609g2.231ON916331274e-06
Smik_6.4526.279ON878471265e-06
SAKL0G11902g5.235ON906481265e-06
YPL248C (GAL4)6.279ON881471266e-06
KAFR0J017102.231ON848331256e-06
NCAS0B065502.231ON906331257e-06
NDAI0B038502.231ON930411248e-06
Smik_9.392.231ON1012331248e-06
Suva_9.592.231ON926331249e-06
YIL130W (ASG1)2.231ON964331249e-06
Kpol_1018.306.279ON881451249e-06
Skud_9.372.231ON954451249e-06
Ecym_7440na 1ON898421231e-05
NCAS0G011006.279ON935451231e-05
TDEL0C044802.231ON852411231e-05
KAFR0J006905.235ON864441231e-05
NCAS0D041906.279ON890451231e-05
TDEL0E039105.235ON862441221e-05
KLTH0G09108g2.231ON782331221e-05
CAGL0G08844g2.231ON847411222e-05
Kwal_23.47542.231ON812331222e-05
SAKL0E08998g2.231ON823411222e-05
Kpol_1039.112.231ON992331222e-05
NCAS0D025405.235ON890441222e-05
KNAG0E017602.231ON902331212e-05
ZYRO0E08272g6.279ON794471212e-05
NDAI0I023505.235ON889441193e-05
TPHA0H019806.279ON993471193e-05
KLTH0E14454gna 1ON902451193e-05
TBLA0G018006.279ON1154451193e-05
Suva_10.945.235ON906441194e-05
SAKL0A02860g6.279ON745451185e-05
Suva_16.596.279ON895451185e-05
Smik_12.775.235ON903441175e-05
TPHA0F013802.231ON890331175e-05
ZYRO0A10956g5.235ON855441176e-05
KAFR0F010406.279ON834471167e-05
SAKL0H24860gna 2ON9711971167e-05
Kwal_23.29055.235ON881481168e-05
KLTH0D02222gna 3ON847471168e-05
YLR014C (PPR1)5.235ON904441168e-05
AER183Cna 1ON879421168e-05
KLTH0G07898g5.235ON866481159e-05
Kpol_495.213.109ON1085371159e-05
NDAI0I007406.279ON1033451159e-05
SAKL0C02024gsingletonON898481151e-04
TDEL0E00160singletonON631471151e-04
AGR280C6.75ON11062941151e-04
SAKL0C03938g1.128ON780331141e-04
Skud_12.825.235ON899441141e-04
Ecym_31126.75ON11442111132e-04
ZYRO0E06270g2.565ON912461132e-04
SAKL0A09856g2.547ON1020501132e-04
NDAI0A087907.17ON1059341132e-04
AER370W2.231ON801331122e-04
Smik_2.438na 4ON469421112e-04
KLTH0H16170gna 5ON619331112e-04
TBLA0C040504.113ON1207361122e-04
NDAI0F00110singletonON508331112e-04
Ecym_53972.231ON826331113e-04
SAKL0H00682gna 6ON922461113e-04
CAGL0A00451g4.113ON1107421113e-04
KLTH0B00352gsingletonON934431113e-04
KAFR0F034104.113ON995371113e-04
YBR297W (MAL33)na 4ON468411103e-04
TBLA0A012101.380ON1422301114e-04
KNAG0I005601.128ON6631831104e-04
Smik_11.2402.654ON9761791104e-04
KLTH0D07260g2.547ON979501095e-04
KAFR0E023305.59ON7043341095e-04
KNAG0B051205.235ON888441095e-04
CAGL0M12298g7.17ON994461096e-04
KNAG0E002107.17ON948331086e-04
KLTH0G15180g6.75ON10963241096e-04
SAKL0B06732gna 1ON878421086e-04
Smik_11.2102.547ON1169501086e-04
YGL013C (PDR1)4.113ON1068381086e-04
KLLA0D12672g6.279ON865451086e-04
Smik_18.8singletonON775381087e-04
Skud_10.101.128ON8331041087e-04
KNAG0A071002.547ON1286501087e-04
TDEL0C056801.128ON6912281078e-04
KAFR0B014502.547ON1088501079e-04
CAGL0K05841g1.380ON1372301079e-04
YJL206C1.128ON7581041079e-04
KLLA0F09559gsingletonON658381060.001
TPHA0A045403.109ON1178371070.001
KNAG0E041507.17ON1136461070.001
CAGL0L01903g2.547ON1287481070.001
Smik_7.2774.113ON1069381060.001
KLTH0H02684g6.279ON749451060.001
Skud_2.427na 4ON468381050.001
Skud_7.2744.113ON1080381060.001
NDAI0D00900singletonON865331060.001
TBLA0C062306.60ON795331050.001
NCAS0A035804.113ON1113371050.001
Suva_15.773.109ON1029471050.001
KLLA0A09119g4.113ON1082361050.001
Suva_6.2851.128ON7861041050.002
KLLA0F22990g1.380ON1253301050.002
TBLA0G011308.879ON1132341050.002
TDEL0D051503.109ON996471040.002
SAKL0D01100g4.113ON940361040.002
TPHA0N002307.17ON1232331040.002
Ecym_27321.380ON1198301040.002
TBLA0D006307.389ON1077391040.002
SAKL0D00264g8.879ON848291040.002
Skud_11.1902.547ON1171501040.002
NCAS0I002707.17ON944341040.002
SAKL0A00704gna 7ON718461040.002
Smik_13.1832.565ON911461040.002
TBLA0A097606.75ON1530431040.002
TPHA0A06090singletonON847331040.002
Suva_16.25singletonON14342960.003
Kwal_26.81092.547ON970501030.003
ZYRO0C18150g1.128ON571381020.003
Smik_10.251.128ON7721041030.003
Skud_11.2142.654ON9811771030.003
Kpol_538.427.17ON1088421030.003
KAFR0L021308.879ON882291030.003
NCAS0C002208.879ON839291020.003
Suva_11.2132.654ON9852511030.003
KNAG0A025508.423ON730381020.003
SAKL0D14520g7.17ON983331020.003
Skud_15.643.109ON1032331020.003
SAKL0C09944g3.109ON1061361020.003
NCAS0A047502.547ON1141501020.003
NDAI0D035504.113ON1118421020.003
ACL058Wna 2ON817881020.003
Kpol_345.36.75ON13682161020.003
KLLA0F25630g2.547ON1007551020.004
CAGL0F07909g3.109ON1049361020.004
CAGL0B03421g1.380ON1355301020.004
KAFR0I020301.380ON1233301020.004
YKL015W (PUT3)2.654ON9791721020.004
KAFR0C049807.17ON951411020.004
YKL038W (RGT1)2.547ON1170501020.004
KNAG0I014501.380ON1476301020.004
Suva_7.2684.113ON1000381010.004
NDAI0G052601.380ON1581301020.004
NCAS0C027308.423ON775391010.004
Smik_1.137.17ON1046461010.004
Kpol_467.11.380ON1289301010.004
KLLA0A02585gna 8ON37037990.005
ZYRO0A13596gsingletonON648371000.005
Skud_15.546na 9ON542461000.005
Suva_4.4003.109ON1037991010.005
NCAS0A088401.380ON1478301010.005
Skud_7.638singletonON473391000.005
Suva_11.1872.547ON1171501000.005
NCAS0A03070singletonON656331000.006
KLLA0C03201g1.128ON6501701000.006
Ecym_2522na 7ON926341000.006
KLLA0F02750g3.109ON1148361000.006
YLR256W (HAP1)1.380ON1502301000.006
SAKL0D07898g1.380ON1244301000.006
TPHA0B036301.380ON1429321000.006
SAKL0B04620gna 8ON36237980.006
NCAS0A016304.113ON1043331000.006
Suva_13.1862.565ON894401000.007
Kwal_YGOB_0.1391.380ON1240301000.007
SAKL0D13464g2.565ON68748990.007
ZYRO0G22550gsingletonON72437990.007
Suva_1.147.17ON104546990.007
CAGL0F07865g8.423ON84429990.007
NDAI0H019907.17ON116133990.007
Smik_17.27singletonON68833990.007
NDAI0A034204.113ON110833990.007
AFL160C6.279ON64847990.007
YGR288W (MAL13)na 10ON47330980.008
NDAI0E034608.423ON94942990.008
Skud_9.220singletonON79333990.008
TBLA0C011201.380ON148631990.008
Suva_10.3238.423ON81338990.008
TPHA0L010608.423ON97329990.008
KLTH0H11572g1.380ON123730990.008
Kwal_34.15751na 5ON62833980.008
Skud_12.3351.380ON147930990.008
Skud_1.107.17ON104046990.009
Smik_12.3271.380ON150330990.009
TBLA0B04800singletonON77726980.009
TBLA0G00490singletonON91837980.009
NDAI0C048408.423ON94843980.009
AFR117C1.380ON115230990.009
Smik_15.561na 9ON54647980.009
KAFR0I002307.17ON104533980.009
KLLA0A04169g8.423ON77529980.009
Suva_8.436na 9ON54538980.009
Skud_5.331singletonON17038930.009
CAGL0A04455g7.389ON109843980.010
YOR380W (RDR1)na 9ON54646980.010
Kwal_26.7095na 3ON83848980.010
NDAI0D03540na 11ON110742980.010
Kwal_23.31228.423ON78838980.010
CAGL0F09229gna 12ON83533980.011
ZYRO0G19338gna 13ON65329970.011
TPHA0F008304.113ON119249980.011
YAL051W (OAF1)7.17ON104746980.011
ZYRO0C00726g7.17ON103546980.012
KNAG0A02300singletonON72931970.012
NDAI0G041403.109ON100145970.012
Suva_10.3511.380ON32430960.012
YMR019W (STB4)2.565ON94946970.013
TBLA0G005106.60ON93537970.013
Kwal_0.142singletonOFF62930970.013
Smik_12.3576.75ON128841970.014
Kwal_47.17681na 14ON854342970.014
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D01452g
         (1445 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D01452g Chr4 (124018..128355) [4338 bp, 1445 aa] {ON} simil...  2456   0.0  
SAKL0D01342g Chr4 (101095..104907) [3813 bp, 1270 aa] {ON} simil...  1003   0.0  
ABL121C Chr2 complement(170782..174639) [3858 bp, 1285 aa] {ON} ...   904   0.0  
KLTH0C03762g Chr3 (324666..328286) [3621 bp, 1206 aa] {ON} simil...   873   0.0  
TDEL0B00530 Chr2 (95898..99803) [3906 bp, 1301 aa] {ON} Anc_8.84...   845   0.0  
Kwal_27.10232 s27 (251015..254644) [3630 bp, 1209 aa] {ON} YMR28...   830   0.0  
ZYRO0G14278g Chr7 complement(1141297..1145049) [3753 bp, 1250 aa...   693   0.0  
Ecym_4616 Chr4 complement(1204091..1208824) [4734 bp, 1577 aa] {...   698   0.0  
Suva_13.468 Chr13 complement(809712..812654,812694..814007) [425...   639   0.0  
Skud_13.452 Chr13 complement(800289..804587) [4299 bp, 1432 aa] ...   622   0.0  
YMR280C Chr13 complement(827028..831329) [4302 bp, 1433 aa] {ON}...   620   0.0  
Smik_13.493 Chr13 complement(810035..814336) [4302 bp, 1433 aa] ...   619   0.0  
KAFR0B03950 Chr2 complement(823760..827500) [3741 bp, 1246 aa] {...   578   0.0  
NCAS0C00390 Chr3 (57333..60827) [3495 bp, 1164 aa] {ON} Anc_8.845     568   e-179
KNAG0J00250 Chr10 (33322..37035) [3714 bp, 1237 aa] {ON} Anc_8.8...   563   e-177
NDAI0K00390 Chr11 (84641..89128) [4488 bp, 1495 aa] {ON} Anc_8.845    538   e-165
CAGL0M03025g Chr13 complement(341849..345613) [3765 bp, 1254 aa]...   492   e-150
Kpol_1016.20 s1016 (51828..55088) [3261 bp, 1086 aa] {ON} (51828...    92   7e-18
AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic ho...    90   2e-17
Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}...    88   1e-16
TPHA0I02820 Chr9 complement(620925..624059) [3135 bp, 1044 aa] {...    88   1e-16
KLTH0D03564g Chr4 (343546..346134) [2589 bp, 862 aa] {ON} weakly...    87   2e-16
KAFR0A01480 Chr1 (294040..296217) [2178 bp, 725 aa] {ON} Anc_1.2...    87   2e-16
SAKL0D05654g Chr4 (457485..460244) [2760 bp, 919 aa] {ON} weakly...    87   2e-16
ZYRO0G15136g Chr7 complement(1218989..1222072) [3084 bp, 1027 aa...    86   4e-16
KLLA0F14322g Chr6 (1328925..1331078) [2154 bp, 717 aa] {ON} unip...    85   6e-16
Smik_10.153 Chr10 (257677..260166) [2490 bp, 829 aa] {ON} YJL089...    85   9e-16
YJL089W Chr10 (265926..268415) [2490 bp, 829 aa] {ON}  SIP4C6 zi...    84   1e-15
Kwal_26.7397 s26 complement(342483..343085) [603 bp, 201 aa] {OF...    79   2e-15
Skud_10.125 Chr10 (233921..236422) [2502 bp, 833 aa] {ON} YJL089...    84   2e-15
Suva_6.161 Chr6 complement(283370..284500,284547..284764,284948....    83   3e-15
KNAG0B01840 Chr2 (345204..348422) [3219 bp, 1072 aa] {ON} Anc_1....    81   1e-14
TDEL0D01450 Chr4 (284869..287706) [2838 bp, 945 aa] {ON} Anc_1.2...    81   1e-14
NDAI0G05530 Chr7 (1360413..1363973) [3561 bp, 1186 aa] {ON}            80   2e-14
CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]...    79   5e-14
TBLA0D05420 Chr4 complement(1334955..1337228) [2274 bp, 757 aa] ...    78   9e-14
NCAS0A09410 Chr1 complement(1865924..1868722) [2799 bp, 932 aa] ...    70   3e-11
KLLA0C10923g Chr3 complement(939148..941475) [2328 bp, 775 aa] {...    58   2e-07
TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {...    56   7e-07
NDAI0F01220 Chr6 complement(295418..298300) [2883 bp, 960 aa] {O...    54   3e-06
KLLA0E13993g Chr5 complement(1239566..1241602) [2037 bp, 678 aa]...    54   4e-06
KNAG0D00690 Chr4 (105640..108267) [2628 bp, 875 aa] {ON} Anc_6.2...    54   4e-06
KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa] {O...    53   4e-06
KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa] {...    54   4e-06
Smik_6.452 Chr6 (741922..744558) [2637 bp, 878 aa] {ON} YPL248C ...    53   5e-06
SAKL0G11902g Chr7 (1016915..1019635) [2721 bp, 906 aa] {ON} simi...    53   5e-06
YPL248C Chr16 complement(79711..82356) [2646 bp, 881 aa] {ON}  G...    53   6e-06
KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa] {...    53   6e-06
NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa] ...    53   7e-06
NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa] {O...    52   8e-06
Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W (R...    52   8e-06
Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W (R...    52   9e-06
YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc c...    52   9e-06
Kpol_1018.30 s1018 complement(81534..83840,83842..84180) [2646 b...    52   9e-06
Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W (REAL)    52   9e-06
Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}...    52   1e-05
NCAS0G01100 Chr7 complement(193052..195859) [2808 bp, 935 aa] {O...    52   1e-05
TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON} Anc_2.2...    52   1e-05
KAFR0J00690 Chr10 (124449..127043) [2595 bp, 864 aa] {ON} Anc_5....    52   1e-05
NCAS0D04190 Chr4 (793242..795914) [2673 bp, 890 aa] {ON} Anc_6.279     52   1e-05
TDEL0E03910 Chr5 (732533..735121) [2589 bp, 862 aa] {ON} Anc_5.2...    52   1e-05
KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly...    52   1e-05
CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa] {...    52   2e-05
Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W...    52   2e-05
SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa] {...    52   2e-05
Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON} (29727....    52   2e-05
NCAS0D02540 Chr4 complement(484060..486732) [2673 bp, 890 aa] {O...    52   2e-05
KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON} Anc_2.2...    51   2e-05
ZYRO0E08272g Chr5 (651705..654089) [2385 bp, 794 aa] {ON} simila...    51   2e-05
NDAI0I02350 Chr9 (536448..539117) [2670 bp, 889 aa] {ON} Anc_5.235     50   3e-05
TPHA0H01980 Chr8 (467688..470669) [2982 bp, 993 aa] {ON} Anc_6.2...    50   3e-05
KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]...    50   3e-05
TBLA0G01800 Chr7 complement(469668..473132) [3465 bp, 1154 aa] {...    50   3e-05
Suva_10.94 Chr10 complement(178366..181086) [2721 bp, 906 aa] {O...    50   4e-05
SAKL0A02860g Chr1 complement(259388..261625) [2238 bp, 745 aa] {...    50   5e-05
Suva_16.59 Chr16 complement(88631..91318) [2688 bp, 895 aa] {ON}...    50   5e-05
Smik_12.77 Chr12 complement(159125..161836) [2712 bp, 903 aa] {O...    50   5e-05
TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {O...    50   5e-05
ZYRO0A10956g Chr1 (881429..883996) [2568 bp, 855 aa] {ON} simila...    50   6e-05
KAFR0F01040 Chr6 complement(195192..197696) [2505 bp, 834 aa] {O...    49   7e-05
SAKL0H24860g Chr8 complement(2162455..2165370) [2916 bp, 971 aa]...    49   7e-05
Kwal_23.2905 s23 (69235..71880) [2646 bp, 881 aa] {ON} YLR014C (...    49   8e-05
KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly...    49   8e-05
YLR014C Chr12 complement(172268..174982) [2715 bp, 904 aa] {ON} ...    49   8e-05
AER183C Chr5 complement(975879..978518) [2640 bp, 879 aa] {ON} N...    49   8e-05
KLTH0G07898g Chr7 (636890..639490) [2601 bp, 866 aa] {ON} simila...    49   9e-05
Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON} (71447.....    49   9e-05
NDAI0I00740 Chr9 complement(160212..163313) [3102 bp, 1033 aa] {...    49   9e-05
SAKL0C02024g Chr3 complement(174858..177554) [2697 bp, 898 aa] {...    49   1e-04
TDEL0E00160 Chr5 (16083..17978) [1896 bp, 631 aa] {ON}                 49   1e-04
AGR280C Chr7 complement(1266912..1270232) [3321 bp, 1106 aa] {ON...    49   1e-04
SAKL0C03938g Chr3 complement(377431..379773) [2343 bp, 780 aa] {...    49   1e-04
Skud_12.82 Chr12 complement(164119..166818) [2700 bp, 899 aa] {O...    49   1e-04
Ecym_3112 Chr3 (203876..207310) [3435 bp, 1144 aa] {ON} similar ...    48   2e-04
ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly...    48   2e-04
SAKL0A09856g Chr1 complement(867959..871021) [3063 bp, 1020 aa] ...    48   2e-04
NDAI0A08790 Chr1 complement(2026171..2029350) [3180 bp, 1059 aa]...    48   2e-04
AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic ...    48   2e-04
Smik_2.438 Chr2 (786437..787846) [1410 bp, 469 aa] {ON} YBR297W ...    47   2e-04
KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]...    47   2e-04
TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa] {...    48   2e-04
NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON}                 47   2e-04
Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar t...    47   3e-04
SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON...    47   3e-04
CAGL0A00451g Chr1 (47557..50880) [3324 bp, 1107 aa] {ON} similar...    47   3e-04
KLTH0B00352g Chr2 complement(31952..34756) [2805 bp, 934 aa] {ON...    47   3e-04
KAFR0F03410 Chr6 complement(677156..680143) [2988 bp, 995 aa] {O...    47   3e-04
YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}  MAL33MAL-a...    47   3e-04
TBLA0A01210 Chr1 (276151..280419) [4269 bp, 1422 aa] {ON} Anc_1....    47   4e-04
KNAG0I00560 Chr9 complement(93785..95776) [1992 bp, 663 aa] {ON}...    47   4e-04
Smik_11.240 Chr11 (395459..395932,395981..398437) [2931 bp, 976 ...    47   4e-04
KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa] {...    47   5e-04
KAFR0E02330 Chr5 (468300..470414) [2115 bp, 704 aa] {ON} Anc_5.5...    47   5e-04
KNAG0B05120 Chr2 (982236..984902) [2667 bp, 888 aa] {ON}               47   5e-04
CAGL0M12298g Chr13 complement(1227303..1230287) [2985 bp, 994 aa...    47   6e-04
KNAG0E00210 Chr5 (24545..27391) [2847 bp, 948 aa] {ON} Anc_7.17 ...    46   6e-04
KLTH0G15180g Chr7 (1326581..1329871) [3291 bp, 1096 aa] {ON} sim...    47   6e-04
SAKL0B06732g Chr2 complement(578508..581144) [2637 bp, 878 aa] {...    46   6e-04
Smik_11.210 Chr11 (352056..355565) [3510 bp, 1169 aa] {ON} YKL03...    46   6e-04
YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON} ...    46   6e-04
KLLA0D12672g Chr4 complement(1076011..1078608) [2598 bp, 865 aa]...    46   6e-04
Smik_18.8 Chr18 (12069..14396) [2328 bp, 775 aa] {ON} YOR172W (R...    46   7e-04
Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}...    46   7e-04
KNAG0A07100 Chr1 complement(1113008..1116868) [3861 bp, 1286 aa]...    46   7e-04
TDEL0C05680 Chr3 complement(1020646..1022721) [2076 bp, 691 aa] ...    46   8e-04
KAFR0B01450 Chr2 (273614..276880) [3267 bp, 1088 aa] {ON} Anc_2....    46   9e-04
CAGL0K05841g Chr11 (573144..577262) [4119 bp, 1372 aa] {ON} simi...    46   9e-04
YJL206C Chr10 complement(47659..49935) [2277 bp, 758 aa] {ON} Pu...    46   9e-04
KLLA0F09559g Chr6 complement(876719..878695) [1977 bp, 658 aa] {...    45   0.001
TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON} Anc_...    46   0.001
KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa] {...    46   0.001
CAGL0L01903g Chr12 (220700..224563) [3864 bp, 1287 aa] {ON} simi...    46   0.001
Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa] {O...    45   0.001
KLTH0H02684g Chr8 complement(235527..237776) [2250 bp, 749 aa] {...    45   0.001
Skud_2.427 Chr2 (769889..771295) [1407 bp, 468 aa] {ON} YGR288W ...    45   0.001
Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa] {O...    45   0.001
NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON}               45   0.001
TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON} Anc_6...    45   0.001
NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa] {...    45   0.001
Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {...    45   0.001
KLLA0A09119g Chr1 complement(797533..800781) [3249 bp, 1082 aa] ...    45   0.001
Suva_6.285 Chr6 (499581..501941) [2361 bp, 786 aa] {ON} YJL206C ...    45   0.002
KLLA0F22990g Chr6 (2134385..2138146) [3762 bp, 1253 aa] {ON} uni...    45   0.002
TBLA0G01130 Chr7 (287952..291350) [3399 bp, 1132 aa] {ON} Anc_8....    45   0.002
TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.1...    45   0.002
SAKL0D01100g Chr4 complement(81235..84057) [2823 bp, 940 aa] {ON...    45   0.002
TPHA0N00230 Chr14 (39855..43553) [3699 bp, 1232 aa] {ON} Anc_7.1...    45   0.002
Ecym_2732 Chr2 (1410290..1413886) [3597 bp, 1198 aa] {ON} simila...    45   0.002
TBLA0D00630 Chr4 complement(164651..167884) [3234 bp, 1077 aa] {...    45   0.002
SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON...    45   0.002
Skud_11.190 Chr11 (345221..348736) [3516 bp, 1171 aa] {ON} YKL03...    45   0.002
NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}...    45   0.002
SAKL0A00704g Chr1 complement(78811..80967) [2157 bp, 718 aa] {ON...    45   0.002
Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911 ...    45   0.002
TBLA0A09760 Chr1 complement(2398683..2403275) [4593 bp, 1530 aa]...    45   0.002
TPHA0A06090 Chr1 complement(1372559..1375102) [2544 bp, 847 aa] ...    45   0.002
Suva_16.25 Chr16 complement(31437..31868) [432 bp, 143 aa] {ON} ...    42   0.003
Kwal_26.8109 s26 complement(650270..653182) [2913 bp, 970 aa] {O...    44   0.003
ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some...    44   0.003
Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}...    44   0.003
Skud_11.214 Chr11 (389377..389855,389895..392361) [2946 bp, 981 ...    44   0.003
Kpol_538.42 s538 complement(89752..93018) [3267 bp, 1088 aa] {ON...    44   0.003
KAFR0L02130 Chr12 (403953..406601) [2649 bp, 882 aa] {ON} Anc_8....    44   0.003
NCAS0C00220 Chr3 (22532..25051) [2520 bp, 839 aa] {ON} Anc_8.879       44   0.003
Suva_11.213 Chr11 (392506..392993,393045..395514) [2958 bp, 985 ...    44   0.003
KNAG0A02550 Chr1 complement(262867..265059) [2193 bp, 730 aa] {O...    44   0.003
SAKL0D14520g Chr4 complement(1192788..1195739) [2952 bp, 983 aa]...    44   0.003
Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {...    44   0.003
SAKL0C09944g Chr3 complement(899127..902312) [3186 bp, 1061 aa] ...    44   0.003
NCAS0A04750 Chr1 (944929..948354) [3426 bp, 1141 aa] {ON} Anc_2....    44   0.003
NDAI0D03550 Chr4 complement(843265..846621) [3357 bp, 1118 aa] {...    44   0.003
ACL058W Chr3 (261723..264176) [2454 bp, 817 aa] {ON} NOHBY305; N...    44   0.003
Kpol_345.3 s345 complement(7411..11517) [4107 bp, 1368 aa] {ON} ...    44   0.003
KLLA0F25630g Chr6 (2378464..2381487) [3024 bp, 1007 aa] {ON} som...    44   0.004
CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some ...    44   0.004
CAGL0B03421g Chr2 complement(336071..340138) [4068 bp, 1355 aa] ...    44   0.004
KAFR0I02030 Chr9 complement(416471..420172) [3702 bp, 1233 aa] {...    44   0.004
YKL015W Chr11 (408544..411483) [2940 bp, 979 aa] {ON}  PUT3Trans...    44   0.004
KAFR0C04980 Chr3 (987900..990755) [2856 bp, 951 aa] {ON} Anc_7.1...    44   0.004
YKL038W Chr11 (365605..369117) [3513 bp, 1170 aa] {ON}  RGT1Gluc...    44   0.004
KNAG0I01450 Chr9 (277513..281943) [4431 bp, 1476 aa] {ON}              44   0.004
Suva_7.268 Chr7 complement(460629..463631) [3003 bp, 1000 aa] {O...    44   0.004
NDAI0G05260 Chr7 (1277631..1282376) [4746 bp, 1581 aa] {ON} Anc_...    44   0.004
NCAS0C02730 Chr3 (513280..515607) [2328 bp, 775 aa] {ON} Anc_8.423     44   0.004
Smik_1.13 Chr1 (31514..34654) [3141 bp, 1046 aa] {ON} YAL051W (R...    44   0.004
Kpol_467.1 s467 (471..4340) [3870 bp, 1289 aa] {ON} (471..4340) ...    44   0.004
KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa] {...    43   0.005
ZYRO0A13596g Chr1 complement(1080653..1082599) [1947 bp, 648 aa]...    43   0.005
Skud_15.546 Chr15 (990335..991963) [1629 bp, 542 aa] {ON} YOR380...    43   0.005
Suva_4.400 Chr4 complement(710591..713704) [3114 bp, 1037 aa] {O...    44   0.005
NCAS0A08840 Chr1 (1746841..1751277) [4437 bp, 1478 aa] {ON} Anc_...    44   0.005
Skud_7.638 Chr7 (1060062..1061483) [1422 bp, 473 aa] {ON} YFL052...    43   0.005
Suva_11.187 Chr11 (348570..352085) [3516 bp, 1171 aa] {ON} YKL03...    43   0.005
NCAS0A03070 Chr1 (603639..605609) [1971 bp, 656 aa] {ON}               43   0.006
KLLA0C03201g Chr3 complement(286973..288925) [1953 bp, 650 aa] {...    43   0.006
Ecym_2522 Chr2 (1017930..1020710) [2781 bp, 926 aa] {ON} similar...    43   0.006
KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa] ...    43   0.006
YLR256W Chr12 (646415..650923) [4509 bp, 1502 aa] {ON}  HAP1Zinc...    43   0.006
SAKL0D07898g Chr4 complement(653332..657066) [3735 bp, 1244 aa] ...    43   0.006
TPHA0B03630 Chr2 (844571..848860) [4290 bp, 1429 aa] {ON} Anc_1....    43   0.006
SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa] {...    42   0.006
NCAS0A01630 Chr1 complement(317259..320390) [3132 bp, 1043 aa] {...    43   0.006
Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019...    43   0.007
Kwal_YGOB_0.139 s0 complement(61752..63560,63594..65507) [3723 b...    43   0.007
SAKL0D13464g Chr4 (1116277..1118340) [2064 bp, 687 aa] {ON} weak...    43   0.007
ZYRO0G22550g Chr7 complement(1856064..1858238) [2175 bp, 724 aa]...    43   0.007
Suva_1.14 Chr1 (25653..28790) [3138 bp, 1045 aa] {ON} YAL051W (R...    43   0.007
CAGL0F07865g Chr6 complement(768270..770804) [2535 bp, 844 aa] {...    43   0.007
NDAI0H01990 Chr8 complement(481983..485468) [3486 bp, 1161 aa] {...    43   0.007
Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}...    43   0.007
NDAI0A03420 Chr1 complement(782010..785336) [3327 bp, 1108 aa] {...    43   0.007
AFL160C Chr6 complement(130842..132788) [1947 bp, 648 aa] {ON} S...    43   0.007
YGR288W Chr7 (1070293..1071714) [1422 bp, 473 aa] {ON}  MAL13MAL...    42   0.008
NDAI0E03460 Chr5 (742144..744993) [2850 bp, 949 aa] {ON} Anc_8.423     43   0.008
Skud_9.220 Chr9 complement(396576..398957) [2382 bp, 793 aa] {ON...    43   0.008
TBLA0C01120 Chr3 complement(233451..237911) [4461 bp, 1486 aa] {...    43   0.008
Suva_10.323 Chr10 complement(566314..568755) [2442 bp, 813 aa] {...    43   0.008
TPHA0L01060 Chr12 (220857..223778) [2922 bp, 973 aa] {ON} Anc_8....    43   0.008
KLTH0H11572g Chr8 complement(989095..992808) [3714 bp, 1237 aa] ...    43   0.008
Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig ...    42   0.008
Skud_12.335 Chr12 (592952..597391) [4440 bp, 1479 aa] {ON} YLR25...    43   0.008
Skud_1.10 Chr1 (24510..27632) [3123 bp, 1040 aa] {ON} YAL051W (R...    43   0.009
Smik_12.327 Chr12 (590984..595495) [4512 bp, 1503 aa] {ON} YLR25...    43   0.009
TBLA0B04800 Chr2 complement(1127000..1129333) [2334 bp, 777 aa] ...    42   0.009
TBLA0G00490 Chr7 (99344..102100) [2757 bp, 918 aa] {ON}                42   0.009
NDAI0C04840 Chr3 (1117201..1120047) [2847 bp, 948 aa] {ON} Anc_8...    42   0.009
AFR117C Chr6 complement(646829..650287) [3459 bp, 1152 aa] {ON} ...    43   0.009
Smik_15.561 Chr15 (997239..998879) [1641 bp, 546 aa] {ON} YOR380...    42   0.009
KAFR0I00230 Chr9 (48095..51232) [3138 bp, 1045 aa] {ON} Anc_7.17...    42   0.009
KLLA0A04169g Chr1 complement(376273..378600) [2328 bp, 775 aa] {...    42   0.009
Suva_8.436 Chr8 (788699..790336) [1638 bp, 545 aa] {ON} YOR380W ...    42   0.009
Skud_5.331 Chr5 complement(543439..543951) [513 bp, 170 aa] {ON}...    40   0.009
CAGL0A04455g Chr1 (437546..440842) [3297 bp, 1098 aa] {ON} simil...    42   0.010
YOR380W Chr15 (1051290..1052930) [1641 bp, 546 aa] {ON}  RDR1Tra...    42   0.010
Kwal_26.7095 s26 (211883..214399) [2517 bp, 838 aa] {ON} YOR363C...    42   0.010
NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa] {...    42   0.010
Kwal_23.3122 s23 complement(166388..168754) [2367 bp, 788 aa] {O...    42   0.010
CAGL0F09229g Chr6 complement(908186..910693) [2508 bp, 835 aa] {...    42   0.011
ZYRO0G19338g Chr7 complement(1601895..1603856) [1962 bp, 653 aa]...    42   0.011
TPHA0F00830 Chr6 complement(188299..191877) [3579 bp, 1192 aa] {...    42   0.011
YAL051W Chr1 (48564..51707) [3144 bp, 1047 aa] {ON}  OAF1Oleate-...    42   0.011
ZYRO0C00726g Chr3 (53977..57084) [3108 bp, 1035 aa] {ON} similar...    42   0.012
KNAG0A02300 Chr1 (214177..216363) [2187 bp, 729 aa] {ON}  gene e...    42   0.012
NDAI0G04140 Chr7 (994071..997076) [3006 bp, 1001 aa] {ON} Anc_3....    42   0.012
Suva_10.351 Chr10 (613486..614460) [975 bp, 324 aa] {ON} YLR256W...    42   0.012
YMR019W Chr13 (312156..315005) [2850 bp, 949 aa] {ON}  STB4Putat...    42   0.013
TBLA0G00510 Chr7 (104797..107604) [2808 bp, 935 aa] {ON} Anc_6.6...    42   0.013
Kwal_0.142 s0 complement(63621..65507) [1887 bp, 629 aa] {OFF} Y...    42   0.013
Smik_12.357 Chr12 complement(638342..642208) [3867 bp, 1288 aa] ...    42   0.014
Kwal_47.17681 s47 complement(513119..515683) [2565 bp, 854 aa] {...    42   0.014
YLR278C Chr12 complement(699999..704024) [4026 bp, 1341 aa] {ON}...    42   0.014
Skud_12.361 Chr12 complement(641047..645075) [4029 bp, 1342 aa] ...    42   0.014
NCAS0A07610 Chr1 complement(1512914..1515982) [3069 bp, 1022 aa]...    42   0.014
YDR213W Chr4 (889751..892492) [2742 bp, 913 aa] {ON}  UPC2Sterol...    42   0.014
CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa] ...    42   0.014
ZYRO0E05412g Chr5 (410945..414679) [3735 bp, 1244 aa] {ON} simil...    42   0.015
ADR403C Chr4 complement(1429115..1432027) [2913 bp, 970 aa] {ON}...    42   0.015
Suva_10.376 Chr10 complement(660780..664688) [3909 bp, 1302 aa] ...    42   0.015
TDEL0B06260 Chr2 (1104557..1108300) [3744 bp, 1247 aa] {ON} Anc_...    42   0.016
Skud_2.106 Chr2 (200722..203754) [3033 bp, 1010 aa] {ON} YBL005W...    42   0.016
Smik_4.460 Chr4 (833609..836365) [2757 bp, 918 aa] {ON} YDR213W ...    42   0.016
Smik_16.20 Chr16 complement(26236..27657) [1422 bp, 473 aa] {ON}...    41   0.016
TBLA0A05860 Chr1 (1449582..1452014) [2433 bp, 810 aa] {ON}             42   0.016
KLTH0E08778g Chr5 complement(795841..798462) [2622 bp, 873 aa] {...    42   0.017
YOL089C Chr15 complement(150398..153490) [3093 bp, 1030 aa] {ON}...    42   0.017
TDEL0B00480 Chr2 (83911..86418) [2508 bp, 835 aa] {ON} Anc_8.879...    42   0.017
TPHA0C04980 Chr3 (1072547..1075105) [2559 bp, 852 aa] {ON} Anc_8...    42   0.018
Skud_4.475 Chr4 (844018..846759) [2742 bp, 913 aa] {ON} YDR213W ...    42   0.018
ZYRO0G21626g Chr7 complement(1781790..1783031) [1242 bp, 413 aa]...    41   0.019
NCAS0C04780 Chr3 (974254..976998) [2745 bp, 914 aa] {ON}               42   0.019
Suva_2.381 Chr2 (669136..671892) [2757 bp, 918 aa] {ON} YDR213W ...    42   0.019
TPHA0F02540 Chr6 (556797..559178) [2382 bp, 793 aa] {ON} Anc_6.6...    42   0.019
Klac_YGOB_3960 Chr3 (291786..293297,293300..294220) [2433 bp, 81...    42   0.019
Ecym_5662 Chr5 complement(1338979..1341174) [2196 bp, 731 aa] {O...    42   0.019
CAGL0D02904g Chr4 complement(302952..305615) [2664 bp, 887 aa] {...    42   0.019
Ecym_5017 Chr5 (36647..39583) [2937 bp, 978 aa] {ON} similar to ...    42   0.019
KAFR0G02450 Chr7 (508147..511353) [3207 bp, 1068 aa] {ON} Anc_6....    42   0.020
TPHA0O00600 Chr15 complement(107944..112062) [4119 bp, 1372 aa] ...    42   0.020
Kpol_538.52 s538 (126243..128966) [2724 bp, 907 aa] {ON} (126243...    41   0.020
KAFR0A02130 Chr1 (447063..449186) [2124 bp, 707 aa] {ON} Anc_2.5...    41   0.020
Smik_12.289 Chr12 complement(540824..543262) [2439 bp, 812 aa] {...    41   0.021
Skud_12.296 Chr12 complement(540407..542851) [2445 bp, 814 aa] {...    41   0.021
Kpol_1049.19 s1049 (38439..41270) [2832 bp, 943 aa] {ON} (38439....    41   0.021
YLR228C Chr12 complement(600019..602463) [2445 bp, 814 aa] {ON} ...    41   0.021
KNAG0C05980 Chr3 complement(1164771..1167677) [2907 bp, 968 aa] ...    41   0.022
ZYRO0G10252g Chr7 (819658..822768) [3111 bp, 1036 aa] {ON} simil...    41   0.022
TDEL0H04340 Chr8 complement(746566..749535) [2970 bp, 989 aa] {O...    41   0.022
Kpol_260.2 s260 complement(3488..5758) [2271 bp, 756 aa] {ON} co...    41   0.023
ZYRO0A00440g Chr1 complement(27895..30447) [2553 bp, 850 aa] {ON...    41   0.023
CAGL0J07150g Chr10 complement(688858..691926) [3069 bp, 1022 aa]...    41   0.023
TDEL0D03610 Chr4 (664819..666993) [2175 bp, 724 aa] {ON} Anc_3.2...    41   0.024
AGL233C Chr7 complement(260414..263032) [2619 bp, 872 aa] {ON} N...    41   0.024
TDEL0A02690 Chr1 (485785..487953) [2169 bp, 722 aa] {ON}               41   0.025
KNAG0D03520 Chr4 complement(642517..645609) [3093 bp, 1030 aa] {...    41   0.025
TPHA0H01240 Chr8 (274496..277129) [2634 bp, 877 aa] {ON} Anc_5.5...    41   0.025
TBLA0G01100 Chr7 complement(279553..281454) [1902 bp, 633 aa] {O...    41   0.025
NCAS0D04860 Chr4 (933920..936025) [2106 bp, 701 aa] {ON}               41   0.026
NDAI0K01800 Chr11 (401055..404687) [3633 bp, 1210 aa] {ON} Anc_2...    41   0.026
KLTH0E00440g Chr5 complement(42945..45011) [2067 bp, 688 aa] {ON...    41   0.026
KLTH0B10076g Chr2 (841024..843090) [2067 bp, 688 aa] {ON} some s...    41   0.026
KLTH0F07854g Chr6 complement(677647..680013) [2367 bp, 788 aa] {...    41   0.026
KAFR0C03730 Chr3 (759382..761757) [2376 bp, 791 aa] {ON}               41   0.026
TBLA0E00700 Chr5 complement(138121..141945) [3825 bp, 1274 aa] {...    41   0.026
Kpol_1061.42 s1061 complement(116430..119819) [3390 bp, 1129 aa]...    41   0.026
Kpol_1061.26 s1061 (69833..73657) [3825 bp, 1274 aa] {ON} (69833...    41   0.026
Skud_13.173 Chr13 (298693..298722,298729..301461) [2763 bp, 920 ...    41   0.027
NDAI0K00150 Chr11 complement(20792..23653) [2862 bp, 953 aa] {ON...    41   0.028
Skud_15.532 Chr15 complement(959437..962439) [3003 bp, 1000 aa] ...    41   0.028
KNAG0J00210 Chr10 (26132..28717) [2586 bp, 861 aa] {ON} Anc_8.87...    41   0.028
SAKL0B01870g Chr2 (185897..188926) [3030 bp, 1009 aa] {ON} weakl...    41   0.028
Kwal_27.9688 s27 complement(21328..23853) [2526 bp, 841 aa] {ON}...    41   0.029
SAKL0H25146g Chr8 complement(2185695..2187632) [1938 bp, 645 aa]...    41   0.030
KAFR0H01800 Chr8 complement(333664..336048) [2385 bp, 794 aa] {O...    41   0.030
KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]...    41   0.031
KAFR0E01250 Chr5 complement(249538..251748) [2211 bp, 736 aa] {O...    41   0.031
YOR363C Chr15 complement(1020222..1023212) [2991 bp, 996 aa] {ON...    41   0.031
SAKL0H13024g Chr8 complement(1119585..1121849) [2265 bp, 754 aa]...    41   0.031
NDAI0A03410 Chr1 complement(778569..781511) [2943 bp, 980 aa] {O...    41   0.032
Suva_2.121 Chr2 (211466..214381) [2916 bp, 971 aa] {ON} YBL005W ...    41   0.032
Smik_16.15 Chr16 complement(14421..15812) [1392 bp, 463 aa] {ON}...    40   0.033
KAFR0A03060 Chr1 complement(626316..628898) [2583 bp, 860 aa] {O...    41   0.033
Kpol_1009.5 s1009 complement(10170..13706) [3537 bp, 1178 aa] {O...    41   0.034
TDEL0F02330 Chr6 complement(429974..433234) [3261 bp, 1086 aa] {...    41   0.034
NCAS0A12720 Chr1 (2510574..2512853) [2280 bp, 759 aa] {ON} Anc_2...    40   0.034
Suva_2.187 Chr2 complement(320833..323187) [2355 bp, 784 aa] {ON...    40   0.035
KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON}      40   0.037
KLTH0E05786g Chr5 (517896..520349) [2454 bp, 817 aa] {ON} weakly...    40   0.039
KNAG0M00970 Chr13 (169393..172926) [3534 bp, 1177 aa] {ON} Anc_6...    40   0.040
SAKL0D14542g Chr4 complement(1195951..1198791) [2841 bp, 946 aa]...    40   0.041
KLLA0A10329g Chr1 (903873..905792) [1920 bp, 639 aa] {ON} conser...    40   0.041
YBL005W Chr2 (217470..220400) [2931 bp, 976 aa] {ON}  PDR3Transc...    40   0.043
KLLA0D05038g Chr4 (433653..435674) [2022 bp, 673 aa] {ON} simila...    40   0.043
SAKL0G07634g Chr7 (636596..639364) [2769 bp, 922 aa] {ON} some s...    40   0.043
TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON} Anc_2....    40   0.045
Smik_15.67 Chr15 complement(113506..116598) [3093 bp, 1030 aa] {...    40   0.048
KAFR0D04590 Chr4 (900318..902840) [2523 bp, 840 aa] {ON} Anc_5.3...    40   0.049
KLTH0E16500g Chr5 (1460844..1463345) [2502 bp, 833 aa] {ON} simi...    40   0.050
Kpol_1002.5 s1002 (11943..14819) [2877 bp, 958 aa] {ON} (11943.....    40   0.050
TPHA0C02180 Chr3 complement(493972..496632) [2661 bp, 886 aa] {O...    40   0.050
Skud_3.181 Chr3 (293773..296268) [2496 bp, 831 aa] {ON} YCR106W ...    40   0.050
ZYRO0A03058g Chr1 (247954..250164) [2211 bp, 736 aa] {ON} simila...    40   0.051
KLTH0A03498g Chr1 complement(301696..303915) [2220 bp, 739 aa] {...    40   0.051
KLLA0C14212g Chr3 complement(1229219..1232341) [3123 bp, 1040 aa...    40   0.051
KLLA0C18953g Chr3 (1682246..1684357) [2112 bp, 703 aa] {ON} some...    40   0.051
CAGL0C01199g Chr3 complement(121944..124712) [2769 bp, 922 aa] {...    40   0.052
YBR150C Chr2 complement(541209..544493) [3285 bp, 1094 aa] {ON} ...    40   0.055
Smik_15.342 Chr15 complement(595611..595820,595851..598070) [243...    40   0.057
Smik_25.2 Chr25 (2105..4462) [2358 bp, 785 aa] {ON} YER184C (REAL)     40   0.057
Kpol_1042.6 s1042 (9848..11548,11550..11612,11615..12193) [2343 ...    40   0.058
Kpol_1031.47 s1031 (125242..127926) [2685 bp, 894 aa] {ON} (1252...    40   0.059
Kwal_47.17506 s47 (431921..434695) [2775 bp, 924 aa] {ON} YGL013...    40   0.060
CAGL0L04576g Chr12 (528957..531554) [2598 bp, 865 aa] {ON} simil...    40   0.061
NCAS0H00780 Chr8 complement(140472..143201) [2730 bp, 909 aa] {O...    40   0.061
Kwal_8.580 s8 (13266..15182) [1917 bp, 638 aa] {ON} [contig 311]...    40   0.061
TBLA0F01200 Chr6 (295744..299004) [3261 bp, 1086 aa] {ON} Anc_3....    40   0.062
TDEL0B06360 Chr2 complement(1127150..1130095) [2946 bp, 981 aa] ...    40   0.062
Kwal_47.18089 s47 complement(680481..682718) [2238 bp, 745 aa] {...    40   0.062
Suva_15.415 Chr15 (726296..728899) [2604 bp, 867 aa] {ON} YCR106...    40   0.063
KLTH0C07480g Chr3 (645219..647546) [2328 bp, 775 aa] {ON} simila...    40   0.063
TPHA0N01100 Chr14 (231308..232501) [1194 bp, 397 aa] {ON} Anc_6....    39   0.065
Skud_7.627 Chr7 (1048240..1049664) [1425 bp, 474 aa] {ON} YBR297...    39   0.066
NDAI0A05750 Chr1 complement(1302180..1304459) [2280 bp, 759 aa] ...    40   0.066
KLLA0D10197g Chr4 complement(861726..864296) [2571 bp, 856 aa] {...    40   0.068
TBLA0E03480 Chr5 (865043..868183) [3141 bp, 1046 aa] {ON} Anc_3....    40   0.068
Ecym_2345 Chr2 (676841..678754) [1914 bp, 637 aa] {ON} similar t...    40   0.071
ZYRO0E05676g Chr5 complement(439616..442816) [3201 bp, 1066 aa] ...    40   0.071
Kwal_23.6425 s23 (1574518..1576725) [2208 bp, 735 aa] {ON} YKL22...    40   0.073
Kpol_455.10 s455 (12074..14566) [2493 bp, 830 aa] {ON} (12074..1...    40   0.074
KLLA0A03421g Chr1 (308414..311056) [2643 bp, 880 aa] {ON} weakly...    40   0.075
KLLA0C17050g Chr3 (1490472..1493339) [2868 bp, 955 aa] {ON} cons...    40   0.075
Kwal_56.23058 s56 complement(381390..383717) [2328 bp, 775 aa] {...    39   0.076
KLLA0D10153g Chr4 (858016..859983) [1968 bp, 655 aa] {ON} some s...    39   0.076
Skud_2.39 Chr2 complement(80293..83772) [3480 bp, 1159 aa] {ON} ...    40   0.077
KLLA0D11286g Chr4 complement(964642..966678) [2037 bp, 678 aa] {...    39   0.077
Ecym_8404 Chr8 complement(834988..837645) [2658 bp, 885 aa] {ON}...    39   0.078
YBL066C Chr2 complement(96669..100115) [3447 bp, 1148 aa] {ON}  ...    40   0.078
Kpol_529.15 s529 complement(38664..41510) [2847 bp, 948 aa] {ON}...    39   0.080
Suva_2.51 Chr2 complement(93709..97176) [3468 bp, 1155 aa] {ON} ...    39   0.081
Ecym_7239 Chr7 (501580..504774) [3195 bp, 1064 aa] {ON} similar ...    39   0.082
CAGL0G09757g Chr7 (930351..934622) [4272 bp, 1423 aa] {ON} some ...    40   0.082
Smik_2.50 Chr2 complement(90559..94011) [3453 bp, 1150 aa] {ON} ...    39   0.083
YER184C Chr5 complement(556296..558680) [2385 bp, 794 aa] {ON} P...    39   0.084
NDAI0B01540 Chr2 complement(359639..362050) [2412 bp, 803 aa] {O...    39   0.084
TDEL0F05470 Chr6 (1017743..1020175) [2433 bp, 810 aa] {ON} Anc_8...    39   0.086
KAFR0G02540 Chr7 complement(524919..527486) [2568 bp, 855 aa] {O...    39   0.089
YDR034C Chr4 complement(509737..512109) [2373 bp, 790 aa] {ON}  ...    39   0.092
KNAG0A02290 Chr1 (211626..214028) [2403 bp, 800 aa] {ON}               39   0.092
Suva_13.49 Chr13 complement(75704..78352) [2649 bp, 882 aa] {ON}...    39   0.093
TBLA0C03390 Chr3 complement(814708..818028) [3321 bp, 1106 aa] {...    39   0.093
NCAS0A10550 Chr1 (2100725..2102950) [2226 bp, 741 aa] {ON} Anc_3...    39   0.094
Ecym_7235 Chr7 (489574..492405) [2832 bp, 943 aa] {ON} similar t...    39   0.096
CAGL0L04400g Chr12 complement(513759..516722) [2964 bp, 987 aa] ...    39   0.097
TDEL0G04090 Chr7 complement(744499..746730) [2232 bp, 743 aa] {O...    39   0.098
YPR196W Chr16 (931376..932788) [1413 bp, 470 aa] {ON} Putative m...    39   0.098
KLLA0E18129g Chr5 (1613115..1615712) [2598 bp, 865 aa] {ON} simi...    39   0.10 
Smik_2.115 Chr2 (210321..213236) [2916 bp, 971 aa] {ON} YBL005W ...    39   0.10 
KLLA0F02299g Chr6 (205549..208167) [2619 bp, 872 aa] {ON} conser...    39   0.10 
TPHA0K01100 Chr11 (228134..231619) [3486 bp, 1161 aa] {ON} Anc_6...    39   0.11 
Smik_3.209 Chr3 (306620..309118) [2499 bp, 832 aa] {ON} YCR106W ...    39   0.11 
ABL099W Chr2 (212830..215232) [2403 bp, 800 aa] {ON} Syntenic ho...    39   0.11 
Suva_8.421 Chr8 complement(757924..760932) [3009 bp, 1002 aa] {O...    39   0.11 
Ecym_4144 Chr4 complement(306206..308728) [2523 bp, 840 aa] {ON}...    39   0.11 
NDAI0B01680 Chr2 (398598..401372) [2775 bp, 924 aa] {ON} Anc_2.547     39   0.11 
KLTH0E03256g Chr5 complement(294997..297021) [2025 bp, 674 aa] {...    39   0.11 
KLLA0E19603g Chr5 complement(1739869..1741914) [2046 bp, 681 aa]...    39   0.12 
TPHA0N00440 Chr14 complement(82249..84522) [2274 bp, 757 aa] {ON...    39   0.12 
Skud_4.287 Chr4 complement(501344..503698) [2355 bp, 784 aa] {ON...    39   0.12 
NCAS0F00370 Chr6 complement(61819..65148) [3330 bp, 1109 aa] {ON...    39   0.12 
AFR171W Chr6 (752589..754427) [1839 bp, 612 aa] {ON} NOHBY629; N...    39   0.12 
KLLA0A03443g Chr1 (311628..314555) [2928 bp, 975 aa] {ON} simila...    39   0.12 
Skud_2.277 Chr2 complement(508677..511877) [3201 bp, 1066 aa] {O...    39   0.13 
KAFR0G02520 Chr7 complement(522206..524722) [2517 bp, 838 aa] {O...    39   0.13 
CAGL0H01507g Chr8 complement(147689..150073) [2385 bp, 794 aa] {...    39   0.13 
TBLA0D04050 Chr4 (1007986..1009809) [1824 bp, 607 aa] {ON} Anc_8...    39   0.13 
TDEL0G03970 Chr7 (720080..723187) [3108 bp, 1035 aa] {ON} Anc_6....    39   0.13 
YOR172W Chr15 (654210..656570) [2361 bp, 786 aa] {ON}  YRM1Zn2-C...    39   0.13 
ZYRO0A09350g Chr1 (749695..752076) [2382 bp, 793 aa] {ON} simila...    39   0.13 
KLLA0C04620g Chr3 complement(422705..426514) [3810 bp, 1269 aa] ...    39   0.13 
SAKL0H01958g Chr8 complement(193079..195055) [1977 bp, 658 aa] {...    39   0.14 
KAFR0G01360 Chr7 complement(305620..308121) [2502 bp, 833 aa] {O...    39   0.14 
Kwal_23.4370 s23 complement(689686..691764) [2079 bp, 692 aa] {O...    39   0.14 
Skud_15.326 Chr15 complement(588275..590731) [2457 bp, 818 aa] {...    39   0.14 
Ecym_4286 Chr4 (613587..615470) [1884 bp, 627 aa] {ON} similar t...    39   0.14 
Smik_15.350 Chr15 (610312..612666) [2355 bp, 784 aa] {ON} YOR172...    39   0.14 
Smik_15.547 Chr15 complement(966368..969355) [2988 bp, 995 aa] {...    39   0.15 
KLTH0B08580g Chr2 (697066..698970) [1905 bp, 634 aa] {ON} simila...    39   0.15 
Suva_10.18 Chr10 complement(36048..38576) [2529 bp, 842 aa] {ON}...    39   0.15 
NCAS0E02620 Chr5 complement(523279..526626) [3348 bp, 1115 aa] {...    39   0.16 
KLTH0E07854g Chr5 (719642..722458) [2817 bp, 938 aa] {ON} weakly...    39   0.16 
Kwal_55.20722 s55 (530982..533465) [2484 bp, 827 aa] {ON} YCR106...    39   0.16 
TPHA0G00380 Chr7 complement(65673..68294) [2622 bp, 873 aa] {ON}       39   0.16 
Kpol_1061.11 s1061 complement(31679..33880) [2202 bp, 733 aa] {O...    39   0.17 
YOR162C Chr15 complement(639560..641992) [2433 bp, 810 aa] {ON} ...    39   0.17 
CAGL0H06875g Chr8 complement(682518..684626) [2109 bp, 702 aa] {...    38   0.17 
SAKL0D03586g Chr4 (290224..292629) [2406 bp, 801 aa] {ON} simila...    39   0.17 
TPHA0F02550 Chr6 (559614..562013) [2400 bp, 799 aa] {ON} Anc_6.6...    39   0.17 
KNAG0M02120 Chr13 (395195..397021) [1827 bp, 608 aa] {ON} Anc_2....    38   0.18 
Smik_26.8 Chr26 (8892..9242) [351 bp, 117 aa] {ON} YER184C (REAL)      36   0.18 
Suva_10.364 Chr10 complement(637047..639170) [2124 bp, 707 aa] {...    38   0.18 
SAKL0G19470g Chr7 complement(1677759..1680254) [2496 bp, 831 aa]...    38   0.18 
KAFR0C03660 Chr3 complement(745068..747611) [2544 bp, 847 aa] {O...    38   0.18 
TPHA0F02630 Chr6 complement(583511..587299) [3789 bp, 1262 aa] {...    38   0.19 
CAGL0E05434g Chr5 (532814..535264) [2451 bp, 816 aa] {ON} simila...    38   0.19 
YLR266C Chr12 complement(675619..677724) [2106 bp, 701 aa] {ON} ...    38   0.19 
KNAG0K00820 Chr11 complement(153470..156622) [3153 bp, 1050 aa] ...    38   0.19 
Smik_4.269 Chr4 complement(491110..493446) [2337 bp, 778 aa] {ON...    38   0.20 
TBLA0A04280 Chr1 complement(1059254..1061932) [2679 bp, 892 aa] ...    38   0.20 
Smik_2.290 Chr2 complement(527416..530511) [3096 bp, 1031 aa] {O...    38   0.21 
Kwal_23.6529 s23 (1627853..1629649) [1797 bp, 598 aa] {ON} YDR03...    38   0.21 
TDEL0G04100 Chr7 complement(746975..749074) [2100 bp, 699 aa] {O...    38   0.21 
CAGL0K11902g Chr11 complement(1149210..1151705) [2496 bp, 831 aa...    38   0.21 
NDAI0I01940 Chr9 (450330..454112) [3783 bp, 1260 aa] {ON} Anc_6.75     38   0.21 
KAFR0A04940 Chr1 (975356..978913) [3558 bp, 1185 aa] {ON} Anc_6....    38   0.23 
KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly...    38   0.23 
TDEL0D00260 Chr4 complement(44685..46628) [1944 bp, 647 aa] {ON}       38   0.23 
TPHA0E00880 Chr5 complement(177030..180164) [3135 bp, 1044 aa] {...    38   0.23 
Suva_4.499 Chr4 complement(871565..872917) [1353 bp, 450 aa] {ON...    38   0.23 
ADR404C Chr4 complement(1432320..1434947) [2628 bp, 875 aa] {ON}...    38   0.23 
Suva_8.216 Chr8 complement(389549..391894) [2346 bp, 781 aa] {ON...    38   0.24 
KLTH0C10098g Chr3 complement(836528..838843) [2316 bp, 771 aa] {...    38   0.24 
Skud_12.346 Chr12 complement(616734..618818) [2085 bp, 694 aa] {...    38   0.24 
ZYRO0B02574g Chr2 complement(204817..206541) [1725 bp, 574 aa] {...    38   0.24 
ZYRO0D14058g Chr4 (1188615..1190891) [2277 bp, 758 aa] {ON} simi...    38   0.25 
Skud_15.334 Chr15 (602966..605338) [2373 bp, 790 aa] {ON} YOR172...    38   0.25 
Skud_7.646 Chr7 (1073386..1074795) [1410 bp, 469 aa] {ON} YPR196...    38   0.25 
KLTH0C00880g Chr3 complement(85841..89098) [3258 bp, 1085 aa] {O...    38   0.25 
Kwal_26.6805 s26 (71596..74430) [2835 bp, 944 aa] {ON} YAL051W (...    38   0.25 
KLTH0C10516g Chr3 (871091..872776) [1686 bp, 561 aa] {ON} simila...    38   0.26 
KLLA0F10373g Chr6 (957948..958994) [1047 bp, 348 aa] {ON} some s...    37   0.27 
NDAI0D02730 Chr4 (629970..633647) [3678 bp, 1225 aa] {ON} Anc_6....    38   0.27 
TBLA0B07920 Chr2 complement(1877300..1879603) [2304 bp, 767 aa] ...    38   0.27 
SAKL0H00660g Chr8 complement(78740..81478) [2739 bp, 912 aa] {ON...    38   0.28 
ACL096W Chr3 (169508..172015) [2508 bp, 835 aa] {ON} Syntenic ho...    38   0.28 
TBLA0G00520 Chr7 (108060..110696) [2637 bp, 878 aa] {ON} Anc_6.6...    38   0.28 
Skud_2.372 Chr2 complement(669194..670552) [1359 bp, 452 aa] {ON...    37   0.28 
NCAS0F00310 Chr6 (49514..52084) [2571 bp, 856 aa] {ON}                 38   0.28 
KAFR0A06690 Chr1 complement(1354262..1357255) [2994 bp, 997 aa] ...    38   0.29 
AGL099C Chr7 complement(516587..518830) [2244 bp, 747 aa] {ON} S...    37   0.30 
ZYRO0E00572g Chr5 (35940..38456) [2517 bp, 838 aa] {ON} similar ...    37   0.30 
TPHA0M01040 Chr13 complement(202491..204803) [2313 bp, 770 aa] {...    37   0.30 
KAFR0C01320 Chr3 (273213..276233) [3021 bp, 1006 aa] {ON} Anc_3....    37   0.31 
KLTH0C00814g Chr3 (76637..79141) [2505 bp, 834 aa] {ON} similar ...    37   0.31 
ZYRO0D14080g Chr4 (1191418..1194183) [2766 bp, 921 aa] {ON} weak...    37   0.31 
Ecym_6141 Chr6 complement(258221..258565) [345 bp, 114 aa] {ON} ...    35   0.31 
AAL175W Chr1 (32874..35525) [2652 bp, 883 aa] {ON} Non-syntenic ...    37   0.32 
Skud_7.2 Chr7 (5094..6749) [1656 bp, 551 aa] {ON} YLR098C (REAL)       37   0.32 
Kwal_47.17233 s47 (309658..312504) [2847 bp, 948 aa] {ON} [conti...    37   0.32 
YBR240C Chr2 complement(700490..701842) [1353 bp, 450 aa] {ON}  ...    37   0.33 
AGL091W Chr7 (535317..537917) [2601 bp, 866 aa] {ON} Syntenic ho...    37   0.34 
SAKL0F11616g Chr6 complement(901066..902841) [1776 bp, 591 aa] {...    37   0.34 
Suva_8.225 Chr8 (404288..406693) [2406 bp, 801 aa] {ON} YOR172W ...    37   0.36 
Kwal_56.24670 s56 complement(1099601..1101532) [1932 bp, 643 aa]...    37   0.36 
TBLA0A07010 Chr1 (1713923..1716046) [2124 bp, 707 aa] {ON}             37   0.37 
ZYRO0D14432g Chr4 complement(1222977..1226489) [3513 bp, 1170 aa...    37   0.37 
KLTH0E06666g Chr5 (611348..614188) [2841 bp, 946 aa] {ON} conser...    37   0.38 
Smik_2.383 Chr2 complement(686676..688022) [1347 bp, 448 aa] {ON...    37   0.39 
CAGL0F02519g Chr6 (245120..247618) [2499 bp, 832 aa] {ON} weakly...    37   0.39 
CAGL0L09383g Chr12 (1020856..1021956) [1101 bp, 366 aa] {ON} som...    37   0.39 
Ecym_2672 Chr2 (1294580..1296799) [2220 bp, 739 aa] {ON} similar...    37   0.39 
KLTH0F03300g Chr6 complement(283918..285474) [1557 bp, 518 aa] {...    37   0.41 
Kwal_56.23308 s56 complement(485779..487092) [1314 bp, 438 aa] {...    37   0.41 
Ecym_8159 Chr8 (330207..332933) [2727 bp, 908 aa] {ON} similar t...    37   0.41 
TDEL0C01880 Chr3 (332932..334554) [1623 bp, 540 aa] {ON} Anc_7.3...    37   0.42 
KLLA0F04213g Chr6 (400673..402979) [2307 bp, 768 aa] {ON} simila...    37   0.42 
ACL195C Chr3 complement(19204..19533) [330 bp, 109 aa] {ON} NOHB...    34   0.43 
TDEL0B07490 Chr2 complement(1314447..1317044) [2598 bp, 865 aa] ...    37   0.43 
ADR199C Chr4 complement(1048528..1051362) [2835 bp, 944 aa] {ON}...    37   0.45 
NCAS0A03570 Chr1 complement(708718..711654) [2937 bp, 978 aa] {O...    37   0.46 
Ecym_5015 Chr5 (29616..32099) [2484 bp, 827 aa] {ON} similar to ...    37   0.47 
KLLA0E02663g Chr5 (244696..248025) [3330 bp, 1109 aa] {ON} conse...    37   0.47 
SAKL0B10538g Chr2 (910662..912767) [2106 bp, 701 aa] {ON} simila...    37   0.47 
NCAS0D02960 Chr4 complement(563406..566924) [3519 bp, 1172 aa] {...    37   0.49 
TBLA0A05850 Chr1 complement(1446872..1448845) [1974 bp, 657 aa] ...    37   0.50 
TPHA0E01290 Chr5 (258004..260562) [2559 bp, 852 aa] {ON} Anc_5.3...    37   0.50 
Ecym_3392 Chr3 (741359..743902) [2544 bp, 847 aa] {ON} similar t...    37   0.51 
Kwal_23.6537 s23 complement(1632048..1633706) [1659 bp, 552 aa] ...    37   0.52 
NDAI0K02840 Chr11 (640461..643634) [3174 bp, 1057 aa] {ON} Anc_6...    37   0.52 
YKL222C Chr11 complement(3503..5620) [2118 bp, 705 aa] {ON} Prot...    37   0.53 
KAFR0C03230 Chr3 complement(655300..656520) [1221 bp, 406 aa] {O...    37   0.53 
ZYRO0G00374g Chr7 complement(28649..30553) [1905 bp, 634 aa] {ON...    37   0.55 
KNAG0E00450 Chr5 complement(74721..76853) [2133 bp, 710 aa] {ON}...    37   0.59 
Skud_20.3 Chr20 (4504..5916) [1413 bp, 470 aa] {ON} YBR297W (REAL)     36   0.60 
Skud_16.500 Chr16 (874371..876485) [2115 bp, 704 aa] {ON} YKL222...    37   0.61 
TBLA0E01900 Chr5 (462299..464821) [2523 bp, 840 aa] {ON} Anc_7.5...    37   0.62 
SAKL0G14256g Chr7 (1230063..1232306) [2244 bp, 747 aa] {ON} cons...    37   0.63 
Kwal_55.20674 s55 complement(515392..516147) [756 bp, 252 aa] {O...    36   0.63 
SAKL0D02596g Chr4 (204347..206599) [2253 bp, 750 aa] {ON} conser...    37   0.63 
KLTH0A00484g Chr1 (42443..44149) [1707 bp, 568 aa] {ON} conserve...    36   0.65 
KLTH0E00176g Chr5 (8605..10311) [1707 bp, 568 aa] {ON} conserved...    36   0.65 
TDEL0E00300 Chr5 (64461..66374) [1914 bp, 637 aa] {ON}                 36   0.65 
KLTH0F03014g Chr6 (260568..262406) [1839 bp, 612 aa] {ON} simila...    36   0.66 
ZYRO0D06688g Chr4 (577455..577507,577577..579311) [1788 bp, 595 ...    36   0.66 
TBLA0F02920 Chr6 (700340..703111) [2772 bp, 923 aa] {ON} Anc_7.5...    37   0.67 
ADR405C Chr4 complement(1435702..1438125) [2424 bp, 807 aa] {ON}...    36   0.69 
TBLA0B07050 Chr2 (1669768..1671996) [2229 bp, 742 aa] {ON}             36   0.69 
SAKL0G02992g Chr7 (243859..247044) [3186 bp, 1061 aa] {ON} conse...    36   0.71 
SAKL0B12518g Chr2 (1072142..1073932) [1791 bp, 596 aa] {ON} cons...    36   0.72 
Kwal_14.915 s14 (110216..112684) [2469 bp, 822 aa] {ON} YKL015W ...    36   0.74 
KLTH0D07898g Chr4 (672516..674534) [2019 bp, 672 aa] {ON} weakly...    36   0.74 
KLTH0D01804g Chr4 complement(173650..175608) [1959 bp, 652 aa] {...    36   0.80 
SAKL0A08074g Chr1 (711985..715425) [3441 bp, 1146 aa] {ON} simil...    36   0.82 
AER291C Chr5 complement(1172383..1174374) [1992 bp, 663 aa] {ON}...    36   0.83 
KLTH0H00968g Chr8 (103482..105353) [1872 bp, 623 aa] {ON} simila...    36   0.84 
Smik_18.3 Chr18 complement(3105..5219) [2115 bp, 704 aa] {ON} YK...    36   0.84 
ZYRO0C18282g Chr3 (1431515..1433665) [2151 bp, 716 aa] {ON} cons...    36   0.86 
CAGL0M11440g Chr13 complement(1127298..1129025) [1728 bp, 575 aa...    36   0.88 
KNAG0J02130 Chr10 complement(388821..390713) [1893 bp, 630 aa] {...    36   0.96 
TDEL0G04920 Chr7 complement(912754..914844) [2091 bp, 696 aa] {O...    36   0.98 
NCAS0D02720 Chr4 complement(520916..523189) [2274 bp, 757 aa] {O...    36   1.1  
KNAG0H00250 Chr8 (37360..40050) [2691 bp, 896 aa] {ON} Anc_2.654...    36   1.1  
YBR033W Chr2 (301944..304703) [2760 bp, 919 aa] {ON}  EDS1Putati...    36   1.1  
NCAS0E02310 Chr5 (452368..454524) [2157 bp, 718 aa] {ON} Anc_7.56      35   1.1  
Suva_15.425 Chr15 (750153..752087) [1935 bp, 644 aa] {ON} YLR098...    35   1.1  
TBLA0H03910 Chr8 complement(943931..946234) [2304 bp, 767 aa] {O...    35   1.2  
NDAI0F02050 Chr6 complement(503400..504740) [1341 bp, 446 aa] {O...    35   1.2  
Kpol_534.29 s534 (66570..67142,67144..67155,67158..68246) [1674 ...    35   1.2  
KLTH0C10032g Chr3 complement(830334..832934) [2601 bp, 866 aa] {...    35   1.2  
Suva_15.3 Chr15 complement(4971..6152) [1182 bp, 393 aa] {ON} YK...    35   1.2  
TDEL0D06620 Chr4 (1197405..1199084) [1680 bp, 559 aa] {ON}             35   1.3  
KAFR0C03900 Chr3 (787524..789980) [2457 bp, 818 aa] {ON} Anc_2.6...    35   1.3  
Skud_6.15 Chr6 complement(24031..25701) [1671 bp, 556 aa] {ON} Y...    35   1.3  
Kpol_1042.7 s1042 (12882..15233) [2352 bp, 783 aa] {ON} (12882.....    35   1.5  
Kwal_56.22605 s56 (200072..202669) [2598 bp, 865 aa] {ON} YOL089...    35   1.5  
Ecym_5183 Chr5 complement(385669..388101) [2433 bp, 810 aa] {ON}...    35   1.6  
Ecym_4153 Chr4 complement(330831..333281) [2451 bp, 816 aa] {ON}...    35   1.6  
ZYRO0D04422g Chr4 (366583..368877) [2295 bp, 764 aa] {ON} simila...    35   1.6  
Smik_23.3 Chr23 complement(4675..6111) [1437 bp, 478 aa] {ON} YB...    35   1.7  
Skud_14.399 Chr14 (715444..717267) [1824 bp, 607 aa] {ON} YNR063...    35   1.7  
NDAI0C03450 Chr3 (789514..791844) [2331 bp, 776 aa] {ON} Anc_5.59      35   2.0  
Ecym_2263 Chr2 (518089..519615) [1527 bp, 508 aa] {ON} similar t...    35   2.0  
SAKL0C00242g Chr3 (14453..16954) [2502 bp, 833 aa] {ON} weakly s...    35   2.0  
SAKL0C03960g Chr3 (380387..383488) [3102 bp, 1033 aa] {ON} conse...    35   2.0  
Smik_12.341 Chr12 complement(613817..615922) [2106 bp, 701 aa] {...    35   2.0  
Kwal_14.819 s14 complement(63184..64890) [1707 bp, 568 aa] {ON} ...    35   2.0  
NCAS0H01240 Chr8 (235885..237312) [1428 bp, 475 aa] {ON} Anc_6.154     35   2.0  
KLTH0A06644g Chr1 complement(553084..555270) [2187 bp, 728 aa] {...    35   2.0  
TBLA0E01110 Chr5 (243534..246755) [3222 bp, 1073 aa] {ON} Anc_6....    35   2.2  
YFL052W Chr6 (28232..29629) [1398 bp, 465 aa] {ON} Putative zinc...    34   2.3  
Kpol_2001.16 s2001 (44110..46518) [2409 bp, 802 aa] {ON} (44110....    35   2.4  
Smik_6.23 Chr6 complement(37285..38955) [1671 bp, 556 aa] {ON} Y...    34   2.7  
TDEL0C05790 Chr3 (1045249..1047057) [1809 bp, 602 aa] {ON}             34   2.8  
Skud_6.7 Chr6 (12394..13791) [1398 bp, 465 aa] {ON} YPR196W (REAL)     34   2.9  
Suva_5.324 Chr5 (529581..530993) [1413 bp, 470 aa] {ON} YFL052W ...    34   3.0  
ADR365W Chr4 (1355407..1357512) [2106 bp, 701 aa] {ON} Syntenic ...    34   3.0  
Kwal_YGOB_gneas1 s33 complement(285483..287042) [1560 bp, 519 aa...    34   3.2  
ZYRO0C11880g Chr3 (929030..930943) [1914 bp, 637 aa] {ON} simila...    34   3.2  
Sklu_YGOB_gneas1 Chr3 complement(352893..354335) [1443 bp, 480 a...    34   3.3  
KLTH0B09262g Chr2 (758773..761235) [2463 bp, 820 aa] {ON} weakly...    34   3.3  
Suva_10.10 Chr10 complement(16722..18389) [1668 bp, 555 aa] {ON}...    34   3.5  
SAKL0C05918g Chr3 complement(558911..561538) [2628 bp, 875 aa] {...    34   3.6  
SAKL0F16588g Chr6 complement(1369763..1371610) [1848 bp, 615 aa]...    34   3.8  
CAGL0L09691g Chr12 complement(1041796..1044270) [2475 bp, 824 aa...    34   3.8  
AGL083W Chr7 (550291..552861) [2571 bp, 856 aa] {ON} Syntenic ho...    34   3.9  
KLTH0H05720g Chr8 (505672..507006) [1335 bp, 444 aa] {ON} simila...    33   4.1  
Smik_6.15 Chr6 (22860..24260) [1401 bp, 466 aa] {ON} YFL052W (REAL)    33   4.5  
NCAS0C04280 Chr3 complement(882224..883384) [1161 bp, 386 aa] {O...    33   4.7  
SAKL0B01562g Chr2 complement(151883..153451) [1569 bp, 522 aa] {...    33   4.7  
Suva_2.718 Chr2 complement(1260979..1262673) [1695 bp, 564 aa] {...    33   4.8  
TPHA0C04280 Chr3 complement(922743..926132) [3390 bp, 1129 aa] {...    33   5.0  
NDAI0H03200 Chr8 complement(764260..766344) [2085 bp, 694 aa] {O...    33   5.5  
Kwal_14.1631 s14 (397794..399125) [1332 bp, 443 aa] {ON} YBR240C...    33   6.2  
KLLA0A03091g Chr1 (276333..277484) [1152 bp, 383 aa] {ON} some s...    33   6.3  
ACL093C Chr3 complement(178239..181271) [3033 bp, 1010 aa] {ON} ...    33   6.5  
NCAS0B05110 Chr2 complement(951685..953485,953561..953643) [1884...    33   6.8  
KNAG0H03350 Chr8 complement(625161..628031) [2871 bp, 956 aa] {O...    33   7.8  

>KLLA0D01452g Chr4 (124018..128355) [4338 bp, 1445 aa] {ON} similar to
            uniprot|Q75DZ4 Ashbya gossypii ABL121C ABL121Cp and
            similar to YMR280C uniprot|P39113 Saccharomyces
            cerevisiae YMR280C CAT8 Zinc cluster transcriptional
            activator
          Length = 1445

 Score = 2456 bits (6366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1221/1445 (84%), Positives = 1221/1445 (84%)

Query: 1    MVEKKDSAGRFNGQPSHGGPRFIRTLGSQSLSGLNPLXXXXXXXXXXXXXXXXXXXNVTD 60
            MVEKKDSAGRFNGQPSHGGPRFIRTLGSQSLSGLNPL                   NVTD
Sbjct: 1    MVEKKDSAGRFNGQPSHGGPRFIRTLGSQSLSGLNPLSNAQQGVSQQQQHLSHHSHNVTD 60

Query: 61   SDSPSIQDSGIPITSALIKKESPSHAVSGIPXXXXXXXXXXXXXXXXXXXXXXXXXXXTS 120
            SDSPSIQDSGIPITSALIKKESPSHAVSGIP                           TS
Sbjct: 61   SDSPSIQDSGIPITSALIKKESPSHAVSGIPSNSNSINNNSKSNSNNNPSSVFSSRNNTS 120

Query: 121  IQQLQQGPSPTLSNSESPVNASLLSSITTPLLHQTGSASHXXXXXXXXXXXXXXXXYRVA 180
            IQQLQQGPSPTLSNSESPVNASLLSSITTPLLHQTGSASH                YRVA
Sbjct: 121  IQQLQQGPSPTLSNSESPVNASLLSSITTPLLHQTGSASHPPSNTGSSTNGTTTPSYRVA 180

Query: 181  QACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGYXXXXXXXXXXXXXXX 240
            QACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY               
Sbjct: 181  QACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGYTETLEERVRELEAEN 240

Query: 241  XXXXXXCDLKEEQLHLVSKYSNSKDENGVEIPSTEEEQILHELSKTNGGSLRVSSTNLYL 300
                  CDLKEEQLHLVSKYSNSKDENGVEIPSTEEEQILHELSKTNGGSLRVSSTNLYL
Sbjct: 241  RRLVALCDLKEEQLHLVSKYSNSKDENGVEIPSTEEEQILHELSKTNGGSLRVSSTNLYL 300

Query: 301  LNKKASPGDDSHIESSEPSIPVRKVAITAPSPRIMSPRNSVADSDPSQTXXXXXXXXXXX 360
            LNKKASPGDDSHIESSEPSIPVRKVAITAPSPRIMSPRNSVADSDPSQT           
Sbjct: 301  LNKKASPGDDSHIESSEPSIPVRKVAITAPSPRIMSPRNSVADSDPSQTNTGNNDHIHSN 360

Query: 361  XXXXXXXXSTDPYGISFEQNEAPGLPXXXXXXXXXXYKQGTQLATLVAVSVPRTTEEILF 420
                    STDPYGISFEQNEAPGLP          YKQGTQLATLVAVSVPRTTEEILF
Sbjct: 361  NNNHNQNNSTDPYGISFEQNEAPGLPALKALSSLSKYKQGTQLATLVAVSVPRTTEEILF 420

Query: 421  VPQLLARIGQIHGFTSKQCIYTASVLASLKENNISSIPPELEVLKNHNLWEIDDVLHFWK 480
            VPQLLARIGQIHGFTSKQCIYTASVLASLKENNISSIPPELEVLKNHNLWEIDDVLHFWK
Sbjct: 421  VPQLLARIGQIHGFTSKQCIYTASVLASLKENNISSIPPELEVLKNHNLWEIDDVLHFWK 480

Query: 481  NVFKLDFMTHTAVDHSSTHLNFAEVEELMQLFFQDWYELIPLFDKNEFNSYYEKFKLNVT 540
            NVFKLDFMTHTAVDHSSTHLNFAEVEELMQLFFQDWYELIPLFDKNEFNSYYEKFKLNVT
Sbjct: 481  NVFKLDFMTHTAVDHSSTHLNFAEVEELMQLFFQDWYELIPLFDKNEFNSYYEKFKLNVT 540

Query: 541  DPNFFVRKDDTVFNNRTRSISYKIFSCLLIIIVQMGMLSKIKRDKITSGKLSTLMKYYDK 600
            DPNFFVRKDDTVFNNRTRSISYKIFSCLLIIIVQMGMLSKIKRDKITSGKLSTLMKYYDK
Sbjct: 541  DPNFFVRKDDTVFNNRTRSISYKIFSCLLIIIVQMGMLSKIKRDKITSGKLSTLMKYYDK 600

Query: 601  LMTHIWINPYFNSRNTSIQVLQCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLRLHRCP 660
            LMTHIWINPYFNSRNTSIQVLQCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLRLHRCP
Sbjct: 601  LMTHIWINPYFNSRNTSIQVLQCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLRLHRCP 660

Query: 661  SAVLGGDGSTVSKVQQGERRILFWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDDDR 720
            SAVLGGDGSTVSKVQQGERRILFWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDDDR
Sbjct: 661  SAVLGGDGSTVSKVQQGERRILFWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDDDR 720

Query: 721  QVNLAGQMIALEGKVSQFSLSVIRFAKVMGNILDSTFKRGMTTSLTKQAALVHENALDNW 780
            QVNLAGQMIALEGKVSQFSLSVIRFAKVMGNILDSTFKRGMTTSLTKQAALVHENALDNW
Sbjct: 721  QVNLAGQMIALEGKVSQFSLSVIRFAKVMGNILDSTFKRGMTTSLTKQAALVHENALDNW 780

Query: 781  RHGLQKDLFFQLDVNGTINMDEFNQQKQYSKSLSPRTAAFTHNSLVLMTLYFMAKCMIHL 840
            RHGLQKDLFFQLDVNGTINMDEFNQQKQYSKSLSPRTAAFTHNSLVLMTLYFMAKCMIHL
Sbjct: 781  RHGLQKDLFFQLDVNGTINMDEFNQQKQYSKSLSPRTAAFTHNSLVLMTLYFMAKCMIHL 840

Query: 841  PVVATKPLVAEAIQTPTDNQTENGSVDRSLSSYXXXXXXXXXXXXXXXXXXSIYLPLPIN 900
            PVVATKPLVAEAIQTPTDNQTENGSVDRSLSSY                  SIYLPLPIN
Sbjct: 841  PVVATKPLVAEAIQTPTDNQTENGSVDRSLSSYVLLQQATNTLLNVLTALNSIYLPLPIN 900

Query: 901  LARTKTRFGLFSARGSLEYTKGGALFQDNKALLLDLVKELETDKKLELPGNTSWHSLKLF 960
            LARTKTRFGLFSARGSLEYTKGGALFQDNKALLLDLVKELETDKKLELPGNTSWHSLKLF
Sbjct: 901  LARTKTRFGLFSARGSLEYTKGGALFQDNKALLLDLVKELETDKKLELPGNTSWHSLKLF 960

Query: 961  DLSINLILQPVNSNPEKTEKMIQKKINYYNKLMGQPTVAVKRKRDPKATENTSKKVKVED 1020
            DLSINLILQPVNSNPEKTEKMIQKKINYYNKLMGQPTVAVKRKRDPKATENTSKKVKVED
Sbjct: 961  DLSINLILQPVNSNPEKTEKMIQKKINYYNKLMGQPTVAVKRKRDPKATENTSKKVKVED 1020

Query: 1021 DHSQDNLHNITTGETTDTVHSEELVKDVPKELNVYPENYTTIEEAFQMDPVLNTNLFSNT 1080
            DHSQDNLHNITTGETTDTVHSEELVKDVPKELNVYPENYTTIEEAFQMDPVLNTNLFSNT
Sbjct: 1021 DHSQDNLHNITTGETTDTVHSEELVKDVPKELNVYPENYTTIEEAFQMDPVLNTNLFSNT 1080

Query: 1081 DLKTLFNSGIFENAGSIHXXXXXXXXXXXXXXXXXXXXGSSRNIHNLGAGIEDIDHGMXX 1140
            DLKTLFNSGIFENAGSIH                    GSSRNIHNLGAGIEDIDHGM  
Sbjct: 1081 DLKTLFNSGIFENAGSIHNNINDNNNNNNNTNNTNNNNGSSRNIHNLGAGIEDIDHGMSL 1140

Query: 1141 XXXXXXXXXXXXXXXXXXXXAEGMKDGXXXXXXXXXXXXXXXFKVPSNGDFLKDYYINNM 1200
                                AEGMKDG               FKVPSNGDFLKDYYINNM
Sbjct: 1141 RSNDASLLNLSNALGNHGNSAEGMKDGTSVSNLLNLSTSDSLFKVPSNGDFLKDYYINNM 1200

Query: 1201 SNTGLSNLHTSSVNKGPSLSQLGSLFMSSGSGTNLPYSNVRGESKHPSGVNLNKQRAQPA 1260
            SNTGLSNLHTSSVNKGPSLSQLGSLFMSSGSGTNLPYSNVRGESKHPSGVNLNKQRAQPA
Sbjct: 1201 SNTGLSNLHTSSVNKGPSLSQLGSLFMSSGSGTNLPYSNVRGESKHPSGVNLNKQRAQPA 1260

Query: 1261 MDGFSFAADASLGLAPLLAWSPDAKPQLNSNNGNDGLNPATGIVLESGDNDSTNASVVXX 1320
            MDGFSFAADASLGLAPLLAWSPDAKPQLNSNNGNDGLNPATGIVLESGDNDSTNASVV  
Sbjct: 1261 MDGFSFAADASLGLAPLLAWSPDAKPQLNSNNGNDGLNPATGIVLESGDNDSTNASVVQL 1320

Query: 1321 XXXXXXXXXXXXXXXXXIPMGKQSSTSDRQNSHHQDNVGSFHSMHSPTIPEQTSAQGLHQ 1380
                             IPMGKQSSTSDRQNSHHQDNVGSFHSMHSPTIPEQTSAQGLHQ
Sbjct: 1321 QQHQQQTHHPPSHNSSSIPMGKQSSTSDRQNSHHQDNVGSFHSMHSPTIPEQTSAQGLHQ 1380

Query: 1381 HQMLGMPNSTLNSDTNTGGANVTNSISSTNRRGPRRRWXXXXXXXXXXXXXXXXXXDLLR 1440
            HQMLGMPNSTLNSDTNTGGANVTNSISSTNRRGPRRRW                  DLLR
Sbjct: 1381 HQMLGMPNSTLNSDTNTGGANVTNSISSTNRRGPRRRWNNAASSSDPNSAGDSSVSDLLR 1440

Query: 1441 WQNGN 1445
            WQNGN
Sbjct: 1441 WQNGN 1445

>SAKL0D01342g Chr4 (101095..104907) [3813 bp, 1270 aa] {ON} similar to
            uniprot|Q75DZ4 Ashbya gossypii ABL121C ABL121Cp and
            similar to YMR280C uniprot|P39113 Saccharomyces
            cerevisiae YMR280C CAT8 Zinc cluster transcriptional
            activator
          Length = 1270

 Score = 1003 bits (2592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 532/948 (56%), Positives = 632/948 (66%), Gaps = 85/948 (8%)

Query: 177  YRVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGYXXXXXXXXXXX 236
            YRVAQACDRCR+KK RCDGKRPQC+QCAAVGFECKISDKLSRRAFPRGY           
Sbjct: 85   YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGYTETLEERVREL 144

Query: 237  XXXXXXXXXXCDLKEEQLHLVSKYSNSKDENGVEIPSTEEEQILHELSKTNGGSLRVSST 296
                      CDLKEEQLHLVSKYSN +     EI   E+EQIL +LS  NGGSLRVSST
Sbjct: 145  EAENRRLVALCDLKEEQLHLVSKYSNKRTS---EISENEDEQILQQLSAANGGSLRVSST 201

Query: 297  NLYLLNKKASPGDDSHIE---SSEPSIPVRKVAIT-APSPRIMSPRNSVADSDPSQTXXX 352
            NLYLLN K +PGD    E   SS+ ++    V    +  P I           P  T   
Sbjct: 202  NLYLLN-KTTPGDQQDEEDQMSSKTTVDCNGVGCNHSHQPNI--------HDKPVSTNL- 251

Query: 353  XXXXXXXXXXXXXXXXSTDPYGISFEQNEAPGLPXXXXXXXXXXYKQGTQLATLVAVSVP 412
                              DP  ISFEQNEAPGLP          ++   QLATLVA+SVP
Sbjct: 252  -----------------NDPTSISFEQNEAPGLPAVKALTSMANHEHSVQLATLVALSVP 294

Query: 413  RTTEEILFVPQLLARIGQIHGFTSKQCIYTASVLASLKENNISSIPPELEVLKNHNLWEI 472
            R+TEEIL +PQLLARIGQ+HG TSKQ +YTAS+LASLKE+   ++P  +++LK+ NLWE+
Sbjct: 295  RSTEEILLIPQLLARIGQVHGLTSKQSLYTASLLASLKESIPLTLPTNVDMLKSTNLWEV 354

Query: 473  DDVLHFWKNVFKLDFMTHTAVDHSSTHLNFAEVEELMQLFFQDWYELIPLFDKNEFNSYY 532
            DDV+ F++ VFK D    ++   S  HL   E++ L+  FF  WY  IP+ DK+EF +YY
Sbjct: 355  DDVIQFFQTVFKFDIQAESSTT-SQDHLIATEIDGLVSDFFSQWYNFIPILDKDEFYNYY 413

Query: 533  EKFKLNVTDPNFFVRKDDTVFNNRTRSISYKIFSCLLIIIVQMGMLSKIKRDKI-TSGKL 591
             KFK ++ DPNFF   +  +FN R +SISYKIF C+L+II QMG++SK+K + +  + K 
Sbjct: 414  NKFKTDLMDPNFF-DDEKNLFNKRNKSISYKIFGCILLIICQMGLISKVKAENLPATNKY 472

Query: 592  STLMKYYDKLMTHIWINPYFNSRNTSIQVLQCLSMLLFYMLNVGDISSIYELRGKVVSMS 651
            S LM YYD ++  + +NPYFN ++TSIQ LQ  S+ LFY LN+G++SS+Y+LRGKVVSMS
Sbjct: 473  SQLMAYYDIVVRQLMMNPYFNLKSTSIQSLQFTSLQLFYFLNIGEVSSVYDLRGKVVSMS 532

Query: 652  QQLRLHRCPSAVLGGDGSTVSKVQQGERRILFWSIYYLDVFSALQLGVPRLLKDFEIECA 711
            QQLRLHRCPSAVLGG+GS VSK QQGERRILFW IYYLDVFSALQLGVPRLLKD EIECA
Sbjct: 533  QQLRLHRCPSAVLGGNGSAVSKAQQGERRILFWGIYYLDVFSALQLGVPRLLKDHEIECA 592

Query: 712  LPVTSDDDRQVNLAGQMIALEGKVSQFSLSVIRFAKVMGNILDSTFKRGMTTSLTKQAAL 771
            LPV  +DD++VNLAGQMIALEG+VS  SLSVIRFAKV+GNILDS FKRGM+ SLTKQ +L
Sbjct: 593  LPVADNDDQKVNLAGQMIALEGRVSMLSLSVIRFAKVLGNILDSIFKRGMSASLTKQISL 652

Query: 772  VHENALDNWRHGLQKDLFFQLDVNGTINMDEFNQQKQYSKSLSPRTAAFTHNSLVLMTLY 831
            VHENALDNWR GL + L F+LDVNGTINMDEFN  KQ   S +     ++  +  LM LY
Sbjct: 653  VHENALDNWRRGLPQQLKFELDVNGTINMDEFNHLKQLDTSGN----MYSKENKSLMVLY 708

Query: 832  FMAKCMIHLPVVATKPLVAEAIQTPTDNQTENGSVDRSLSSYXXXXXXXXXXXXXXXXXX 891
            FMAKCMIHLPVVA +PLV +  Q+P  +   N   DRS SSY                  
Sbjct: 709  FMAKCMIHLPVVAKRPLVNDPEQSPESSTPSNNCGDRSSSSYVLLQQATNTLLNVFTSLR 768

Query: 892  SIYLPLPINLARTKTRFGLFSARGSLEYTKGGALFQDNKALLLDLVKELETDKKLELPGN 951
            ++Y P+PIN++RTKTRF L SARGSLEYTKGGALFQDNKALLLDLVKELE DKKLELPG 
Sbjct: 769  NVYPPIPINVSRTKTRFSLLSARGSLEYTKGGALFQDNKALLLDLVKELEVDKKLELPGT 828

Query: 952  TSWHSLKLFDLSINLILQPVNSNPEKTEKMIQKKINYYNKLMGQ------------PTVA 999
             SWHSLKL D+SI+LILQP N+ PEK EKM+Q+K+NYYNKL  +            P   
Sbjct: 829  LSWHSLKLLDMSISLILQPANTKPEKLEKMLQRKLNYYNKLTNRRSNLGGGRSASSPGGN 888

Query: 1000 VKRKRD--------PKATENTS-------KKVKVEDDHSQDNLHNITTGETTDTVHSEEL 1044
             KRK D        PK T  +S       KK+K+ED           TG       S+  
Sbjct: 889  SKRKLDENQGSAEPPKLTPASSKGDTPPDKKIKLED-----------TGFVPVRAVSQHS 937

Query: 1045 VKDVPKELN----VYPENYTTIEEAFQMDPVLNTNLFSNTDLKTLFNS 1088
              D  K  N    V P+N  +I EAF +DPVLN N FSNTDL   FN+
Sbjct: 938  QSDSEKFENFQPPVAPQN--SIAEAFHLDPVLNNNPFSNTDLNAFFNT 983

 Score = 61.2 bits (147), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 73/237 (30%), Positives = 98/237 (41%), Gaps = 42/237 (17%)

Query: 1183 FKVPSNGDFLKDYYINNMSNTGLSNLHTSSVNKGPSLSQLGSLFMSSGSGTNLPYSNVRG 1242
            FKVPSNGDFLKDYY          N+       G S SQL  LF+++ +    P  N  G
Sbjct: 1026 FKVPSNGDFLKDYY----------NV------PGASSSQLNLLFLNNNASNGKPQLN--G 1067

Query: 1243 ESKHPSGVNLNKQRAQPAMDGFSFAADASLGLAPLLAWSPDAKP-QLNSNNGNDGLNPAT 1301
             S H SG     Q      +GF FA DAS GLAPLL WSP  KP    + N N+      
Sbjct: 1068 SSAH-SGT----QAQNNDNNGFGFAVDASWGLAPLLEWSPAGKPVDPGTCNANE-----N 1117

Query: 1302 GIVLESGDNDSTNASVVXXXXXXXXXXXXXXXXXXXIPMGKQSSTSDRQNSHHQDNVGSF 1361
             I+L++   +  +                       +P     S+  +Q   H+   G+ 
Sbjct: 1118 SIILDTSAANMESEMATGGRLHSNTRSYTDAKNLDIVPT--LPSSKQQQQQQHRLQKGAS 1175

Query: 1362 HSMHSPTIPEQTSAQGLHQHQMLGMPNSTLNSDTNTGGANVTNSISSTNRRGPRRRW 1418
                S +IP         + Q L   N T  + +   G     ++ + N RGPRRRW
Sbjct: 1176 QQPRSASIPT--------RKQSLCESNPTTATGSRDDGV---LTMGTRNHRGPRRRW 1221

 Score = 33.9 bits (76), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 15/17 (88%), Positives = 15/17 (88%)

Query: 19 GPRFIRTLGSQSLSGLN 35
           PR IRTLGSQSLSGLN
Sbjct: 10 APRIIRTLGSQSLSGLN 26

>ABL121C Chr2 complement(170782..174639) [3858 bp, 1285 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YMR280C
            (CAT8)
          Length = 1285

 Score =  904 bits (2337), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/1003 (51%), Positives = 637/1003 (63%), Gaps = 103/1003 (10%)

Query: 177  YRVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGYXXXXXXXXXXX 236
            YRVAQACDRCR+KK RCDGKRPQC+QCAAVGFECKISDKLSRRAFPRGY           
Sbjct: 72   YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGYTETLEERVREL 131

Query: 237  XXXXXXXXXXCDLKEEQLHLVSKYS------------NSKDENGVEIPSTEEEQILHELS 284
                      CDLKEEQL LVSKY             N K ++  +  + E+EQIL +LS
Sbjct: 132  EAENRRLVALCDLKEEQLRLVSKYGCASAPATSSSSANKKGDS--DHTTLEDEQILQQLS 189

Query: 285  KTNGGSLRVSSTNLYLLNKKAS------PGDDSHIESSEPSIPVRKVAITAPSPRIMSPR 338
             ++GG+LRVSSTNLYLLNKK +      P   +   +   S P  +  +   SP  ++  
Sbjct: 190  NSDGGALRVSSTNLYLLNKKTAAFPLVQPVQQNLSPTQLRSNPYTRATL---SPSHVAEA 246

Query: 339  NSVADSDPSQTXXXXXXXXXXXXXXXXXXXS-TDPYGISFEQNEAPGLPXXXXXXXXXXY 397
            + V D                         +  DP  ISFEQ++APGLP          +
Sbjct: 247  DHVTDLRKGLPANPVAISSSVGQVPPYPFTNLNDPTSISFEQDQAPGLPAVKALSSLASH 306

Query: 398  KQGTQLATLVAVSVPRTTEEILFVPQLLARIGQIHGFTSKQCIYTASVLASLKENNISSI 457
            ++ +QLA LVAVS+PRTTEEILFVPQLLARIGQ+HGFTSKQC+YTASVLASLKE      
Sbjct: 307  EESSQLAALVAVSIPRTTEEILFVPQLLARIGQMHGFTSKQCLYTASVLASLKEITPRKT 366

Query: 458  PPELEVLKNHNLWEIDDVLHFW--------------------KNVFKLDFMTHTAVD--- 494
               LE LK  NLWEID+V  F                      N +KL+   H   D   
Sbjct: 367  SSILEQLKAKNLWEIDNVDTFLLEGLQIDIRRGSSGDFNLENPNGYKLENEYHQTKDAHP 426

Query: 495  --HSSTHLNFAEVEELMQLFFQDWYELIPLFDKNEFNSYYEKFKLNVTDPNFFVRKDDTV 552
                 T L F E+EEL+QLFF DWY LIP+FD++EF SY+ KFK NV+ P FF    DT+
Sbjct: 427  ELQELTPLTFQEIEELIQLFFDDWYSLIPIFDRSEFESYWVKFKDNVSTPGFFT-SGDTL 485

Query: 553  FNNRTRSISYKIFSCLLIIIVQMGMLSKIKRDKITSG-KLSTLMKYYDKLMTHIWINPYF 611
            F+ R +SISYKIF+CLL+ + QMG++SK+KR++   G +L+ LM YYD+ ++H+ +NPYF
Sbjct: 486  FDRRHKSISYKIFACLLLTVCQMGLMSKVKRERHERGDRLNNLMTYYDRAISHVIMNPYF 545

Query: 612  NSRNTSIQVLQCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLRLHRCPSAVLGGDGSTV 671
            +S +TSIQ LQ LS+LLFY LNVGD+S++YELRGKVVS++QQLRLHRCPSAVLG DGSTV
Sbjct: 546  SSSSTSIQSLQLLSLLLFYFLNVGDVSNVYELRGKVVSLTQQLRLHRCPSAVLGSDGSTV 605

Query: 672  SKVQQGERRILFWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDDDRQVNLAGQMIAL 731
             K+QQGERR+LFW +YYLDVFS+LQLGVPRL+KD EIECALPV+SDDD  VNLAGQMIAL
Sbjct: 606  GKIQQGERRVLFWGVYYLDVFSSLQLGVPRLMKDHEIECALPVSSDDDNHVNLAGQMIAL 665

Query: 732  EGKVSQFSLSVIRFAKVMGNILDSTFKRGMTTSLTKQAALVHENALDNWRHGLQKDLFFQ 791
            EGK+S FSLS+IRF+KV+GN+LDS FKRGMT S+TKQ ALVHENALDNWRH L  +L FQ
Sbjct: 666  EGKMSPFSLSIIRFSKVLGNVLDSIFKRGMTESMTKQVALVHENALDNWRHALPDNLRFQ 725

Query: 792  LDVNGTINMDEFNQQKQYSKSLSPRTAAFTHNSLVLMTLYFMAKCMIHLPVVATKPLVAE 851
            LDVNGTINM++ NQ K   +    +  A   N+ + M LYF+AK MIHLPVVATKP++ +
Sbjct: 726  LDVNGTINMEDLNQLK---RDYLNKDTALKLNNAIFMALYFLAKIMIHLPVVATKPII-D 781

Query: 852  AIQTPTDNQTENGSVDRSLSSYXXXXXXXXXXXXXXXXXXSIYLPLPINLARTKTRFGLF 911
              Q   D       +DRS SSY                  S+YLPLP+N+ RTKTRFGL 
Sbjct: 782  KPQPVVDTNIPGSQIDRSSSSYVLLQQATNTFLNVLSSVSSLYLPLPLNITRTKTRFGLV 841

Query: 912  SARGSLEYTKGGALFQDNKALLLDLVKELETDKKLELPGNTSWHSLKLFDLSINLILQPV 971
            SARGSLEYTKGGALFQDNK LLLDL+K+LE DKKL +PG  SWHSLKL D+++NLILQP 
Sbjct: 842  SARGSLEYTKGGALFQDNKNLLLDLLKDLEADKKLNMPGTISWHSLKLLDMAVNLILQPP 901

Query: 972  NSNPEKTEKMIQKKINYYNKLMGQ----------PTVAVKRKRDP--------KATENTS 1013
            N+ PEK EK++QKKINYYNKL+            P     RK +P        K    +S
Sbjct: 902  NTKPEKQEKLLQKKINYYNKLIDSHLGPTASLPTPGQTAPRKPEPAHARPIPEKEKPPSS 961

Query: 1014 KKVKVEDDHSQD---------NLHNITTGETTDTVHSEELVKDVPKELNVY--------- 1055
            K+ + +D+ +            L    +   T       L +DVP+ L+ +         
Sbjct: 962  KRHRGDDNAAASMPPLLEKKVKLEAPASNMPTPPAPISALHEDVPRVLDGHLGANSSLAV 1021

Query: 1056 ------PENY------TTIEEAFQMDPVLNTNLFSNTDLKTLF 1086
                  PE          I EAFQ+DP+L    FSNTDL + F
Sbjct: 1022 LAAKHEPEGSLHSSAGNAITEAFQLDPILQPTPFSNTDLPSFF 1064

 Score = 69.7 bits (169), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 72/261 (27%), Positives = 97/261 (37%), Gaps = 88/261 (33%)

Query: 1183 FKVPSNGDFLKDYYINNMSNTGLSNLHTSSVNKGPSLSQLGSLFMSSGSGTNLPYSNVRG 1242
            FKVPSNGDFLKDYY      +G+S+            +QL SLF +          +VR 
Sbjct: 1111 FKVPSNGDFLKDYY------SGMSS------------AQLNSLFTAPDR------RDVRP 1146

Query: 1243 ESKHPSGVNLNKQRAQPAMDGFSFAADASLGLAPLLAWSPDAKPQLNSNNGNDGLNPATG 1302
             +  P     +  + QP   G+ F  DASLGLAPLLAWSP                PA  
Sbjct: 1147 RAPQPDRAPSDGLQQQP---GYGFVVDASLGLAPLLAWSP---------------RPADD 1188

Query: 1303 IVLESGDNDSTNASVVXXXXXXXXXXXXXXXXXXXIPMGKQSSTSDRQNSHHQDNVGSFH 1362
            ++L+                                   K +  +  ++  H + + S  
Sbjct: 1189 LLLDD----------------------------------KGAKLASARSFTHVNKLSSIP 1214

Query: 1363 SMHSPTIPEQTSAQGLHQHQMLGMPNSTLNSDTNTGGANVTNSISSTNRRGPRRRWXXXX 1422
            ++ S T P   SA     H  LG P      D + G      +I   ++RGPRR W    
Sbjct: 1215 TLMS-TQPPPASA----PHAKLGQPAP---PDQDDG----ILTIPPRDQRGPRRLWNSAL 1262

Query: 1423 XXXXXXXXXXXXXXDLLRWQN 1443
                          DL RWQN
Sbjct: 1263 NQARPAAALDDSISDLFRWQN 1283

>KLTH0C03762g Chr3 (324666..328286) [3621 bp, 1206 aa] {ON} similar to
            uniprot|P39113 Saccharomyces cerevisiae YMR280C CAT8 Zinc
            cluster transcriptional activator
          Length = 1206

 Score =  873 bits (2256), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/946 (49%), Positives = 617/946 (65%), Gaps = 86/946 (9%)

Query: 177  YRVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGYXXXXXXXXXXX 236
            YRVAQACDRCR+KK RCDGKRPQC+QCAAVGFECK+SDKLSRRAFPRGY           
Sbjct: 68   YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYTETLEERVREL 127

Query: 237  XXXXXXXXXXCDLKEEQLHLVSKYSNSKDENGVEIPSTEEEQILHELSKTNGGSLRVSST 296
                      CDLK+EQ+HLV KYS++K     E  STEEEQ+L +LS +NGGSLRVSST
Sbjct: 128  EAENRRLVALCDLKDEQMHLVYKYSSNKRP---EPSSTEEEQMLEQLSSSNGGSLRVSST 184

Query: 297  NLYLLNKKASPGDDSHIESSEPSIPVRKVAITAPSPRIMSPRNSVADSDPSQTXXXXXXX 356
            NLYLLNK +  G +                              V ++   Q        
Sbjct: 185  NLYLLNKTSPAGHE------------------------------VPENHKCQGIDCNHTS 214

Query: 357  XXXXXXXXXXXXSTDPYGISFEQNEAPGLPXXXXXXXXXXYKQGTQLATLVAVSVPRTTE 416
                         +DP  ISFEQ+EAPGLP          ++  TQLA LVA+SVPR+TE
Sbjct: 215  HPHLHEKPVSTTLSDPTTISFEQHEAPGLPAVKALSSMANHEYSTQLACLVALSVPRSTE 274

Query: 417  EILFVPQLLARIGQIHGFTSKQCIYTASVLASLKENNISSIPPE--LEVLKNHNLWEIDD 474
            EILF+PQLLAR+GQ+HG TSKQC+YTAS+LASLKE + + +P    L  LK  +LWEIDD
Sbjct: 275  EILFIPQLLARLGQVHGLTSKQCLYTASLLASLKEPSQAVVPTTDGLTELKCTSLWEIDD 334

Query: 475  VLHFWKNVFKLDFMTHTAVDHSSTHLNFAEVEELMQLFFQDWYELIPLFDKNEFNSYYEK 534
             + F+K+  K +       D+    L+ +E+E+L+ ++F++ + LIP+ ++NEF  YY K
Sbjct: 335  PMRFFKDSCKFNL----GSDNDVELLSISEIEDLISIYFEECHALIPVLNENEFYKYYNK 390

Query: 535  FKLNVT-DPNFFVRKDDTVFNNRTRSISYKIFSCLLIIIVQMGMLSKIKRDKITS-GKLS 592
            FK ++T DPNFF  K ++ F +R++SISYKIF+C+L+++ Q+G++SK+KR+++ +  K S
Sbjct: 391  FKESLTVDPNFF-GKANSSFAHRSKSISYKIFACILLVVCQLGIMSKVKREQLPAKSKFS 449

Query: 593  TLMKYYDKLMTHIWINPYFNSRNTSIQVLQCLSMLLFYMLNVGDISSIYELRGKVVSMSQ 652
             +M YY+  +  + +NPYF+ + TS++ LQ +S+LLFY LNVG++SS+YELRG +VSM+Q
Sbjct: 450  RIMAYYNNAILALKLNPYFSVKTTSVKTLQLMSLLLFYFLNVGEVSSVYELRGTIVSMAQ 509

Query: 653  QLRLHRCPSAVLGGDGSTVSKVQQGERRILFWSIYYLDVFSALQLGVPRLLKDFEIECAL 712
            QLRLHRCPSAVLG +GST+SK +QG+RR+LFW IYYLDVFSALQLGVPRLLKD EIECAL
Sbjct: 510  QLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFSALQLGVPRLLKDHEIECAL 569

Query: 713  PVTSDDDRQVNLAGQMIALEGKVSQFSLSVIRFAKVMGNILDSTFKRGMTTSLTKQAALV 772
            P++ +    V+LA Q+I LEG+VS+FSLS++RF+K++GNILDS FKRGMT+S+ +Q AL+
Sbjct: 570  PISENGHPGVSLADQVIRLEGQVSEFSLSLLRFSKILGNILDSIFKRGMTSSIAQQVALI 629

Query: 773  HENALDNWRHGLQKDLFFQLDVNGTINMDEFNQQKQYSKSLSPRTAAFTHNSLVLMTLYF 832
            HENALD+WR GL K+L F+LDVNGTINM+E N    + K  S    A + ++  LM LYF
Sbjct: 630  HENALDSWRRGLPKNLTFELDVNGTINMEELNSGSHWKKDYS---TAPSCDNRTLMVLYF 686

Query: 833  MAKCMIHLPVVATKPLVAEAIQTPTDN----QTENGSVDRSLSSYXXXXXXXXXXXXXXX 888
            + KC++HLPV+A KPL+  A +  TD        +   DRS SSY               
Sbjct: 687  LVKCLVHLPVLAAKPLLGGASEVDTDATLAFDDASSGADRSSSSYVLLQQATNTFLSVQS 746

Query: 889  XXXSIYLPLPINLARTKTRFGLFSARGSLEYTKGGALFQDNKALLLDLVKELETDKKLEL 948
               S +LPL +NL R K RF L SARG LEYTKGGALFQ NKALLLD+VKELET K+LE+
Sbjct: 747  SLKSRHLPLALNLPRIKARFALLSARGILEYTKGGALFQGNKALLLDVVKELETTKRLEI 806

Query: 949  PGNTSWHSLKLFDLSINLILQPVNSNPEKTEKMIQKKINYYNKLMGQPTVAVKRKRDPKA 1008
            PG+ SWHSL L D++++LI+QP ++   K +K+++ K++YYNKLMG+            A
Sbjct: 807  PGSLSWHSLILLDMAVSLIMQPPHTKAGKLDKLLEAKLSYYNKLMGR-----------SA 855

Query: 1009 TENTSKKVKVEDDHSQDNLHNITTGETTDTVHSEELVK----DVPKELNVYPEN------ 1058
               ++K+ K ED+ S  N   +T   +  +  SE+ VK    D   E  V  EN      
Sbjct: 856  NVASTKRKKEEDNTSLSNATKLTPLSSDSSSPSEKRVKLEHTDKVGETPVGVENTGQPNG 915

Query: 1059 ----------------YTTIEEAFQMDPVLNTNLFSNTDLKTLFNS 1088
                            ++T+ EAF +DPVLN N FSN DL   F++
Sbjct: 916  NTQEHYAATWSNQNQPHSTVAEAFHLDPVLNNNPFSNGDLTAFFST 961

 Score = 67.4 bits (163), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 73/272 (26%), Positives = 98/272 (36%), Gaps = 89/272 (32%)

Query: 1183 FKVPSNGDFLKDYYINNMSNTGLSNLHTSSVNKGPSLSQLGSLFMSSGSGTNLPYSNVRG 1242
            F+VPSNGDFLKDYY                   G S SQL  + M SGS      SN R 
Sbjct: 1010 FRVPSNGDFLKDYY----------------RVPGASSSQLNLMLMGSGSSG----SNQR- 1048

Query: 1243 ESKHPSGVNLNKQRAQPAMDGFSFAADASLGLAPLLAWSPDAKPQLNSNNGNDGLNPATG 1302
                       +Q+      GF F  DASLGLAPLLAWSP+A               A  
Sbjct: 1049 --------QAKQQQTNTTDPGFGFTVDASLGLAPLLAWSPEA---------------AQE 1085

Query: 1303 IVLESGDNDSTNASVVXXXXXXXXXXXXXXXXXXXIPMGKQSSTSDRQNSHHQDNVGSFH 1362
             + E+ D+D+ N S +                              R+ S   +  G   
Sbjct: 1086 PIAETSDHDTRNDSGL------------------------------RRKS-GAETAGVLV 1114

Query: 1363 SMHSPTIPEQTSAQGLHQHQMLGMPNSTLNSDTNTGGANVTNSISSTNRRGPRRRWXXXX 1422
            + HS  + + ++     Q + +G  + T   D +   + +T  + +   RGPRRRW    
Sbjct: 1115 AGHS-QLADSSTDPASQQQRRVGSYDHTYAQDQSVEDSAIT--MPTRPHRGPRRRWNSTT 1171

Query: 1423 XXXXX-----------XXXXXXXXXDLLRWQN 1443
                                     DL RWQN
Sbjct: 1172 GAAAITPNSDRPRNAPASETDENLQDLFRWQN 1203

 Score = 38.1 bits (87), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 16/19 (84%), Positives = 18/19 (94%)

Query: 19 GPRFIRTLGSQSLSGLNPL 37
          GPRFIRTLGSQS+S +NPL
Sbjct: 10 GPRFIRTLGSQSISVINPL 28

>TDEL0B00530 Chr2 (95898..99803) [3906 bp, 1301 aa] {ON} Anc_8.845
            YMR280C
          Length = 1301

 Score =  845 bits (2182), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/974 (48%), Positives = 609/974 (62%), Gaps = 95/974 (9%)

Query: 178  RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGYXXXXXXXXXXXX 237
            RVAQACDRCR+KK RCDGKRPQC+QCAAVGFEC+ISDKLSRRAFPRGY            
Sbjct: 97   RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGYTETLEERVRELE 156

Query: 238  XXXXXXXXXCDLKEEQLHLVSKYSNSKDENGVEIPSTEEEQILHELSKTNGGSLRVSSTN 297
                     CD+KE+Q+HLVS +  +K + G       +EQ+L EL+  N G LR+SSTN
Sbjct: 157  AENRRLVALCDIKEQQIHLVSHFPTNKKKIG-----GNDEQMLQELTGANNGRLRISSTN 211

Query: 298  LYLLNKKASPGDDSHIESSEPSIPVRKVAITAPSPRIMSPRNSVADSDPSQTXXXXXXXX 357
            L+LLNK       + I + +  +       T          N+   S P  T        
Sbjct: 212  LFLLNKARDGKQPATISNGDDHMTKPDHEHTGKHRCDELDCNNKLHSKPVSTNL------ 265

Query: 358  XXXXXXXXXXXSTDPYGISFEQNEAPGLPXXXXXXXXXXYKQGTQLATLVAVSVPRTTEE 417
                         DP  ISFEQNEAPGLP           +Q TQLATLVA+SVPR+TEE
Sbjct: 266  ------------NDPTAISFEQNEAPGLPAVKALTSMATREQSTQLATLVALSVPRSTEE 313

Query: 418  ILFVPQLLARIGQIHGFTSKQCIYTASVLASLKENNISSIP-------PELEVLKNHNLW 470
            ILF+PQLLARI QIHGFTSKQC+Y+ S+LASLK N    +P        EL+ LK  NLW
Sbjct: 314  ILFIPQLLARIIQIHGFTSKQCLYSVSLLASLKNN----LPGPQLVKWDELDYLKTTNLW 369

Query: 471  EIDDVLHFWKNVFKLDFMT-HTAVDHSSTHLNFAEVEELMQLFFQDWYELIPLFDKNEFN 529
            E+D++  F+    K + +    + D  S  L+  E++EL+ LFF  W   IP+ DK EF 
Sbjct: 370  EVDNLDKFFHETLKFNILRPGVSDDGESLGLSIKEIDELVNLFFDSWAVHIPILDKEEFF 429

Query: 530  SYYEKFKLNV-TDPNFFVRKDDTVFNNRTRSISYKIFSCLLIIIVQMGMLSKIKRDKITS 588
            SYY+K K ++ T P  F ++  + F  R + ISYKIF+C+L  + QMG+L+K+K +KITS
Sbjct: 430  SYYDKLKKDISTQPGLF-QEGPSNFARRNKIISYKIFACILFTVCQMGLLTKVKGEKITS 488

Query: 589  GK--LSTLMKYYDKLMTHIWINPYFNSRNTSIQVLQCLSMLLFYMLNVGDISSIYELRGK 646
                   L  YY + ++ I++NPYF    TS+Q LQ LS+LLFY +N G++S+IYELRG+
Sbjct: 489  ADSPYVKLTSYYHRAISLIYLNPYFGVLTTSLQSLQFLSLLLFYFVNTGNVSAIYELRGR 548

Query: 647  VVSMSQQLRLHRCPSAVLGGDGSTVSKVQQGERRILFWSIYYLDVFSALQLGVPRLLKDF 706
            VVSM+QQLRLHRCPSAVLGG GST++K +QG+RR+LFW IYYLDVFSALQLGVPRL+KDF
Sbjct: 549  VVSMAQQLRLHRCPSAVLGGSGSTMNKREQGDRRVLFWGIYYLDVFSALQLGVPRLIKDF 608

Query: 707  EIECALPVTSDDDRQVNLAGQMIALEGKVSQFSLSVIRFAKVMGNILDSTFKRGMTTSLT 766
            EIECALPV  +DDR+V+LAGQMI LEG+VSQFSL++IRFAKV+GNILD+ FKRGMT S++
Sbjct: 609  EIECALPVAENDDREVSLAGQMIRLEGRVSQFSLAIIRFAKVLGNILDTVFKRGMTESVS 668

Query: 767  KQAALVHENALDNWRHGLQKDLFFQLDVNGTINMDEFNQQKQYSKSLSPRTAAFTHNSLV 826
            K+ AL+HENALDNWR GL  +L F+++VNGTINMD+FN+ KQ + ++           +V
Sbjct: 669  KKLALIHENALDNWRRGLPAELIFEIEVNGTINMDKFNEMKQNNATVE------NVEQMV 722

Query: 827  LMTLYFMAKCMIHLPVVATKPL---------VAEAIQTPTDNQTENGSVDRSLSSYXXXX 877
            L+  YF+AKCMIHLPVVAT+PL         + E  +    N   N ++ RS SSY    
Sbjct: 723  LLVSYFLAKCMIHLPVVATRPLPSSDDPNSDIKEEEEVNDKNGESNFAI-RSSSSYVLLQ 781

Query: 878  XXXXXXXXXXXXXXSIYLPLPINLARTKTRFGLFSARGSLEYTKGGALFQDNKALLLDLV 937
                          SIYLPLP N+ARTK RF L SARGSLEY KGGALF DNKALLLD+V
Sbjct: 782  QATNTMLNVLESLKSIYLPLPFNVARTKARFALLSARGSLEYIKGGALFLDNKALLLDVV 841

Query: 938  KELETDKKLELPGNTSWHSLKLFDLSINLILQPVNSNPEKTEKMIQKKINYYNKLMGQPT 997
            K +E D+KLE+PG  SWH LKL D++I+L+LQP N+  EK +++++KK+NYY+++MG+P 
Sbjct: 842  KSIEEDRKLEIPGVISWHGLKLLDMTISLLLQPPNTKVEKLDRLLKKKLNYYSRVMGRPI 901

Query: 998  V--------AVKRKRDP--------------KATENT-----------SKKVKVEDDHSQ 1024
            +        A  ++R+               +AT  T            KK+K+ED+ S 
Sbjct: 902  LKTSSLRQEANGKRRNSSDDKLSRSGTEENFRATNLTPISSKSDGSPVEKKIKLEDE-SS 960

Query: 1025 DNLHNITTGETTDTVHSEELVKDVPKELNVYPENYTTIEEAFQMDPVLNTNLFSNTDLKT 1084
            D  + +     TD + S      VP          T I EA  +DPVLN N+ S  DL  
Sbjct: 961  DTSNALVDKSYTDDLSSSANQPQVPA------STQTAIAEALHLDPVLNNNILSVADLAA 1014

Query: 1085 LFNSGIFENAGSIH 1098
             F   +    G+ H
Sbjct: 1015 FFGGNMPAAGGNQH 1028

 Score = 52.0 bits (123), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/117 (35%), Positives = 55/117 (47%), Gaps = 20/117 (17%)

Query: 1183 FKVPSNGDFLKD-YYINNMSNTGLSNLHTSSVNKGPSLSQLGSLFMSSGSGTNLPYSNVR 1241
            F+VPSN DFL D YY +  S+  L+  + ++ N   +          +G  TN    NV+
Sbjct: 1068 FRVPSNADFLMDEYYPSGTSHINLTLFNNNANNHDDTFGLSDGHGKDTGVNTNF---NVK 1124

Query: 1242 G---ESKHPSGVNLNKQRAQPAMDGFS------------FAADASLGLAPLLAWSPD 1283
            G    + H    N N  R Q    GF+            FA DASLGLAPLL WSP+
Sbjct: 1125 GGHQSTNHSHLTNFN-DRLQGNQLGFTNSGNMNSGSDFNFAVDASLGLAPLLDWSPE 1180

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 17/20 (85%), Positives = 20/20 (100%)

Query: 18 GGPRFIRTLGSQSLSGLNPL 37
          GGP++IRT+GSQSLSGLNPL
Sbjct: 9  GGPKYIRTMGSQSLSGLNPL 28

>Kwal_27.10232 s27 (251015..254644) [3630 bp, 1209 aa] {ON} YMR280C
            (CAT8) - Zinc-cluster protein involved in activating
            gluconeogenic genes; related to Gal4p [contig 39] FULL
          Length = 1209

 Score =  830 bits (2144), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/949 (48%), Positives = 607/949 (63%), Gaps = 93/949 (9%)

Query: 177  YRVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGYXXXXXXXXXXX 236
            YRVAQACDRCR+KK RCDGKRPQC+QCAAVGFECK+SDKLSRRAFPRGY           
Sbjct: 68   YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYTETLEERVREL 127

Query: 237  XXXXXXXXXXCDLKEEQLHLVSKYSNSKDENGVEIPSTEEEQILHELSKTNGGSLRVSST 296
                      CDLK+EQ+HLVSKYS++K     E  STEE ++L +LS ++GGSLRVSST
Sbjct: 128  EAENRRLVALCDLKDEQMHLVSKYSSNKRH---EPSSTEEGRMLEQLSNSDGGSLRVSST 184

Query: 297  NLYLLNKKASPG--DDSHIE---------SSEPSIPVRKVAITAPSPRIMSPRNSVADSD 345
            NLYLLN K +P   D S +          +S P +  + V+ +                 
Sbjct: 185  NLYLLN-KTTPAVQDGSELHKCQGLGCNHASHPHLHEKPVSTSL---------------- 227

Query: 346  PSQTXXXXXXXXXXXXXXXXXXXSTDPYGISFEQNEAPGLPXXXXXXXXXXYKQGTQLAT 405
                                    +DP  ISFEQNEAPGLP          ++   QLA 
Sbjct: 228  ------------------------SDPAAISFEQNEAPGLPAVKALNTMANHEYSAQLAY 263

Query: 406  LVAVSVPRTTEEILFVPQLLARIGQIHGFTSKQCIYTASVLASLKENNISSI--PPELEV 463
            LVA+SVPR+T+EILF+PQLLAR+GQ+HG TSKQC+Y+AS+LA+LKE++ +S    P+ + 
Sbjct: 264  LVALSVPRSTDEILFIPQLLARLGQVHGLTSKQCLYSASLLAALKESSQTSFQGSPDYKD 323

Query: 464  LKNHNLWEIDDVLHFWKNVFKLDFMTHTAVDHSSTHLNFAEVEELMQLFFQDWYELIPLF 523
            LK+ +LWEIDD + F+K   K +  +    +     L  +E+EEL+ ++F + + LIP+ 
Sbjct: 324  LKDKSLWEIDDCMTFFKTGCKFNLTSSKDAEC----LTISEIEELISIYFGECHALIPVL 379

Query: 524  DKNEFNSYYEKFKLNVT-DPNFFVRKDDTVFNNRTRSISYKIFSCLLIIIVQMGMLSKIK 582
            ++ EF  YY KFK N+T DP FF +     F  R++SISYKIF+C+L++I Q G+++K+K
Sbjct: 380  NEAEFYKYYNKFKSNLTTDPEFF-KTSTPSFAQRSKSISYKIFACILLVICQFGLMAKVK 438

Query: 583  RDKI-TSGKLSTLMKYYDKLMTHIWINPYFNSRNTSIQVLQCLSMLLFYMLNVGDISSIY 641
            R+++ T  K S LM YY   +  +  NPYF+ +NTSIQ LQ LS+LLFY LNVG++SS+Y
Sbjct: 439  REQLPTKNKFSLLMSYYSNALLALKTNPYFSVKNTSIQTLQLLSLLLFYYLNVGEVSSVY 498

Query: 642  ELRGKVVSMSQQLRLHRCPSAVLGGDGSTVSKVQQGERRILFWSIYYLDVFSALQLGVPR 701
            E+RG VVSM+QQLRLHRCPSAVLG +GST+SK +QG+RR+LFW IYYLDVF ALQLGVPR
Sbjct: 499  EIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQLGVPR 558

Query: 702  LLKDFEIECALPVTSDDDRQVNLAGQMIALEGKVSQFSLSVIRFAKVMGNILDSTFKRGM 761
            LLKD EIECALP++      V+LA Q+I LEG+VS+ SLS++RF+K++GNILDS FKRGM
Sbjct: 559  LLKDHEIECALPISEHAHAGVSLADQVIKLEGQVSELSLSLLRFSKILGNILDSIFKRGM 618

Query: 762  TTSLTKQAALVHENALDNWRHGLQKDLFFQLDVNGTINMDEFNQQKQYSKSLSPRTAAFT 821
            T+S  +Q AL+HENALDNWR GL K+L F+LDVNGTI ++E     Q ++  +   ++  
Sbjct: 619  TSSAAQQVALIHENALDNWRRGLPKNLTFELDVNGTIKIEELTGSAQNNQDFTKNASS-- 676

Query: 822  HNSLVLMTLYFMAKCMIHLPVVATKPLVAEAIQTPTDN----QTENGSVDRSLSSYXXXX 877
             +  +LM LYF+ KC++HLPV+A KPL+  + +   D        +   DRS SSY    
Sbjct: 677  -DKKILMLLYFLVKCLVHLPVLAAKPLLGGSSEPDKDATPAFDDASSGADRSSSSYVLLQ 735

Query: 878  XXXXXXXXXXXXXXSIYLPLPINLARTKTRFGLFSARGSLEYTKGGALFQDNKALLLDLV 937
                          + +LPL I+L R K RF L SARG LEYTKGGALFQDNKALLL++V
Sbjct: 736  QATNTFLSVQSCFKTRHLPLAIDLPRIKARFALLSARGILEYTKGGALFQDNKALLLEVV 795

Query: 938  KELETDKKLELPGNTSWHSLKLFDLSINLILQPVNSNPEKTEKMIQKKINYYNKLMGQPT 997
            KELE  KKLELPG+ SWHSL L D++  LI+QP  +  +K +K+++ ++NYYNKLMG+ T
Sbjct: 796  KELEASKKLELPGSLSWHSLILLDMATLLIMQPPQTKTDKLDKLLETRLNYYNKLMGRST 855

Query: 998  VAVKRKRDPKATENTS-----------------KKVKVEDDHSQDNL-HNITTGETTDTV 1039
            +    KR  +  + TS                 K++KVE   S  N+  N  +    D +
Sbjct: 856  LTSNGKRKNEENDATSKVSKLTPLSSEYNTPSDKRIKVESIGSSGNVPSNSESVHHFDDI 915

Query: 1040 HSEELVKDVPKELNVYPENYTTIEEAFQMDPVLNTNLFSNTDLKTLFNS 1088
             +++   + P   N  P     I EAF +DPVLN N FSN DL   FNS
Sbjct: 916  QNDKFSTNWPSN-NPQP---NAIAEAFHLDPVLNGNPFSNGDLTAFFNS 960

 Score = 66.2 bits (160), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 45/105 (42%), Positives = 50/105 (47%), Gaps = 30/105 (28%)

Query: 1183 FKVPSNGDFLKDYYINNMSNTGLSNLHTSSVNKGPSLSQLGSLFMSSGSGTNLPYSNVRG 1242
            F+VPSNGDFLKDYY                   G S SQL  +FM  G        N   
Sbjct: 1011 FRVPSNGDFLKDYY----------------RIPGASSSQLNLMFMGPG--------NTGA 1046

Query: 1243 ESKHPSGVNLNKQRAQPAMDGFSFAADASLGLAPLLAWSPDAKPQ 1287
                P     N Q+    + GF F  DASLGLAPLLAWSP+A PQ
Sbjct: 1047 NQNAP-----NNQKNNFTVPGFGFTVDASLGLAPLLAWSPEA-PQ 1085

 Score = 40.8 bits (94), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 18/19 (94%), Positives = 18/19 (94%)

Query: 19 GPRFIRTLGSQSLSGLNPL 37
          GPRFIRTLGSQSLSG NPL
Sbjct: 10 GPRFIRTLGSQSLSGTNPL 28

>ZYRO0G14278g Chr7 complement(1141297..1145049) [3753 bp, 1250 aa]
            {ON} similar to uniprot|Q75DZ4 Ashbya gossypii ABL121C
            ABL121Cp and similar to YMR280C uniprot|P39113
            Saccharomyces cerevisiae YMR280C CAT8 Zinc cluster
            transcriptional activator
          Length = 1250

 Score =  693 bits (1789), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/770 (48%), Positives = 504/770 (65%), Gaps = 62/770 (8%)

Query: 371  DPYGISFEQNEAPGLPXXXXXXXXXXYKQGTQLATLVAVSVPRTTEEILFVPQLLARIGQ 430
            DP  +SFEQ+EAPGLP           +Q  QLATLVA+SVPR+TEEILF+PQLLARI Q
Sbjct: 265  DPTSVSFEQSEAPGLPAVQALTSVATREQSNQLATLVALSVPRSTEEILFIPQLLARIRQ 324

Query: 431  IHGFTSKQCIYTASVLASLK----ENNISSIPPELEVLKNHNLWEIDDVLHFWKNVFKLD 486
            I+GFTSKQC+YT S+L+SLK    E ++    P LE L + NLWE+DD+  F+  +FK  
Sbjct: 325  IYGFTSKQCLYTVSLLSSLKSSLPEPHLVKHEP-LETLASTNLWEMDDLEQFFAEIFKFK 383

Query: 487  FMTHTAVDH-SSTHLNFAEVEELMQLFFQDWYELIPLFDKNEFNSYYEKFKLNVTDPNFF 545
              + +   +     LN +E+EEL+ +FF+     IP+  K+EF  Y+ +FK NV     F
Sbjct: 384  LESKSPSSYKGGAQLNLSEIEELISIFFEHSSIHIPILVKDEFYHYFNQFKENVLQNLEF 443

Query: 546  VR---KDDTVFNNRTRSISYKIFSCLLIIIVQMGMLSKIKRDKI-TSGKLSTLMKYYDKL 601
            ++   +   +   R + ISYKIF C+++++ Q+G+LSKIK + +  + K   L  YY K 
Sbjct: 444  LKTPLQGPALTARRGKIISYKIFGCIILMLCQLGLLSKIKAENLGATSKHHRLASYYHKA 503

Query: 602  MTHIWINPYFNSRNTSIQVLQCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLRLHRCPS 661
            ++ +++NPYF   +TS+Q LQ LS++LFY LN+G++S+IYELRG+VVSM+QQLRLHRCPS
Sbjct: 504  ISLVYMNPYFGVLSTSLQSLQFLSLVLFYFLNIGNVSAIYELRGRVVSMAQQLRLHRCPS 563

Query: 662  AVLGGDGSTVSKVQQGERRILFWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDDDRQ 721
            AVLGG GST++K +QG+RR+LFW IYYLDVFSALQLGVPRL+KDFEIECALPV  +DDR 
Sbjct: 564  AVLGGAGSTMNKREQGDRRVLFWGIYYLDVFSALQLGVPRLIKDFEIECALPVADNDDRT 623

Query: 722  VNLAGQMIALEGKVSQFSLSVIRFAKVMGNILDSTFKRGMTTSLTKQAALVHENALDNWR 781
            VNLAGQ I LEG+V+ +SL++IRF+KV+GNILDS FKRGMT S+TKQ +L+HENALDNWR
Sbjct: 624  VNLAGQQIRLEGQVTNYSLAIIRFSKVLGNILDSIFKRGMTESITKQVSLIHENALDNWR 683

Query: 782  HGLQKDLFFQLDVNGTINMDEFNQQKQYSKSLSPRTAAFTHNSLVLMTLYFMAKCMIHLP 841
            HGL K+L F+LDVNGTIN+DEFN+ KQ + ++          ++ L+ +YF+AKCMIHLP
Sbjct: 684  HGLPKELIFELDVNGTINIDEFNRLKQMNVTVE------RSENMTLLVMYFLAKCMIHLP 737

Query: 842  VVATKPLVAEAIQT--PTDNQTENG---------------SVDRSLSSYXXXXXXXXXXX 884
            VVAT+PL          T N T NG               + DRS SSY           
Sbjct: 738  VVATRPLPTNDSNDTGETSNATSNGNNVRARDPSTERNQAAADRSSSSYVLLQQATNTML 797

Query: 885  XXXXXXXSIYLPLPINLARTKTRFGLFSARGSLEYTKGGALFQDNKALLLDLVKELETDK 944
                   +++LPLP+N++RTK RF L SARGSLEYTKGGALF DNK+LLLD++K+LE D+
Sbjct: 798  NVLESLKTLFLPLPLNISRTKARFALLSARGSLEYTKGGALFLDNKSLLLDVIKDLEEDR 857

Query: 945  KLELPGNTSWHSLKLFDLSINLILQPVNSNPEKTEKMIQKKINYYNKLMGQPTVAVKRKR 1004
            KL+LPG  SW+SLKL D+SINL+LQP N+   K +++++KK+NYYN+LMG+PT  VK++ 
Sbjct: 858  KLDLPGVISWNSLKLLDMSINLLLQPPNTEVGKLDRLLKKKLNYYNRLMGRPT--VKQEP 915

Query: 1005 DPKATENTSKKVKVEDDHSQDNLHNITTGETTDTVHSEELVKDVPKELNVYPE------- 1057
              K  + T    K E+D        I        V  ++     P  + V  +       
Sbjct: 916  ASKGHDLTPASSKDEEDTPAAKRIKIEETSIPLAVPQQQQHMQAPAPVMVQEKQQPQPQP 975

Query: 1058 -------------------NYTTIEEAFQMDPVLNTNL-FSNTDLKTLFN 1087
                                 T   EA Q+DPVLN+N+ F N    TL++
Sbjct: 976  QPQPQPQPQLQPQPQQLQLPQTAFAEALQLDPVLNSNVSFQNAPPTTLYD 1025

 Score =  150 bits (379), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 83/125 (66%), Gaps = 6/125 (4%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGYXXXXXXXXXXXX 237
           RVAQACDRCR+KK RCDGKRPQC+QCAAVGFECKISD+LSRRAFPRGY            
Sbjct: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGYTETLEERVRELE 158

Query: 238 XXXXXXXXXCDLKEEQLHLVSKYSNSKDENGVEIPSTEEEQILHELSKTNGGSLRVSSTN 297
                    CD+KE+Q+HL S+  +            ++E++L EL   NGGSL +SSTN
Sbjct: 159 AENRRLVALCDIKEQQIHLFSQQHSPGGRR------KDDERMLRELQSANGGSLNISSTN 212

Query: 298 LYLLN 302
           LYLLN
Sbjct: 213 LYLLN 217

 Score = 59.7 bits (143), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 56/120 (46%), Gaps = 31/120 (25%)

Query: 1183 FKVPSNGDFLKDYYINNMSNTGLSNLHTSSVNKGPSLSQLGSLFMSSGSGTNLPYS-NVR 1241
            FKVPS  DFL D   N+  N  L              ++LG L  S  S TN P S +  
Sbjct: 1059 FKVPSTADFLMDDSANSQLNFLLGT------------TELGVLDPSQPSYTNNPGSGSAI 1106

Query: 1242 GESKHPSGVNLNK------------------QRAQPAMDGFSFAADASLGLAPLLAWSPD 1283
            G +  PSG+NL+                   Q  Q    GF+FA DASLGLAPLLAW+PD
Sbjct: 1107 GINNMPSGLNLSNLFDLEGSTDQPPTNTNATQATQANSGGFNFAVDASLGLAPLLAWTPD 1166

>Ecym_4616 Chr4 complement(1204091..1208824) [4734 bp, 1577 aa] {ON}
            similar to Ashbya gossypii ABL121C
          Length = 1577

 Score =  698 bits (1802), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/869 (47%), Positives = 523/869 (60%), Gaps = 129/869 (14%)

Query: 500  LNFAEVEELMQLFFQDWYELIPLFDKNEFNSYYEKFKLNVTDPNFFVRKDDTVFNNRTRS 559
            L+F E +E++ LFF +WY LIP+FDK+EF++Y++KFK NV+ P FF    DT+F  R +S
Sbjct: 594  LSFQECDEMIHLFFDEWYSLIPIFDKSEFDNYWQKFKENVSTPEFFT-SGDTIFAKRHKS 652

Query: 560  ISYKIFSCLLIIIVQMGMLSKIKRDKI-TSGKLSTLMKYYDKLMTHIWINPYFNSRNTSI 618
            ISYKIF+CLL+ +VQMG+++K+KR+ +    KL+ LM YYD+ ++HI  NPYF S +TSI
Sbjct: 653  ISYKIFACLLVTVVQMGLMTKVKRENLGRRHKLNILMTYYDRALSHIITNPYFGSNSTSI 712

Query: 619  QVLQCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLRLHRCPSAVLGGDGSTVSKVQQGE 678
            Q LQ LS+LLFY LNVGDIS+IYELRGKVVS +QQLRLHRCPSAVLGGDG TVS++QQGE
Sbjct: 713  QSLQLLSLLLFYFLNVGDISNIYELRGKVVSFAQQLRLHRCPSAVLGGDGCTVSRIQQGE 772

Query: 679  RRILFWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDDDRQVNLAGQMIALEGKVSQF 738
            RR+LFW +YYLDVF++LQLGVPRLLKD EIECALPV+SD DRQVNLAGQMI+LEGK+S F
Sbjct: 773  RRVLFWGVYYLDVFASLQLGVPRLLKDHEIECALPVSSDSDRQVNLAGQMISLEGKMSPF 832

Query: 739  SLSVIRFAKVMGNILDSTFKRGMTTSLTKQAALVHENALDNWRHGLQKDLFFQLDVNGTI 798
            SLSVIRF+KV+GN+LDS FKRGMT S+TK+ ALVHENALDNWRHGL   L FQLDVNGTI
Sbjct: 833  SLSVIRFSKVLGNVLDSIFKRGMTISITKEVALVHENALDNWRHGLPDGLRFQLDVNGTI 892

Query: 799  NMDEFNQQKQYSKSLSPRTAAFTHNSLVLMTLYFMAKCMIHLPVVATKPLVAEAIQTPTD 858
            NMDEFNQ K   + L+   + F   + + MTLYF+AK MIH+PVVA KP V  ++Q   D
Sbjct: 893  NMDEFNQLKH--EYLNNDNSKFNKENFIFMTLYFLAKSMIHIPVVAGKPPVDTSVQEKND 950

Query: 859  NQTENGSVDRSLSSYXXXXXXXXXXXXXXXXXXSIYLPLPINLARTKTRFGLFSARGSLE 918
                    DRS SSY                  + YLPLPIN++R KTRFGLFSARGSLE
Sbjct: 951  PAISR-QADRSSSSYILLQQATNTFLNVLTSMRTAYLPLPINISRAKTRFGLFSARGSLE 1009

Query: 919  YTKGGALFQDNKALLLDLVKELETDKKLELPGNTSWHSLKLFDLSINLILQPVNSNPEKT 978
            YTKGGALFQDNK+LLL+L+KELE D+KL +PG  SWHSLKLFD++INLILQP N+ PEK 
Sbjct: 1010 YTKGGALFQDNKSLLLNLIKELEVDRKLGIPGTISWHSLKLFDMAINLILQPPNTKPEKE 1069

Query: 979  EKMIQKKINYYNKLMGQP---------TVAVKR--------------------------- 1002
            EK++QKKI+YYNKL+            + A++                            
Sbjct: 1070 EKLLQKKISYYNKLIDHSVGMHASVITSAAIQHQRQQQQQQQQQQQQQQLHYKENKGNGA 1129

Query: 1003 KRDPKATENTS------KKVKVEDDHSQ--------DNLHNITTGETTDTVHSEELVKDV 1048
            KR P+   +T+      K+VK+E+   +          LH   +     ++ S  +V DV
Sbjct: 1130 KRKPEIGSSTTTNMSLNKRVKMEEPSVKIPTSNGPLSALHEDDSEMLGKSLRSNTIVSDV 1189

Query: 1049 P------KELNVYPENYTTIEEAFQMDPVLNTNLFSNTDLKTLFNSGIFENAGSIHXXXX 1102
            P       E+ V       I EAFQ+DPVL+   FS+TDL +  N  +  NA        
Sbjct: 1190 PTGQKMESEIPVSMSATNAIAEAFQLDPVLHATPFSSTDLTSFLNGEVVTNASMF----- 1244

Query: 1103 XXXXXXXXXXXXXXXXGSSRNIHNLGAGIEDID--HGMXXXXXXXXXXXXXXXXXXXXXX 1160
                              + +   +G G+ D+   +G+                      
Sbjct: 1245 ----------------ADTMHTTGIGGGLTDVSGHNGLPSNNSLLNMSSIGFGIGSGPSL 1288

Query: 1161 AE-GMKDGXXXXXXXXXXXXXXXFKVPSNGDFLKDYYINNMSNTGLSNL----HTSSVNK 1215
            A    KDG               FKVPSNGDFLKDYY + MS+  L++L    +T +  +
Sbjct: 1289 ANLSSKDG--------------LFKVPSNGDFLKDYY-SGMSSAQLASLFVNGNTENALQ 1333

Query: 1216 GPSLSQLGSLFMSSGSGTNL-PY-----SNVRGESKHP----------------SGVNLN 1253
             P+  +      S G   +L P+        + + +HP                S +   
Sbjct: 1334 KPTDHRRYQPSQSQGQQLHLQPHPEPQRQRQQQQQQHPDHQRYPLEDEPGICEQSKIRTE 1393

Query: 1254 KQRAQPAMDGFSFAADASLGLAPLLAWSP 1282
            K+  Q    G+ F  DASLGLA LL WSP
Sbjct: 1394 KKNQQ---QGYGFVVDASLGLASLLGWSP 1419

 Score =  285 bits (729), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 169/392 (43%), Positives = 207/392 (52%), Gaps = 77/392 (19%)

Query: 177 YRVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGYXXXXXXXXXXX 236
           YRVAQACDRCR+KK RCDGKRPQC+QCAAVGFECKISDKLSRRAFPRGY           
Sbjct: 123 YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGYTETLEERVREL 182

Query: 237 XXXXXXXXXXCDLKEEQLHLVSKYS----------------------------------- 261
                     CDLKEEQL LVSKYS                                   
Sbjct: 183 EAENRRLVALCDLKEEQLRLVSKYSAGSVGVGVGGPVTAGTTVGNRSSVNGAVNESASST 242

Query: 262 ---------------NSKDENGVEIPSTEEEQILHELSKTNGGSLRVSSTNLYLLNKKAS 306
                           +K   G +  + EE++IL +LSK++GG+LRVSSTNLYLLNKK S
Sbjct: 243 VGSIATAGSTAGLAHQNKKCAGSDSTTPEEDRILQQLSKSDGGTLRVSSTNLYLLNKKTS 302

Query: 307 -------PGDDSHIESSEPSIPVRKVAITAPSPRIMSPRNSVADSD-PSQ---------- 348
                  PG  +  E+     P++  +         +  + VADSD P++          
Sbjct: 303 GQQQLLLPGSANKSEA----FPIQPDSYKLQQRSQSTASSHVADSDNPAEFQKEHLQPRT 358

Query: 349 -----TXXXXXXXXXXXXXXXXXXXSTDPYGISFEQNEAPGLPXXXXXXXXXXYKQGTQL 403
                                      DP  ISFEQ++APGL           ++Q +QL
Sbjct: 359 LPNIPVASTAIPSAPPGVTAYSLANLNDPTSISFEQDQAPGLSAVKALSTMANHEQSSQL 418

Query: 404 ATLVAVSVPRTTEEILFVPQLLARIGQIHGFTSKQCIYTASVLASLKENNISSIPPELEV 463
           ATLVA+S+PRTTEEILFVPQLLARIGQ+HGFTSKQC+YTASVLASLKE       PELE+
Sbjct: 419 ATLVAMSIPRTTEEILFVPQLLARIGQVHGFTSKQCLYTASVLASLKEIVPYQTSPELEL 478

Query: 464 LKNHNLWEIDDVLHFWKNVFKLDFMTHTAVDH 495
           L++ +LWEIDDV  F     +  F + T+ ++
Sbjct: 479 LRSKSLWEIDDVDSFLSKGLRFSFPSATSAEN 510

>Suva_13.468 Chr13 complement(809712..812654,812694..814007) [4257 bp,
            1418 aa] {ON} YMR280C (REAL)
          Length = 1418

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/1008 (40%), Positives = 568/1008 (56%), Gaps = 132/1008 (13%)

Query: 177  YRVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGYXXXXXXXXXXX 236
            YR+AQACDRCR+KK RCDGKRPQC+QCAAVGFEC+ISDKL R+A+P+GY           
Sbjct: 63   YRIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYPKGYTESLEERVREL 122

Query: 237  XXXXXXXXXXCDLKEEQLHLVSKYSNSKDENGVEIPSTEEEQILHELSKTNGGSLRVSST 296
                      CD+KE+Q++LVS+           + +T  +    +L       L +SST
Sbjct: 123  EAENKRLLALCDIKEQQINLVSQ-----SRPPTSLDNTVSDNFKQDLK---DAPLNLSST 174

Query: 297  NLYLLNKKASPG-DDSHIESSEPSIPVRKVAITAPSPRIMSPRNSVADSDPSQTXXXXXX 355
            N+YLLN+  +    +  I+++     +  +A + P P+    ++ V D            
Sbjct: 175  NIYLLNQTVNKQLQNGKIDTNRSDSTMGLLATSPPLPQ----KDHVCDG---------VS 221

Query: 356  XXXXXXXXXXXXXSTDPYGISFEQNEAPGLPXXXXXXXXXXYKQGTQLATLVAVSVPRTT 415
                           DP  ISFEQNEAPGLP          +++ TQLATLV++S+PR+T
Sbjct: 222  CTNNLHAKPTSTSLNDPTAISFEQNEAPGLPAVKALKSMTTHQRSTQLATLVSLSIPRST 281

Query: 416  EEILFVPQLLARIGQIHGFTSKQCIYTASVLASLK------------------ENNISSI 457
            EEILF+PQLL RI QI GF SKQC+YT S+L+SLK                  EN+ S  
Sbjct: 282  EEILFIPQLLTRIRQIFGFNSKQCLYTVSLLSSLKNRLPAPKLLLSSTSTKIKENDDSKF 341

Query: 458  PPELEVLKNHNLWEIDDVLHFWKNVFKLDFMTHT----AVDHSSTH---LNFAEVEELMQ 510
               L   +  +L E  D+  F  ++ K D  + +     V ++ +    L+  E++EL+ 
Sbjct: 342  ---LNTFETTSLAEFGDLKKFLISL-KFDINSFSNQQPEVQNNKSDNDLLSLNEIKELLH 397

Query: 511  LFFQDWYELIPLFDKNEFNSYYEKFKLNVTDPNFFVRKDDTVFNNRTRSISYKIFSCLLI 570
            LFF+ W   + + + + F  Y+  F   +      ++K +    + T   +++IF+  L+
Sbjct: 398  LFFKFWSNQVSILNNDHFLLYFNNFVEVIKALPLELKKTNGTKTHAT--TNHQIFALKLL 455

Query: 571  IIVQMGMLSKIKRDKIT-------SGKLSTLMKYYDKLMTHIWINPYF-NSRNTSIQVLQ 622
            I++QMG+L K+KR+KI        + K + LM YY ++ + I  NPYF N   TS+  LQ
Sbjct: 456  IMLQMGLLIKVKREKIKDTVPGNQNSKFAKLMVYYHQVSSIIPKNPYFLNMSTTSLPSLQ 515

Query: 623  CLSMLLFYMLNVGDISSIYELRGKVVSMSQQLRLHRCPSAVLGGDGSTV-SKVQQGERRI 681
             LS+  FY LNVGDI +IY LRG++VSMSQQLRLHRCPSAVL    + V  + +Q ERR+
Sbjct: 516  LLSLTSFYFLNVGDIPAIYGLRGRIVSMSQQLRLHRCPSAVLSVHSNPVLQRFEQSERRL 575

Query: 682  LFWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDDDRQVNLAGQM---------IALE 732
            LFW++YY+DVF++LQLGVPRLLKDF+IECALP+ SD + +  LA +          I L+
Sbjct: 576  LFWAVYYIDVFASLQLGVPRLLKDFDIECALPI-SDVEFEDQLASENEKTKNKTKKIQLQ 634

Query: 733  GKVSQFSLSVIRFAKVMGNILDSTFKRGMTTS-LTKQAALVHENALDNWRHGLQKDLFFQ 791
            G+VS FSL +IRFAK++GNILDS FKRGM    +T + ALVHENALDNWR+ L +  +FQ
Sbjct: 635  GQVSSFSLQIIRFAKILGNILDSIFKRGMMDERVTSEVALVHENALDNWRNQLPEMYYFQ 694

Query: 792  LDVNGTINMDEF---NQQKQYSKSLSPRTAAFTHNSLVLMTLYFMAKCMIHLPVVATKPL 848
            + VNGT+N+D+    N +   +K        F  N  VL+  YF+AK MIHLPV+ATKPL
Sbjct: 695  ITVNGTVNLDDIRANNSRNTEAKFDRKDIICFEKN--VLLLFYFLAKSMIHLPVIATKPL 752

Query: 849  ---VAEAIQ---------TPTDNQTENGSVD--------RSLSSYXXXXXXXXXXXXXXX 888
               V  + +         T + N  ++  VD        R+ SSY               
Sbjct: 753  PKTVDNSTKKKHSMFNNDTKSINNQDHSVVDVDMTSPAIRTSSSYIILQQATNATLTLFQ 812

Query: 889  XXXSIYLPLPINLARTKTRFGLFSARGSLEYTKGGALFQDNKALLLDLVKELETDKKLEL 948
               S+YLPLP+N++RT  RF L  ARGSLEYTKGGALF DNK LLLD +K++E D+ L+L
Sbjct: 813  SINSVYLPLPLNVSRTLIRFSLLCARGSLEYTKGGALFLDNKNLLLDTIKDIENDRLLDL 872

Query: 949  PGNTSWHSLKLFDLSINLILQPVNSNPEKTEKMIQKKINYYNKLMG---------QPTVA 999
            PG  SWH+LKLFD++INL+L+  N   E+ +K ++KK+NYYN+LMG         +P  +
Sbjct: 873  PGVASWHTLKLFDMTINLLLKAPNVKVERLDKFLEKKLNYYNRLMGLPPTTTTSSEPLFS 932

Query: 1000 VKRKRDPKATENTSKKVKVEDDHSQ----DNLHNITTGETTDTVHSEELVKDVPKELNVY 1055
             + K  P A  + S  VK E+  ++    D ++N   G T     S E  ++V K L   
Sbjct: 933  SQSKNTP-ANGSRSSIVKRENPENEYLYGDGINN---GNTDMDKPSTEDARNVNKRLKHE 988

Query: 1056 PENYTTIEE----------AFQMDPVLN---TNL----FSNTDLKTLF 1086
                 +I++           FQ D   N   +NL    FSNTDL  LF
Sbjct: 989  KSISQSIDDDNMSRNQNGSKFQQDSKKNMSTSNLFPFSFSNTDLTALF 1036

>Skud_13.452 Chr13 complement(800289..804587) [4299 bp, 1432 aa]
           {ON} YMR280C (REAL)
          Length = 1432

 Score =  622 bits (1603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/887 (42%), Positives = 520/887 (58%), Gaps = 89/887 (10%)

Query: 177 YRVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGYXXXXXXXXXXX 236
           YR+AQACDRCR+KK RCDGKRPQC+QCAAVGFEC+ISDKL R+A+P+GY           
Sbjct: 63  YRIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYPKGYTESLEERVREL 122

Query: 237 XXXXXXXXXXCDLKEEQLHLVSKYSNSKDENGVEIPSTEEEQILHELSKTNGGSLRVSST 296
                     CD+KE+Q+ LVS+   S       + S  +     EL       L +SST
Sbjct: 123 EAENKRLLALCDIKEQQISLVSQSRPS-----TSLDSNVDGNCKKELK---DAPLNLSST 174

Query: 297 NLYLLNKKASPGDDSHIESSEPSIPVRKVAITAPSPRIMSPRNSVADSDPSQTXXXXXXX 356
           N+YLLN+  +    S    ++ S         +PSP    P++ V D             
Sbjct: 175 NIYLLNQTVNKQLQSGKMDNDNSDAAIDSLAASPSP---PPKDHVCDG---------VSC 222

Query: 357 XXXXXXXXXXXXSTDPYGISFEQNEAPGLPXXXXXXXXXXYKQGTQLATLVAVSVPRTTE 416
                        +DP  ISFEQNEAPGLP          +++ TQLATLV++S+PR+TE
Sbjct: 223 TNRLHVKPTSTSLSDPTAISFEQNEAPGLPAVKALKSMTTHQRSTQLATLVSLSIPRSTE 282

Query: 417 EILFVPQLLARIGQIHGFTSKQCIYTASVLASLK------------------ENNISSIP 458
           EILF+PQLL RI QI GF SKQC+YT S+L+SLK                  E N    P
Sbjct: 283 EILFIPQLLTRIRQIFGFNSKQCLYTVSLLSSLKNRLPAPSILLPSTSTNSKEKNEDKTP 342

Query: 459 PE----LEVLKNHNLWEIDDVLHFWKNV-FKLDFMTHT----AVDHSSTHLNFAEVEELM 509
            +    L+  ++ +L E  D+  F  ++ F +D  +      A  H S  L+  E++EL+
Sbjct: 343 NDDSAFLKTFQSTSLSEFVDLKKFLISLKFDIDSFSKQPEKQANGHDSDLLSLTEIKELL 402

Query: 510 QLFFQDWYELIPLFDKNEFNSYYEKFKLNVTDPNFFVRKDDTVFNNRTRSISYKIFSCLL 569
            LFF+ W   +P+ + + F  Y+  F   + D +    K ++   N   + +++IF+  L
Sbjct: 403 HLFFKFWSNQVPILNNDHFLLYFNNFVEIIKDFSLISTKANSTTKNNV-TTNHEIFTLKL 461

Query: 570 IIIVQMGMLSKIKRD-------KITSGKLSTLMKYYDKLMTHIWINPYF-NSRNTSIQVL 621
           ++++QMG+L KIK+D       + ++ K   LM YY ++   I  NPYF N   TS+  L
Sbjct: 462 LMMLQMGLLIKIKKDKIKDTVPRNSNAKYIRLMSYYHQISLIIPKNPYFLNMSTTSLPSL 521

Query: 622 QCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLRLHRCPSAVLGGDGSTV-SKVQQGERR 680
           Q LS+  FY LNVGDIS+IY +RG++VSM+QQLRLHRCPSAVL    + V  K +Q ERR
Sbjct: 522 QLLSLASFYYLNVGDISAIYGIRGRIVSMAQQLRLHRCPSAVLSVHSNPVLQKFEQSERR 581

Query: 681 ILFWSIYYLDVFSALQLGVPRLLKDFEIECALPVT--------SDDDRQVNLAGQMIALE 732
           +LFW+IYY+DVF++LQLGVPRLLKDF+IECALP++        S ++ ++    + I L+
Sbjct: 582 LLFWAIYYVDVFASLQLGVPRLLKDFDIECALPISDVEYKDQLSMENEKMKNKAKKIQLQ 641

Query: 733 GKVSQFSLSVIRFAKVMGNILDSTFKRGMTTS-LTKQAALVHENALDNWRHGLQKDLFFQ 791
           G+VS FSL +IRFAK++GNILDS FKRGM    ++ + ALVHENALDNWR+ L +  +F+
Sbjct: 642 GQVSSFSLQIIRFAKILGNILDSIFKRGMMDERISSEVALVHENALDNWRNQLPEMYYFK 701

Query: 792 LDVNGTINMDEF--NQQKQYSKSLSPRTAAFTHNSLVLMTLYFMAKCMIHLPVVATKPL- 848
           + VNGT+N+DE   N  +        +        ++L+  YF+AK MIHLPV+ATKPL 
Sbjct: 702 ITVNGTVNLDEIRANNSRDIETPFETKDIILFEKKILLL-FYFLAKSMIHLPVIATKPLS 760

Query: 849 -----VAEAIQTPTDNQT------ENGSVD--------RSLSSYXXXXXXXXXXXXXXXX 889
                V +  Q+  +N +      ++ +VD        R+ SSY                
Sbjct: 761 KNVDNVMKKKQSMFNNDSKGTNNHDHMAVDVDMTSPAIRTSSSYIILQQATNATLTIFQS 820

Query: 890 XXSIYLPLPINLARTKTRFGLFSARGSLEYTKGGALFQDNKALLLDLVKELETDKKLELP 949
              +YLPLP+N++RT  RF L  ARGSLEYTKGGALF DNK LLLD +K++E D+ LELP
Sbjct: 821 INWMYLPLPLNVSRTLVRFSLLCARGSLEYTKGGALFLDNKNLLLDTIKDIENDRLLELP 880

Query: 950 GNTSWHSLKLFDLSINLILQPVNSNPEKTEKMIQKKINYYNKLMGQP 996
           G  SWH+LKLFD++INL+L+  N   E+ +K ++KK+NYYN+LMG P
Sbjct: 881 GIASWHTLKLFDMTINLLLKAPNVKVERLDKFLEKKLNYYNRLMGLP 927

>YMR280C Chr13 complement(827028..831329) [4302 bp, 1433 aa] {ON}
           CAT8Zinc cluster transcriptional activator necessary for
           derepression of a variety of genes under
           non-fermentative growth conditions, active after diauxic
           shift, binds carbon source responsive elements
          Length = 1433

 Score =  620 bits (1600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/900 (42%), Positives = 518/900 (57%), Gaps = 115/900 (12%)

Query: 177 YRVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGYXXXXXXXXXXX 236
           YR+AQACDRCR+KK RCDGKRPQC+QCAAVGFEC+ISDKL R+A+P+GY           
Sbjct: 64  YRIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYPKGYTESLEERVREL 123

Query: 237 XXXXXXXXXXCDLKEEQLHLVSKYSNSKDENGVEIPSTEEEQILHELSKTNGGSLRVSST 296
                     CD+KE+Q+ LVS+   S+ +   +  +T      H+L       L +SST
Sbjct: 124 EAENKRLLALCDIKEQQISLVSQ---SRPQTSTD--NTINGNFKHDLK---DAPLNLSST 175

Query: 297 NLYLLNKKASP--------GDDSHIESSEPSIPVRKVAITAPSPRIMSPRNSVADSDPSQ 348
           N+YLLN+  +         GD+S                       MSP  +        
Sbjct: 176 NIYLLNQTVNKQLQNGKMDGDNSG--------------------SAMSPLGAPPPPPHKD 215

Query: 349 TXXXXXXXXXXXXXXXXXXXSTDPYGISFEQNEAPGLPXXXXXXXXXXYKQGTQLATLVA 408
                                 DP  ISFEQ+EAPGLP          +++ TQLATLV+
Sbjct: 216 HLCDGVSCTNHLHVKPTSTSLNDPTAISFEQDEAPGLPAVKALKSMTTHQRSTQLATLVS 275

Query: 409 VSVPRTTEEILFVPQLLARIGQIHGFTSKQCIYTASVLASLKENNISS---IPPE----- 460
           +S+PR+TEEILF+PQLL RI QI GF SKQC+YT S+L+SLK N + +   + P      
Sbjct: 276 LSIPRSTEEILFIPQLLTRIRQIFGFNSKQCLYTVSLLSSLK-NRLPAPRLLAPSTSTKL 334

Query: 461 ---------------LEVLKNHNLWEIDDVLHFWKNV-FKLDFMTHT----AVDHSSTHL 500
                          ++  ++ NL E  D+  F  ++ F ++  +      A D     L
Sbjct: 335 KEKDEDKKLDDDSAFVKRFQSTNLSEFVDLKKFLISLKFNINSFSKQSEKPANDQDDELL 394

Query: 501 NFAEVEELMQLFFQDWYELIPLFDKNEFNSYYEKFKLNVTDPNFFVRKDDTVFNNRTRSI 560
           +  E++EL+ LFF+ W   +P+ + + F  Y+  F   V      +  ++   NN T+S 
Sbjct: 395 SLTEIKELLHLFFKFWSNQVPILNNDHFLIYFNNFVEVVK----HLSTENLETNNTTKST 450

Query: 561 ---SYKIFSCLLIIIVQMGMLSKIKRDKIT-------SGKLSTLMKYYDKLMTHIWINPY 610
              +++IF+  L++++QMG+L KIK +KI          K + LM YY +L   I  NPY
Sbjct: 451 VTTNHEIFALKLLMMLQMGLLVKIKMEKIKYTVPKNPKAKYARLMAYYHQLSLIIPKNPY 510

Query: 611 F-NSRNTSIQVLQCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLRLHRCPSAVLGGDGS 669
           F N   TS+  LQ LS+  FY LNVGDIS+IY +RG++VSM+QQLRLHRCPSAVL    +
Sbjct: 511 FLNMSTTSLPSLQLLSLASFYYLNVGDISAIYGVRGRIVSMAQQLRLHRCPSAVLSVHSN 570

Query: 670 TV-SKVQQGERRILFWSIYYLDVFSALQLGVPRLLKDFEIECALPVT--------SDDDR 720
            V  K +Q ERR+LFW+IYY+DVF++LQLGVPRLLKDF+IECALP++        S ++ 
Sbjct: 571 PVLQKFEQSERRLLFWAIYYVDVFASLQLGVPRLLKDFDIECALPISDVEYKDQLSMENE 630

Query: 721 QVNLAGQMIALEGKVSQFSLSVIRFAKVMGNILDSTFKRGMTTS-LTKQAALVHENALDN 779
           + +   + I L+G+VS FSL +IRFAK++GNILDS FKRGM    +T + ALVHENALDN
Sbjct: 631 KADKKAKKIQLQGQVSSFSLQIIRFAKILGNILDSIFKRGMMDERITSEVALVHENALDN 690

Query: 780 WRHGLQKDLFFQLDVNGTINMDEF---NQQKQYSKSLSPRTAAFTHNSLVLMTLYFMAKC 836
           WR+ L +  +FQ+ VNGT+N+DE    NQ+   +K        F     +L+  YF+AK 
Sbjct: 691 WRNQLPEMYYFQITVNGTVNLDEIRATNQRNTETKFDKKDIILFEKK--ILLLFYFLAKS 748

Query: 837 MIHLPVVATKPL------VAEAIQTPTDNQTENGS--------VD------RSLSSYXXX 876
           MIHLPV+ATKPL        +  Q+  +N ++  +        VD      R+ SSY   
Sbjct: 749 MIHLPVIATKPLPKNVDNATKKKQSMFNNDSKGATNQDHMILDVDMTSPAIRTSSSYIIL 808

Query: 877 XXXXXXXXXXXXXXXSIYLPLPINLARTKTRFGLFSARGSLEYTKGGALFQDNKALLLDL 936
                          S+YLPLP+N++RT  RF L  ARGSLEYTKGGALF DNK LLLD 
Sbjct: 809 QQATNATLTIFQAINSMYLPLPLNVSRTLIRFSLLCARGSLEYTKGGALFLDNKNLLLDT 868

Query: 937 VKELETDKKLELPGNTSWHSLKLFDLSINLILQPVNSNPEKTEKMIQKKINYYNKLMGQP 996
           +K++E D+ L+LPG  SWH+LKLFD+SINL+L+  N   E+ +K ++KK+NYYN+LMG P
Sbjct: 869 IKDIENDRLLDLPGIASWHTLKLFDMSINLLLKAPNVKVERLDKFLEKKLNYYNRLMGLP 928

>Smik_13.493 Chr13 complement(810035..814336) [4302 bp, 1433 aa]
           {ON} YMR280C (REAL)
          Length = 1433

 Score =  619 bits (1596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/889 (42%), Positives = 507/889 (57%), Gaps = 93/889 (10%)

Query: 177 YRVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGYXXXXXXXXXXX 236
           YR+AQACDRCR+KK RCDGKRPQC+QCAAVGFEC+ISDKL R+A+P+GY           
Sbjct: 64  YRIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYPKGYTESLEERVREL 123

Query: 237 XXXXXXXXXXCDLKEEQLHLVSKYSNSKDENGVEIPSTEEEQILHELSKTNGGSLRVSST 296
                     CD+KE+Q+ LVS+           + +T       EL       L +SST
Sbjct: 124 EAENKRLLALCDIKEQQISLVSQ-----SRPPTSMDNTANGSFKQELK---DAPLNLSST 175

Query: 297 NLYLLNKKASPGDDSHIESSEPSIPVRKVAITAPSPRIMSPRNSVADSDPSQTXXXXXXX 356
           N+YLLN+  +    +    S+ S  V      AP P     ++ V D             
Sbjct: 176 NIYLLNQTVNKQLQNGKMDSDNSNTVMNSLAAAPLP---PQKDHVCDG---------ISC 223

Query: 357 XXXXXXXXXXXXSTDPYGISFEQNEAPGLPXXXXXXXXXXYKQGTQLATLVAVSVPRTTE 416
                         DP  ISFEQ+EAPGLP          +++ TQLATLV++S+PR+TE
Sbjct: 224 TNHLHVKPTSTSLNDPTAISFEQDEAPGLPAVKALKLMTTHQRSTQLATLVSLSIPRSTE 283

Query: 417 EILFVPQLLARIGQIHGFTSKQCIYTASVLASLKENNISS---IPPE------------- 460
           EILF+PQLL RI QI GF SKQC+YT S+L+SLK N + +   +PP              
Sbjct: 284 EILFIPQLLTRIRQIFGFNSKQCLYTVSLLSSLK-NRLPAPRLLPPSTSTKLKEKGEDKI 342

Query: 461 -------LEVLKNHNLWEIDDVLHFWKNV-FKLDFMTHTAV----DHSSTHLNFAEVEEL 508
                   +  +  NL E  D+  F  ++ F +D  +  +     DH +  L+  E++EL
Sbjct: 343 LDDDSAFFKKFQTTNLSEFVDLKGFLVSLKFDIDSFSKQSENLPNDHDNELLSLTEIKEL 402

Query: 509 MQLFFQDWYELIPLFDKNEFNSYYEKFKLNVTDPNFFVRKDDTVFNNRTRSISYKIFSCL 568
           + LFF+ W   +P+ + + F  Y+  F   V D +    K + V N    + ++++F+  
Sbjct: 403 LHLFFKFWSNQVPILNNDHFLLYFNNFVEVVKDLSSANLKTN-VTNTSIVTTNHELFALK 461

Query: 569 LIIIVQMGMLSKIKRDKIT-------SGKLSTLMKYYDKLMTHIWINPYF-NSRNTSIQV 620
           L +++ MG+L KIK +KI        + K + LM YY +L   I  NPYF N   TS+  
Sbjct: 462 LSMMLLMGLLVKIKMEKIKYTVPKNPNSKYARLMAYYHQLSLIIPKNPYFLNMSTTSLPS 521

Query: 621 LQCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLRLHRCPSAVLGGDGSTV-SKVQQGER 679
           LQ LS+  FY LNVGDIS+IY +RG++VSM+QQLRLHRCPSAVL    + V  K +Q ER
Sbjct: 522 LQLLSLASFYYLNVGDISAIYGVRGRIVSMAQQLRLHRCPSAVLSVHSNPVLQKFEQSER 581

Query: 680 RILFWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDDDRQVNLAGQM---------IA 730
           R+LFW+IYY+DVF++LQLGVPRLLKDF+IECALP+ SD + +  L  +          I 
Sbjct: 582 RLLFWAIYYVDVFASLQLGVPRLLKDFDIECALPI-SDVEYKDQLFMENKKTNKKAKKIQ 640

Query: 731 LEGKVSQFSLSVIRFAKVMGNILDSTFKRGMTTS-LTKQAALVHENALDNWRHGLQKDLF 789
           L+G+VS FSL +IRFAK++GNILDS FKRGM    +T + ALVHENALDNWR  L K  +
Sbjct: 641 LQGQVSSFSLQIIRFAKILGNILDSIFKRGMMDERITSEVALVHENALDNWRSQLPKMYY 700

Query: 790 FQLDVNGTINMDEF--NQQKQYSKSLSPRTAAFTHNSLVLMTLYFMAKCMIHLPVVATKP 847
           FQ+ VNGT+N+DE   N  K        +        ++L+  YF+AK MIHLPV+ATKP
Sbjct: 701 FQITVNGTVNLDEIRVNDSKNIETRFEKKDIILFEKKILLL-FYFLAKSMIHLPVIATKP 759

Query: 848 LVAEAIQTPTDNQT-----ENGSVD---------------RSLSSYXXXXXXXXXXXXXX 887
           L           Q+       GS D               R+ SSY              
Sbjct: 760 LPKNIDNGTKKKQSVFSNDSKGSNDQDHMIVDVDMTSPAIRTSSSYIILQQATNATLMIF 819

Query: 888 XXXXSIYLPLPINLARTKTRFGLFSARGSLEYTKGGALFQDNKALLLDLVKELETDKKLE 947
                +Y+PLP+N++RT  RF L  ARGSLEYTKGGALF DNK LLLD +K++E D+ L+
Sbjct: 820 QTINWMYIPLPLNVSRTLIRFSLLCARGSLEYTKGGALFLDNKNLLLDTIKDIENDRLLD 879

Query: 948 LPGNTSWHSLKLFDLSINLILQPVNSNPEKTEKMIQKKINYYNKLMGQP 996
           LPG  SWH+LKL+D++INL+L+  N   E+ +K ++KK+NYYN+LMG P
Sbjct: 880 LPGTASWHTLKLYDMTINLLLKAPNVKVERLDKFLEKKLNYYNRLMGLP 928

>KAFR0B03950 Chr2 complement(823760..827500) [3741 bp, 1246 aa] {ON}
            Anc_8.845 YMR280C
          Length = 1246

 Score =  578 bits (1490), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/753 (45%), Positives = 471/753 (62%), Gaps = 62/753 (8%)

Query: 371  DPYGISFEQNEAPGLPXXXXXXXXXXYKQGTQLATLVAVSVPRTTEEILFVPQLLARIGQ 430
            DP  ISFEQ+EAPGL            ++ TQLA LV++SVPR+TEEILF+PQLLA+I Q
Sbjct: 265  DPTSISFEQSEAPGLVAAKALKSINNQEEATQLAILVSLSVPRSTEEILFIPQLLAKIRQ 324

Query: 431  IHGFTSKQCIYTASVLAS------------LKENNISSIPPELEVLKNHNLWEIDDVLHF 478
            +HGFTSKQC+YT S+L+S            L +N+ +S+     +LKN N+W+I+D+  F
Sbjct: 325  VHGFTSKQCLYTVSLLSSLKNSLPSPKSDFLMDNSQNSL-----LLKNTNIWQINDLNVF 379

Query: 479  WKNVFKLDFMTHTAVDHSSTHLNFAEVEELMQLFFQDWYELIPLFDKNEFNSYYEKFKLN 538
            + ++ K +    +    +ST L+F ++++L  L+F  W  LIP+ ++ EF + Y  FK+ 
Sbjct: 380  FTDLLKFNISNDSK---TSTLLSFDDIDDLTNLYFNHWSNLIPVLNEEEFFNRYNNFKIQ 436

Query: 539  VTDPNFFVRKDDTVFNNRTRSISYKIFSCLLIIIVQMGMLSKIKRDKITSGKLSTLMKYY 598
                  F++ + +   N  R   YK F C L+++ QMG+L K+K  K ++  L  ++ YY
Sbjct: 437  CQS---FIQGNQS---NNLRD--YKFFGCFLMVMCQMGLLIKLKEHK-SNNSLFKILTYY 487

Query: 599  DKLMTHIWINPYFNSRNTSIQVLQCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLRLHR 658
             +L   +  NP ++   TSI+ +Q L++LLFY LN+G+I  IYELRG ++SM+ QLRLHR
Sbjct: 488  HQLTYILPKNPVYDFATTSIKSVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRLHR 547

Query: 659  CPSAVLGGDGSTVSKVQQGERRILFWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDD 718
            CPSAVL G GST+ K++Q  RR+LFW+IYYLDVFS+LQLGVPRLLKD+EIECALPV +  
Sbjct: 548  CPSAVLTGSGSTMQKLEQSNRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPVDNTT 607

Query: 719  DRQVNLAGQMIALEGKVSQFSLSVIRFAKVMGNILDSTFKRGMTTSLTKQAALVHENALD 778
                 + G  I LEG VSQ SL++ RFAKV+GNI+DS FKR M+TS+++Q AL+HENALD
Sbjct: 608  TMDA-IDGTSIKLEGTVSQISLTLFRFAKVLGNIVDSIFKRNMSTSISRQVALIHENALD 666

Query: 779  NWRHGLQKDLFFQLDVNGTINMDEFNQQKQYSKSLSPRTAAFTHNSLVLMTLYFMAKCMI 838
            NWR  L +   F+LDVNGTIN+++ + +                +++ L+  YF+AKCMI
Sbjct: 667  NWRSRLPEQFQFKLDVNGTINLNDLDTENS--------------DTIFLIVFYFLAKCMI 712

Query: 839  HLPVVATKPLVAEAIQTPTDNQTENGSVDRSLSSYXXXXXXXXXXXXXXXXXXSIYLPLP 898
            HLPV +TK  + + +    ++   N   DR  +SY                    YLP+P
Sbjct: 713  HLPVCSTKVDLEDKVTETGNDVIYN---DRFSTSYVSLQQSTNTMLNALRMIRDKYLPMP 769

Query: 899  INLARTKTRFGLFSARGSLEYTKGGALFQDNKALLLDLVKELETDKKLELPGNTSWHSLK 958
             N++RT TRF L SA+GSL+Y KGG+LF DNK LLLD V+++E ++KL+LPG  SWHSLK
Sbjct: 770  FNVSRTLTRFTLISAKGSLDYIKGGSLFIDNKKLLLDCVQDIEANRKLDLPGIISWHSLK 829

Query: 959  LFDLSINLILQPVNSNPEKTEKMIQKKINYYNKLMGQPTVA----VKRKRDPKATEN--- 1011
            L DL++NL LQ  N+ PEK EK++QKK+NYYNKLMG+P V      KR    K   N   
Sbjct: 830  LLDLTLNLFLQNSNTKPEKIEKLLQKKLNYYNKLMGKPLVKNLPIQKRTNQNKGNNNDEP 889

Query: 1012 TSKKVKVEDDHSQDNLHNI-TTGETTDTVHSEELVKDVPKELN---VYPENYTTIEEAFQ 1067
            + KKVK E ++  ++LH I    E      +  L+       N   V  +N     EA Q
Sbjct: 890  SRKKVKKELENDINSLHPILIDNEGVTPSDAAPLINKTNSNTNNPVVTTQN--EFAEALQ 947

Query: 1068 MDPVLNTNL--FSNTDLKTLFNSGIFENAGSIH 1098
            +DP+LN++   FSN DL TLFNS       S H
Sbjct: 948  VDPILNSDYYQFSNLDLATLFNSDKLNKINSHH 980

 Score =  132 bits (332), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 86/144 (59%), Gaps = 17/144 (11%)

Query: 177 YRVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGYXXXXXXXXXXX 236
           YRV QACDRCR+KK RCDG++PQC+QCAAVGFECK+SDKL R+A+PRGY           
Sbjct: 26  YRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTESIEERVREL 85

Query: 237 XXXXXXXXXXCDLKEEQLHLVSKYSNSK------DENGVEIPSTEE--EQILHELSKT-- 286
                     CDLKE+Q+ LV+KYS++K      D   +E+ S  +    I  EL+K   
Sbjct: 86  EAENRRLLALCDLKEQQISLVAKYSSNKSNILPTDRCIIELNSDSDCTNNIKGELNKDRQ 145

Query: 287 -------NGGSLRVSSTNLYLLNK 303
                  N   L +S TNLYLLN+
Sbjct: 146 NDVTTIPNSLPLNISQTNLYLLNQ 169

>NCAS0C00390 Chr3 (57333..60827) [3495 bp, 1164 aa] {ON} Anc_8.845
          Length = 1164

 Score =  568 bits (1463), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 304/641 (47%), Positives = 409/641 (63%), Gaps = 56/641 (8%)

Query: 375 ISFEQNEAPGLPXXXXXXXXXXYKQGTQLATLVAVSVPRTTEEILFVPQLLARIGQIHGF 434
           ISFEQNEAPGL           ++Q TQLATLVA+++PR+T+EILF+PQLL++I Q  GF
Sbjct: 216 ISFEQNEAPGLSAVKALKSMANHEQSTQLATLVALAIPRSTDEILFIPQLLSKIRQNFGF 275

Query: 435 TSKQCIYTASVLASLK---------ENNISSIPPELEVLKNHNLWEIDDVLHFWKNVFKL 485
           TSK C+YT S+L+SLK          NN+      L  LK  NLW+ DD+  F     KL
Sbjct: 276 TSKHCLYTVSLLSSLKPNLPPPKMIANNLEMTKKLLNQLKITNLWKFDDLSQFINQYLKL 335

Query: 486 DFMTHTAVDHSSTHLNFAEVEELMQLFFQDWYELIPLFDKNEFNSYYEKFKLNVTDPNFF 545
           D +      +S+  LN  E++EL+  FFQDW ++IP+ +K EF S Y  FKL++ +    
Sbjct: 336 DPLNQ---KNSNDLLNQIEMDELINFFFQDWNDIIPIINKEEFLSNYNAFKLDLKN---- 388

Query: 546 VRKDDTVFNNRTRSISYKIFSCLLIIIVQMGMLSKIKRDKITSGK------LSTLMKYYD 599
             + D + +N    ++YKIF C+L+++ QMG+L+KIK    T+GK      L ++M YY 
Sbjct: 389 -SERDKLSSNL--KMNYKIFGCILVLMCQMGLLTKIKA---TNGKSSPNIHLKSIMAYYH 442

Query: 600 KLMTHIWINPYFNSRNTSIQVLQCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLRLHRC 659
           +L+ ++ IN +F     SI  L+   ++LFY LNVGDIS+IYELRG+++SMSQQLRLHRC
Sbjct: 443 QLIANLPINNFFQIATISIPQLKLYVLILFYNLNVGDISAIYELRGRIISMSQQLRLHRC 502

Query: 660 PSAVLGGDGSTVSKVQQGERRILFWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDDD 719
           PSAVL G   T++K+ Q  RRILFW+IY LD  S+LQLGVPRLLKD+EIECALP+T +D 
Sbjct: 503 PSAVLSGSSLTMNKLDQSNRRILFWTIYSLDALSSLQLGVPRLLKDYEIECALPITMEDK 562

Query: 720 RQVNLAGQMIALEGKVSQFSLSVIRFAKVMGNILDSTFKRGMTTSLTKQAALVHENALDN 779
            +       I LEG VS FSL++ RF+K++GNILD  FKR MT S+TK  +L+HENALD 
Sbjct: 563 ER---DKTKIKLEGTVSPFSLAIFRFSKILGNILDMIFKRNMTESMTKSVSLIHENALDQ 619

Query: 780 WRHGLQKDLFFQLDVNGTINMDEFNQQKQYSKSLSPRTAAFTHNSLVLMTLYFMAKCMIH 839
           WR+ L +DL F+L++ G+I+++  +Q            +     +L+LM  YF A  MIH
Sbjct: 620 WRYDLPEDLTFKLNIQGSIDLNVMHQG----------NSTPGKKNLILMFFYFFAVSMIH 669

Query: 840 LPVVATKPLVAEAIQTPTDNQTENGSVDRSLSSYXXXXXXXXXXXXXXXXX----XSIYL 895
           LPVVA +PL             +N   DRS SSY                      + YL
Sbjct: 670 LPVVAARPL-----------DVKNAMPDRSSSSYIALQHAINTMLNVLELLNNQPKNYYL 718

Query: 896 PLPINLARTKTRFGLFSARGSLEYTKGGALFQDNKALLLDLVKELETDKKLELPGNTSWH 955
           P+PIN++R + R  L S+RG L+Y KGGALF DNK LLL ++K LE D+ L+LPG  SWH
Sbjct: 719 PVPINMSRLQIRSALISSRGMLDYIKGGALFLDNKTLLLQVIKNLERDRTLDLPGVVSWH 778

Query: 956 SLKLFDLSINLILQPVNSNPEKTEKMIQKKINYYNKLMGQP 996
           SLKLFDL+I L +Q  N   EK +K+++KK NYYNKLMG+P
Sbjct: 779 SLKLFDLTITLFIQNSNIKLEKLDKILEKKSNYYNKLMGKP 819

 Score =  107 bits (266), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 45/48 (93%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           R+AQACDRCR+KK RCDGKRPQC+QCA VGFECKISDKL R++FPRGY
Sbjct: 76  RIAQACDRCRSKKTRCDGKRPQCSQCAIVGFECKISDKLQRKSFPRGY 123

>KNAG0J00250 Chr10 (33322..37035) [3714 bp, 1237 aa] {ON} Anc_8.845
            YMR280C
          Length = 1237

 Score =  563 bits (1450), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 322/746 (43%), Positives = 450/746 (60%), Gaps = 73/746 (9%)

Query: 371  DPYGISFEQNEAPGLPXXXXXXXXXXYKQGTQLATLVAVSVPRTTEEILFVPQLLARIGQ 430
            DP  +SFEQNEAPGL           ++Q TQLA LV++S+PR+TEEILF+PQLLA+I Q
Sbjct: 302  DPTSVSFEQNEAPGLMAARAIDQISNHEQSTQLAILVSLSIPRSTEEILFIPQLLAKIRQ 361

Query: 431  IHGFTSKQCIYTASVLASLKENNISSIPP---------------ELEVLKNHNLWEIDDV 475
            + GFTSKQC+YT S+L+SLK++    +PP                 ++L + NLW ++++
Sbjct: 362  VFGFTSKQCLYTVSLLSSLKDD----LPPPNLLKNSKMILQNSSNFDILTSVNLWHLENL 417

Query: 476  LHFWKNVFKLDFMTHTAVDH---SSTHLNFAEVEELMQLFFQDWYELIPLFDKNEFNSYY 532
             +F++NV KL+ +     DH   +  HL  +E++EL+ L+F+ W + IP+F++ EFNS Y
Sbjct: 418  SNFFQNVLKLNILPDDD-DHLKKNDDHLALSEIDELVALYFKYWSDSIPIFNEKEFNSNY 476

Query: 533  EKFKLNVTDPNFFVRKDDTVFNNRTRSISYKIFSCLLIIIVQMGMLSKIKRDKITSGKLS 592
              FK ++       +   +   N    ++ KIF CLL +I QMG+L K K  K  S K  
Sbjct: 477  RVFKADLMK---LSKNGPSSLEN---ILNIKIFGCLLTVICQMGILIKYKNFKNKSPKFE 530

Query: 593  TLMKYYDKLMTHIWINPYFNSRNTSIQVLQCLSMLLFYMLNVGDISSIYELRGKVVSMSQ 652
             L+ YY  LM  +  N YF    TSI+ +Q LS++LFY LN GDI  IY+LRG ++SM+Q
Sbjct: 531  KLLSYYHHLMYVLPKNSYFGVITTSIKTVQILSLILFYHLNTGDIIQIYDLRGMIISMAQ 590

Query: 653  QLRLHRCPSAVLGGDGSTVSKVQQGERRILFWSIYYLDVFSALQLGVPRLLKDFEIECAL 712
            QLRLHRCPSAVL G GS + +++QG RR LFW IYYLDVF +LQLGVPRL+KD EIECAL
Sbjct: 591  QLRLHRCPSAVLTGSGSKMDRLEQGNRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECAL 650

Query: 713  PVTSDDDRQVNLAGQMIALEGKVSQFSLSVIRFAKVMGNILDSTFKRGMTTSLTKQAALV 772
            P++S+      + G  + LEG +S+FSLSV+R AKV+GNILDS FKR M+ S+T+Q   +
Sbjct: 651  PLSSEIHNTDKMDG--VQLEGTMSEFSLSVVRCAKVLGNILDSIFKRNMSESITEQVYTI 708

Query: 773  HENALDNWRHGLQKDLFFQLDVNGTINMDEFNQQKQYSKSLSPRTAAFTHNSLVLMTLYF 832
            HENALD+WR  L K   F+L+ NG ++++  N                 H +L+L+ L+F
Sbjct: 709  HENALDSWRTKLPKKYQFKLNANGMVDLEHLN-----------------HENLILVLLFF 751

Query: 833  MAKCMIHLPVVATKPLVAEAIQTPTDNQTENGSVDRSLSSYXXXXXXXXXXXXXXXXXXS 892
            + K MI++P+ +    + E    P   + +N        S+                  +
Sbjct: 752  LVKSMIYMPLSSA---ITELANNP---KVKNDYYMNHKVSHTSLQQSINALLSVFKNINN 805

Query: 893  IYLPLPINLARTKTRFGLFSARGSLEYTKGGALFQDNKALLLDLVKELETDKKLELPGNT 952
             YLPLP+N +RT TRF L SA+GSLEY KGG LF+DNK LLL +++E+E D+KLELPG  
Sbjct: 806  QYLPLPLNSSRTMTRFALVSAKGSLEYKKGGLLFEDNKVLLLSVIQEIEKDRKLELPGII 865

Query: 953  SWHSLKLFDLSINLILQPVNSNPEKTEKMIQKKINYYNKLMGQPTVA------VKRKRDP 1006
             WHSLKL DL++NL L     N +K EK +QKKINYYNK+MG+P +        KRK+  
Sbjct: 866  PWHSLKLLDLAVNLFLLGPTINSDKLEKFLQKKINYYNKIMGKPLITSLPSSKTKRKQSK 925

Query: 1007 K--ATENTSKKVKVEDDHSQDNLHNITTGETTDTVHSEELVKDVPKELNVYPENYTTIEE 1064
            +   T N  +K +V+ +        ++T E        +L+K    + N      +   E
Sbjct: 926  EDLFTANKKRKQQVKTE--------LSTLEVKREPQQVQLLKR-EGQGNTTESTQSAFVE 976

Query: 1065 AFQMDPVLNTNL--FSNTDLKTLFNS 1088
            A Q+DP+LN N+  FS TDL   F S
Sbjct: 977  ALQLDPILNANIYNFSGTDLSNFFIS 1002

 Score = 98.6 bits (244), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 42/77 (54%), Positives = 50/77 (64%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGYXXXXXXXXXXXX 237
           R +QACDRCR KKI+CD KRPQC+ CA+VGFECK+SDKL+R +FPRGY            
Sbjct: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYTESLEERIRELE 230

Query: 238 XXXXXXXXXCDLKEEQL 254
                     DLKE+QL
Sbjct: 231 SENRRLLAMNDLKEQQL 247

>NDAI0K00390 Chr11 (84641..89128) [4488 bp, 1495 aa] {ON} Anc_8.845
          Length = 1495

 Score =  538 bits (1387), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 326/836 (38%), Positives = 458/836 (54%), Gaps = 140/836 (16%)

Query: 374  GISFEQNEAPGLPXXXXXXXXXXYKQGTQLATLVAVSVPRTTEEILFVPQLLARIGQIHG 433
             ISFEQNEAPGL            ++ TQLATLV++++PR+TEEILF+PQ+LA++ Q  G
Sbjct: 304  SISFEQNEAPGLSTVKALKSMVNDEKNTQLATLVSLAIPRSTEEILFIPQILAKVRQNFG 363

Query: 434  FTSKQCIYTASVLASLK------ENNISSIPPE---LEVLKNHNLWEIDDVLHFWKNVFK 484
            FTSK C+YT S+L+SLK       N+IS+   +   LE LKN NLW+ + +  F+    K
Sbjct: 364  FTSKHCLYTVSLLSSLKSFLSNSNNSISAASADNKNLETLKNTNLWKFNALFQFFTAFLK 423

Query: 485  LDFM--------------------THTAVDHSSTHLNFAEVEELMQLFFQDWYELIPLFD 524
            LDF+                     ++A     + L+ +E++EL++LFFQ+W + + + +
Sbjct: 424  LDFLDSSLEKQNKGKKNGKVNNNNNNSANQDGISPLSSSEIDELLKLFFQNWSDFVLMIN 483

Query: 525  KNEFNSYYEKFKLNVTDPNFFVRKDDTVFNNRTRSISYKIFSCLLIIIVQMGMLSKIK-- 582
            + EF  YY  FK ++ + N       T+ N       YKIF  ++++  QMG+LSKIK  
Sbjct: 484  EKEFYQYYSVFKSDLQNNNISKMSLSTLMN-------YKIFGLIILLFCQMGLLSKIKLS 536

Query: 583  ------RDKITSGKLSTLMKYYDKLMTHIWINPYFNSRNTSIQVLQCLSMLLFYMLNVGD 636
                  ++      L  +M YY  L+  +  N +F   N ++Q L+ LS++LFY L++G+
Sbjct: 537  SNNTKSKNFKQQYHLKKVMNYYHNLINKLMWNEFFKISNVTLQSLKLLSLILFYNLHMGN 596

Query: 637  ISSIYELRGKVVSMSQQLRLHRCPSAVLGGDGSTVSKVQQGERRILFWSIYYLDVFSALQ 696
            IS+IYELR KV+SMSQQLRLHRCPSAVL G    + K++Q  RR+LFW+IYYLD+F++LQ
Sbjct: 597  ISNIYELRSKVISMSQQLRLHRCPSAVLCGSTLKIHKLEQSNRRLLFWNIYYLDIFASLQ 656

Query: 697  LGVPRLLKDFEIECALPVTSDDDRQVNLAGQM------------IALEGKVSQFSLSVIR 744
            LGVPRLLKD EIECALP+  D D + +   Q             I LEG VS  SL +IR
Sbjct: 657  LGVPRLLKDHEIECALPIPMDTDSKSDNQSQRSAATNAENDDNKIKLEGCVSHLSLVIIR 716

Query: 745  FAKVMGNILDSTFKRGMTTSLTKQAALVHENALDNWRHGLQKDLFFQLDVNGTINMDEFN 804
            +++++GNILD  FKR MT S+TK  AL+H +ALD+WR+ L  +L F L+VNG+I++  F 
Sbjct: 717  YSQIVGNILDMIFKRNMTESMTKSIALIHIHALDDWRNTLPSNLKFDLNVNGSIDLSSFI 776

Query: 805  QQKQYSKSLSPRTAAFTHNSLVLMTLYFMAKCMIHLPVVATKPLVAEAIQTPTDNQTENG 864
             Q    ++L+          L+++ LYF    MIH+PVVA++PL         +N + N 
Sbjct: 777  DQ----QNLNEEEQRTQQQKLLVIFLYFFGVNMIHMPVVASRPLPL------VENDSLNQ 826

Query: 865  SVDRSLSSYXXXXXXXXXXXXXXXXXXSIYLPLPINLARTKTRFGLFSARGSLEYTKGGA 924
              DRS SSY                    Y+PLPIN++RT  RF + SA G L++ KGG+
Sbjct: 827  IPDRSSSSYIALQHATNTMLNVLDLLSPTYVPLPINMSRTMVRFSMISACGMLDFIKGGS 886

Query: 925  LFQDNKALLLDLVKELETDKKLELPGNTSWHSLKLFDLSINLILQPVNSNPEKTEKMIQK 984
            LF +NKALL  +VK +ETD+ L+LPG  SWHSLKLFDL++ L  Q  N   EK +K+++K
Sbjct: 887  LFLENKALLAQVVKNIETDRFLDLPGVISWHSLKLFDLTLTLFFQNTNIKLEKLDKLLEK 946

Query: 985  KINYYNKLMGQPTV-------------------------AVKRKRDPKATEN-------- 1011
            K NYYN+LMG+P V                         A K+K+D   TEN        
Sbjct: 947  KSNYYNRLMGKPIVRNPAEKNSTTVPASMSAVDETDLPRADKKKKDIVDTENEYVSSVPD 1006

Query: 1012 --------------TSKKVKVEDDHSQDNLHNITTGETTDTVHSEELVKDVPKELNVYPE 1057
                          TS K  V+D      L  I    T      +E +  V K+     +
Sbjct: 1007 TNNIVVKQTPEEWDTSTKTNVKDSTLAHKLTTIELPSTDKKKRKQEQISPVNKKAKKAEQ 1066

Query: 1058 ---------------------NYTTIE----EAFQMDPVLNTNL--FSNTDLKTLF 1086
                                 NY  I+    +A Q DP+LN+N   FSN DL +LF
Sbjct: 1067 EVSQTQVGVPRSSTSSTAQNSNYANIQNQFADALQFDPILNSNSFNFSNLDLSSLF 1122

 Score =  104 bits (259), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 45/48 (93%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           R++QACDRCR+KK RCDGKRPQC+QCA VGFECK+SDKL R+++PRGY
Sbjct: 103 RISQACDRCRSKKTRCDGKRPQCSQCAIVGFECKVSDKLQRKSYPRGY 150

>CAGL0M03025g Chr13 complement(341849..345613) [3765 bp, 1254 aa] {ON}
            similar to uniprot|P39113 Saccharomyces cerevisiae
            YMR280c CAT8 transcription factor involved in
            gluconeogenesis
          Length = 1254

 Score =  492 bits (1267), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 302/767 (39%), Positives = 444/767 (57%), Gaps = 90/767 (11%)

Query: 375  ISFEQNEAPGLPXXXXXXXXXXYKQGTQLATLVAVSVPRTTEEILFVPQLLARIGQIHGF 434
            +SFEQN APGLP           ++  QLA LV++++PR+TEEILF+PQL+A I +  GF
Sbjct: 201  VSFEQNVAPGLPAVKALNSMAEREESAQLAMLVSLALPRSTEEILFIPQLMANIQKTFGF 260

Query: 435  TSKQCIYTASVLASLKEN----NISSIPPELEVLKNHNLWEIDDVLHFWKNVFKLDFMTH 490
            +SKQ +YT S+L+SLK+N    N +S    L    + N +  +D   F+  V K D +  
Sbjct: 261  SSKQSLYTVSLLSSLKKNLPTPNSNSSDENL----SPNYYVSEDFRPFFYEVLKFDILGE 316

Query: 491  TAVDHSSTH----------------LNFAEVEELMQLFFQDWYELIPLFDKNEFNSYYEK 534
            T  ++ S                  L++ E++ L+ ++F+ W   IP+F +  F    + 
Sbjct: 317  TETENGSNRNESPDSTIPNSRSDDLLSWMEIQRLVDVYFECWSNTIPIFSRKLFIKQMKA 376

Query: 535  FKLNVTDPNFFVRKDDTVFNNRTRSISY-KIFSCLLIIIVQMGMLSKIKRDKITSGKLST 593
            FK   T+ + F  +   V+      I++ KIF+ +L ++ QM +LS++K+ + T+ +L  
Sbjct: 377  FK---TEVDKFGDRLFEVYKTEQIKINFLKIFATVLAVMCQMALLSRLKQLEATTQELEC 433

Query: 594  -----LMKYYDKLMTHIWINPYFNSRNTS-IQVLQCLSMLLFYMLNVGDISSIYELRGKV 647
                 L+ +Y++L+  I ++ +F   +T+ +Q LQ LS + FY LNVGDI  +Y+LRG V
Sbjct: 434  KRTQNLIAHYNQLIEKIHLDSFFQDMSTTTVQSLQLLSFISFYFLNVGDIPRLYQLRGTV 493

Query: 648  VSMSQQLRLHRCPSAVL-GGDGSTVSKVQQGERRILFWSIYYLDVFSALQLGVPRLLKDF 706
            +SM+QQLRLHRCPSAVL    GST+ K +QGERR+LFW+IYYLDVF +LQLGVPRL+KD 
Sbjct: 494  ISMAQQLRLHRCPSAVLLSASGSTMQKFEQGERRLLFWAIYYLDVFYSLQLGVPRLIKDH 553

Query: 707  EIECALPVTSDDDRQVNLAGQMIALEGKVSQFSLSVIRFAKVMGNILDSTFKRGMTT-SL 765
            EIECALPV+ ++D Q         LEG+VS FSL+VIR+AKV+GNILDS FKR M + + 
Sbjct: 554  EIECALPVSEEEDSQ---------LEGRVSDFSLAVIRYAKVLGNILDSIFKRNMMSEAA 604

Query: 766  TKQAALVHENALDNWRHGLQKDLFFQLDVNGTINMDEFNQQKQYSKSLSPRTAAFTHNSL 825
            T+  A VHE ALD W++ L +   F+L+ NG  N DE    K   K L  +++       
Sbjct: 605  TESMAFVHEKALDIWKNRLPEKYGFRLEANGLFNFDELTVVKNSEKDLIEKSS------- 657

Query: 826  VLMTLYFMAKCMIHLPVVATKPLVAEAIQTP--------TDNQTENGSVDRSLSSYXXXX 877
             ++  YF+AKCMIHLPV+AT+    E    P        T  +++N +  R   SY    
Sbjct: 658  -ILLFYFLAKCMIHLPVIATRSASLEQQLQPGTSSDTSETPKESQNKTPTRVCPSYILMQ 716

Query: 878  XXXXXXXXXXXXXXSIYLPLPINLARTKTRFGLFSARGSLEYTKGGALFQDNKALLLDLV 937
                            YLP PIN++RTK RF L +A  ++EY KGG+L+ + K LL +L+
Sbjct: 717  KAASTMLQVMHYTSEYYLPSPINISRTKARFALLTACSAVEYLKGGSLYVETKNLLENLI 776

Query: 938  KELETDKKLELPGNTSWHSLKLFDLSINLILQPVNSNPEKTEKMIQKKINYYNKLMGQPT 997
             +LE ++KL+LPG  SWHSLKL D+++ L+LQ   +  EK +K++QKKIN+YN+ MG P 
Sbjct: 777  IKLELERKLDLPGIISWHSLKLLDMALMLLLQSPTTKMEKLDKLVQKKINHYNRQMGIPA 836

Query: 998  VAVKRKRDPKATENTSKKVKVEDDHSQ--DNLHNITTGE-TTDTVHSEELVKDVPKELNV 1054
            + +   R        +KK+K+E++ SQ     + I  GE  +D+V  EE       + NV
Sbjct: 837  MKLSNSR------KNNKKIKLENESSQLSSTSNPIAKGELKSDSVVCEE-------DDNV 883

Query: 1055 YPENYTTIEEAFQMDPVLNTNL-------------FSNTDLKTLFNS 1088
                 TT  +  + +  +N N              FS+TDL  LFN+
Sbjct: 884  NDNEVTTTAKLEENNEFINPNKIEQGVTSNTLAFSFSSTDLSALFNA 930

 Score =  102 bits (254), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 39/49 (79%), Positives = 45/49 (91%)

Query: 177 YRVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           YRVAQACDRCR KK +CDGK PQC+QCA VGFECKISD+L+R++FPRGY
Sbjct: 54  YRVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102

>Kpol_1016.20 s1016 (51828..55088) [3261 bp, 1086 aa] {ON}
           (51828..55088) [3261 nt, 1087 aa]
          Length = 1086

 Score = 92.0 bits (227), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 33/48 (68%), Positives = 39/48 (81%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           R++QACDRCR KKI+CDG +P C+QC  V F CK SDKL+RR FPRGY
Sbjct: 93  RLSQACDRCRLKKIKCDGLKPNCSQCLKVNFICKTSDKLTRRGFPRGY 140

>AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL089W (SIP4)
          Length = 852

 Score = 90.1 bits (222), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 33/48 (68%), Positives = 39/48 (81%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           R +QACDRCR KKI+CDG RP CT C  +G++CK SDKL+RR FPRGY
Sbjct: 24  RSSQACDRCRLKKIKCDGLRPSCTSCKKIGYQCKTSDKLTRRGFPRGY 71

>Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}
           similar to Ashbya gossypii AFR096W
          Length = 952

 Score = 87.8 bits (216), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 32/48 (66%), Positives = 39/48 (81%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           R +QACDRCR KKI+CDG RP CT C  +G++C+ SDKL+RR FPRGY
Sbjct: 25  RSSQACDRCRLKKIKCDGVRPSCTSCKKIGYQCRTSDKLTRRGFPRGY 72

>TPHA0I02820 Chr9 complement(620925..624059) [3135 bp, 1044 aa] {ON}
           Anc_1.277 YJL089W
          Length = 1044

 Score = 87.8 bits (216), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 30/48 (62%), Positives = 39/48 (81%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           R++QACDRCR KKI+CDG +P CT C+ + F CK SD+L+RR FP+GY
Sbjct: 79  RLSQACDRCRLKKIKCDGLKPSCTHCSKIKFACKTSDRLTRRGFPKGY 126

>KLTH0D03564g Chr4 (343546..346134) [2589 bp, 862 aa] {ON} weakly
           similar to uniprot|P46954 Saccharomyces cerevisiae
           YJL089W SIP4 Possibly involved in Snf1p regulated
           transcriptional activation shows homology to DNA binding
           domain of Gal4p has a leucine zipper motif and acidic
           region lexA-Sip4p activates transcription
          Length = 862

 Score = 87.4 bits (215), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 33/48 (68%), Positives = 39/48 (81%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           R++QACDRCR KKI+CDG +P CT C  +GF C+ SDKLSRR FPRGY
Sbjct: 24  RMSQACDRCRLKKIKCDGIKPTCTPCTKIGFHCQTSDKLSRRGFPRGY 71

>KAFR0A01480 Chr1 (294040..296217) [2178 bp, 725 aa] {ON} Anc_1.277
           YJL089W
          Length = 725

 Score = 87.0 bits (214), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 39/49 (79%)

Query: 177 YRVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           +RV+QACDRCR KKI+CDG++P+C+ C  + F C IS KLSRR  P+GY
Sbjct: 10  FRVSQACDRCRLKKIKCDGQKPRCSNCKKINFNCAISTKLSRRGLPKGY 58

>SAKL0D05654g Chr4 (457485..460244) [2760 bp, 919 aa] {ON} weakly
           similar to uniprot|P46954 Saccharomyces cerevisiae
           YJL089W SIP4 Possibly involved in Snf1p regulated
           transcriptional activation shows homology to DNA binding
           domain of Gal4p has a leucine zipper motif and acidic
           region lexA-Sip4p activates transcription
          Length = 919

 Score = 87.4 bits (215), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 33/48 (68%), Positives = 38/48 (79%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           R +QACDRCR KKI+CDG +P CT C  VGF C+ SDKL+RR FPRGY
Sbjct: 24  RSSQACDRCRLKKIKCDGLKPNCTSCKKVGFHCQTSDKLTRRGFPRGY 71

>ZYRO0G15136g Chr7 complement(1218989..1222072) [3084 bp, 1027 aa]
           {ON} weakly similar to uniprot|P46954 Saccharomyces
           cerevisiae YJL089W SIP4 Possibly involved in Snf1p
           regulated transcriptional activation shows homology to
           DNA binding domain of Gal4p has a leucine zipper motif
           and acidic region lexA-Sip4p activates transcription
          Length = 1027

 Score = 86.3 bits (212), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 31/48 (64%), Positives = 38/48 (79%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           R +QACDRCR KKI+CDG +P C+QC  V F C+ SD+L+RR FPRGY
Sbjct: 33  RQSQACDRCRLKKIKCDGMKPTCSQCTKVNFTCRTSDRLTRRGFPRGY 80

>KLLA0F14322g Chr6 (1328925..1331078) [2154 bp, 717 aa] {ON}
           uniprot|Q7Z8R2 Kluyveromyces lactis Sip4 protein
          Length = 717

 Score = 85.1 bits (209), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 30/48 (62%), Positives = 37/48 (77%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           R +QACDRCR KKI+CDG +P C+ C  +G+ C  SDKL+RR FPRGY
Sbjct: 58  RFSQACDRCRLKKIKCDGIKPSCSNCKKIGYHCSTSDKLTRRGFPRGY 105

>Smik_10.153 Chr10 (257677..260166) [2490 bp, 829 aa] {ON} YJL089W
           (REAL)
          Length = 829

 Score = 85.1 bits (209), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 31/48 (64%), Positives = 35/48 (72%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           R A ACDRCR KKIRCDG +P C+ C  + F CK SDKLSRR  P+GY
Sbjct: 41  RKAHACDRCRLKKIRCDGLKPNCSNCTKINFPCKTSDKLSRRGLPKGY 88

>YJL089W Chr10 (265926..268415) [2490 bp, 829 aa] {ON}  SIP4C6 zinc
           cluster transcriptional activator that binds to the
           carbon source-responsive element (CSRE) of gluconeogenic
           genes; involved in the positive regulation of
           gluconeogenesis; regulated by Snf1p protein kinase;
           localized to the nucleus
          Length = 829

 Score = 84.3 bits (207), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 31/48 (64%), Positives = 36/48 (75%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           R A ACDRCR KKI+CDG +P C+ CA + F CK SDKLSRR  P+GY
Sbjct: 41  RKAHACDRCRLKKIKCDGLKPNCSNCAKIDFPCKTSDKLSRRGLPKGY 88

>Kwal_26.7397 s26 complement(342483..343085) [603 bp, 201 aa] {OFF}
           YJL089W (SIP4) - shows homology to DNA binding domain of
           Gal4p, has a leucine zipper motif and acidic region;
           lexA-Sip4p activates transcription [contig 304] PARTIAL
          Length = 201

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 31/48 (64%), Positives = 38/48 (79%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           R++QACDRCR KKI+CDG +P C  C+ + F C+ SDKLSRR FPRGY
Sbjct: 24  RMSQACDRCRLKKIKCDGVKPTCGPCSKIKFHCQTSDKLSRRGFPRGY 71

>Skud_10.125 Chr10 (233921..236422) [2502 bp, 833 aa] {ON} YJL089W
           (REAL)
          Length = 833

 Score = 83.6 bits (205), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 30/48 (62%), Positives = 36/48 (75%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           R A ACDRCR KKI+CDG +P C+ C+ + F CK SDKLSRR  P+GY
Sbjct: 41  RKAHACDRCRLKKIKCDGLKPNCSNCSKIDFPCKTSDKLSRRGLPKGY 88

>Suva_6.161 Chr6
           complement(283370..284500,284547..284764,284948..285781,
           285812..286127) [2499 bp, 832 aa] {ON} YJL089W (REAL)
          Length = 832

 Score = 83.2 bits (204), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 30/48 (62%), Positives = 35/48 (72%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           R A ACDRCR KKI+CDG +P C+ C  + F CK SDKLSRR  P+GY
Sbjct: 41  RKAHACDRCRLKKIKCDGLKPNCSNCGKIDFPCKTSDKLSRRGLPKGY 88

>KNAG0B01840 Chr2 (345204..348422) [3219 bp, 1072 aa] {ON} Anc_1.277
           YJL089W
          Length = 1072

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 36/49 (73%)

Query: 177 YRVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           +R  QACDRCR KKI+CDG +P CT CA + F CK S KLSRR  P+GY
Sbjct: 22  FRKNQACDRCRLKKIKCDGLKPTCTNCAKINFLCKTSHKLSRRGLPKGY 70

>TDEL0D01450 Chr4 (284869..287706) [2838 bp, 945 aa] {ON} Anc_1.277
           YJL089W
          Length = 945

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 36/48 (75%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           R + ACDRCR KK+RCDG +P C+QC+   F C  SDKL+RR FP+GY
Sbjct: 54  RHSHACDRCRLKKVRCDGLKPSCSQCSRANFRCTTSDKLTRRGFPKGY 101

>NDAI0G05530 Chr7 (1360413..1363973) [3561 bp, 1186 aa] {ON} 
          Length = 1186

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 35/48 (72%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           R  QACDRCR KKI+CD  +P C+QC    F+CK +DKL+RR F RGY
Sbjct: 117 RKIQACDRCRLKKIKCDDLKPSCSQCLKADFQCKTTDKLARRGFSRGY 164

>CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]
           {ON} some similarities with uniprot|P46954 Saccharomyces
           cerevisiae YJL089w SIP4 interacts with SNF1 protein
           kinase
          Length = 1209

 Score = 79.3 bits (194), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 30/48 (62%), Positives = 38/48 (79%), Gaps = 1/48 (2%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           R +QACDRCR+KKI+CDG +P C+ CA +G+ C  SDKLSRR  P+GY
Sbjct: 24  RHSQACDRCRSKKIKCDGLQP-CSNCAKIGYNCVTSDKLSRRGLPKGY 70

>TBLA0D05420 Chr4 complement(1334955..1337228) [2274 bp, 757 aa]
           {ON} Anc_1.277 YJL089W
          Length = 757

 Score = 78.2 bits (191), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 34/48 (70%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           R +QACDRCR KKI+CDG  P CT C  + F C+ + KLSRR  P+GY
Sbjct: 96  RHSQACDRCRLKKIKCDGLIPHCTNCRKINFNCQTTHKLSRRGLPKGY 143

>NCAS0A09410 Chr1 complement(1865924..1868722) [2799 bp, 932 aa]
           {ON} Anc_1.277
          Length = 932

 Score = 70.5 bits (171), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 32/48 (66%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           +  QACDRCR KKI+CD + P CT C   G  C+ +++L RR F +GY
Sbjct: 40  KRKQACDRCRLKKIKCDDRTPDCTPCMKAGIPCRTTERLKRRGFAKGY 87

>KLLA0C10923g Chr3 complement(939148..941475) [2328 bp, 775 aa] {ON}
           weakly similar to uniprot|P07272 Saccharomyces
           cerevisiae YLR014C PPR1 Zinc finger transcription factor
           containing a Zn(2)-Cys(6) binuclear cluster domain
           positively regulates transcription of genes involved in
           uracil biosynthesis activity may be modulated by
           interaction with Tup1p
          Length = 775

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 27/49 (55%)

Query: 177 YRVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           YR   AC RCR +KI+CD K P CT+C      C   D  +RR  PR Y
Sbjct: 14  YRSVAACKRCRIRKIKCDNKFPSCTKCIQAQEPCITIDPSTRREIPRSY 62

>TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {ON}
           Anc_2.231 YIL130W
          Length = 1000

 Score = 56.2 bits (134), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 27/42 (64%), Gaps = 1/42 (2%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRR 219
           RV +ACD CR KK++CDG++P C  C    +EC  +   +RR
Sbjct: 61  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTYNQPSTRR 101

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 61/118 (51%), Gaps = 16/118 (13%)

Query: 621 LQCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLR--LHRC-PSAVLG-GDGSTVSKVQQ 676
           +Q + ML  ++     +S+ Y   G  V++   LR  LHR  P+  +G G  S  + ++ 
Sbjct: 378 IQTILMLFIFLQCSARLSTCYSYIG--VALRSALREGLHRVIPTNKIGTGTDSRFNCIEI 435

Query: 677 GERRILFWSIYYLDVFSALQLGVPRLLKDFEIECALP-------VTSDD---DRQVNL 724
             R+ LF++IY LD++    LG+PR +   + + +LP       +T D+   DRQ N+
Sbjct: 436 EMRKRLFYTIYKLDIYVNAMLGLPRSISPNDFDQSLPFDLSDENITKDEIFFDRQNNV 493

>NDAI0F01220 Chr6 complement(295418..298300) [2883 bp, 960 aa] {ON}
           Anc_6.279
          Length = 960

 Score = 53.9 bits (128), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 27/45 (60%)

Query: 181 QACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           QACD CR KK++C  ++P+C +C   G+EC  S K  R    R +
Sbjct: 10  QACDICRIKKLKCSREKPKCAKCMKNGWECCYSPKAKRSPLTRAH 54

>KLLA0E13993g Chr5 complement(1239566..1241602) [2037 bp, 678 aa]
           {ON} some similarities with uniprot|P07272 Saccharomyces
           cerevisiae YLR014C PPR1 Zinc finger transcription factor
           containing a Zn(2)-Cys(6) binuclear cluster domain
           positively regulates transcription of genes involved in
           uracil biosynthesis activity may be modulated by
           interaction with Tup1p
          Length = 678

 Score = 53.5 bits (127), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 25/44 (56%)

Query: 182 ACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           AC  C+ ++ RCDG  PQC  C   G +C   DK++ R  PR Y
Sbjct: 66  ACCFCKRRRKRCDGGFPQCGACVNAGIQCTFVDKITGRELPRDY 109

 Score = 36.6 bits (83), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 34/78 (43%)

Query: 636 DISSIYELRGKVVSMSQQLRLHRCPSAVLGGDGSTVSKVQQGERRILFWSIYYLDVFSAL 695
           D + ++ L G  V  +  L LHR P +           V Q  R  +FW  Y ++    +
Sbjct: 279 DYNQLWLLAGVAVRTAVSLDLHRKPGSPRSMTHGLEQHVLQNLRSRVFWCAYSIERLIGM 338

Query: 696 QLGVPRLLKDFEIECALP 713
            +G P  + D +I+  LP
Sbjct: 339 TVGRPFCISDVDIDAPLP 356

>KNAG0D00690 Chr4 (105640..108267) [2628 bp, 875 aa] {ON} Anc_6.279
           YPL248C
          Length = 875

 Score = 53.5 bits (127), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 25/45 (55%)

Query: 181 QACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           QACD CR KK++C   +P C +CA  G+ C  S K  R    R +
Sbjct: 19  QACDLCRIKKLKCSKDKPACRKCAKNGWNCTYSPKAKRSPLTRAH 63

>KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa] {ON}
           Anc_1.128 YJL206C
          Length = 658

 Score = 53.1 bits (126), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 59/121 (48%), Gaps = 14/121 (11%)

Query: 610 YFNSRNT--------SIQVLQCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLRLHRCPS 661
           YFN   T         I  +Q + M+  ++   GD+ + Y   G  + ++ +  LHR PS
Sbjct: 224 YFNKAKTLIDFKDINDIHSIQAIFMMTIFLQCSGDLKACYYYIGIALRIAIRENLHRKPS 283

Query: 662 AVLGGDGSTVSKVQQGERRILFWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDDDRQ 721
             L G  +    ++   ++ LFWSIY +D++    LG+P  L +  I+  LP   DD++ 
Sbjct: 284 --LTGPTA----IEDETKKRLFWSIYKVDIYMNCTLGLPASLNESFIDQELPYDVDDEKI 337

Query: 722 V 722
           V
Sbjct: 338 V 338

 Score = 45.8 bits (107), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 27/48 (56%), Gaps = 5/48 (10%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           RV +AC  CR KK RCDGK P C+ CA     C+ ++     A PR +
Sbjct: 27  RVFKACIACRKKKRRCDGKSP-CSHCARTSIICEYTNT----ARPRSH 69

>KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa] {ON}
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130W ASG1 Proposed transcriptional activator member
           of the Gal4p family of zinc cluster proteins
          Length = 916

 Score = 53.5 bits (127), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 23/33 (69%), Gaps = 1/33 (3%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210
           RV +ACD CR KK++CDGK+P C  C    +EC
Sbjct: 9   RVTRACDECRKKKVKCDGKQP-CIHCTVYNYEC 40

 Score = 39.7 bits (91), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 67/142 (47%), Gaps = 16/142 (11%)

Query: 621 LQCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLR--LHRCPSAVLGGDGSTVSK--VQQ 676
           +Q + +L  ++     +S+ Y   G  V+M   LR  LHR     +  D S      ++ 
Sbjct: 405 IQTIVLLFLFLQCSARLSTSYSYIG--VAMRSALREGLHR----KIKPDPSKTKTNFIEI 458

Query: 677 GERRILFWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDDDRQVNLA------GQMIA 730
             R+ LF++IY +D++    LG+PR +   + +  LP+  +DD     A      G +++
Sbjct: 459 EMRKRLFYTIYKMDIYINTMLGLPRTISPRDFDQELPLELNDDYITEDAIYPEEQGDVLS 518

Query: 731 LEGKVSQFSLSVIRFAKVMGNI 752
             G  +Q +  ++   ++M ++
Sbjct: 519 SAGIANQHTKILMILDQIMADL 540

>Smik_6.452 Chr6 (741922..744558) [2637 bp, 878 aa] {ON} YPL248C
           (REAL)
          Length = 878

 Score = 53.1 bits (126), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (59%)

Query: 179 VAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           + QACD CR KK++C  ++P+C +C    +EC+ S K  R    R +
Sbjct: 7   IEQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPLTRAH 53

>SAKL0G11902g Chr7 (1016915..1019635) [2721 bp, 906 aa] {ON} similar
           to uniprot|P07272 Saccharomyces cerevisiae YLR014C PPR1
           Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 906

 Score = 53.1 bits (126), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 27/48 (56%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           R   AC RCR KK++CD K P C++CA+    C   D  + R  PR Y
Sbjct: 38  RSIAACKRCRLKKVKCDQKFPSCSKCASANEPCVSLDPATGRDVPRSY 85

>YPL248C Chr16 complement(79711..82356) [2646 bp, 881 aa] {ON}
           GAL4DNA-binding transcription factor required for the
           activation of the GAL genes in response to galactose;
           repressed by Gal80p and activated by Gal3p
          Length = 881

 Score = 53.1 bits (126), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (59%)

Query: 179 VAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           + QACD CR KK++C  ++P+C +C    +EC+ S K  R    R +
Sbjct: 7   IEQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPLTRAH 53

>KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa] {ON}
           Anc_2.231 YIL130W
          Length = 848

 Score = 52.8 bits (125), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 23/33 (69%), Gaps = 1/33 (3%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210
           RV +ACD CR KK++CDG++P C  C    +EC
Sbjct: 13  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 44

 Score = 40.0 bits (92), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 50/101 (49%), Gaps = 8/101 (7%)

Query: 621 LQCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLR--LHRCPSAVLGGDGSTVSKVQQGE 678
           +Q + ML  ++     +SS Y   G  V+M   LR   HR        +   ++ ++   
Sbjct: 318 IQTVLMLFIFLQCSARLSSCYTYIG--VAMRSVLREGYHRASDP----NDPNINPIELEM 371

Query: 679 RRILFWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDDD 719
           ++ LF+++Y +D++    LG+PR L+  + +  LP+   D+
Sbjct: 372 KKRLFYNVYKMDIYINAMLGLPRSLRVEDFDQTLPIELSDE 412

>NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa]
           {ON} Anc_2.231
          Length = 906

 Score = 52.8 bits (125), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 23/33 (69%), Gaps = 1/33 (3%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210
           RV +ACD CR KK++CDG++P C  C    +EC
Sbjct: 32  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 63

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 49/101 (48%), Gaps = 9/101 (8%)

Query: 621 LQCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLR--LHRCPSAVLGGDGSTVSKVQQGE 678
           +Q + ML  ++     +S+ Y   G  V+M   LR   HR       G  S  + ++   
Sbjct: 355 IQAILMLFIFLQCSARLSTCYAYIG--VAMRSALREGYHR-----QVGPLSGFTPIEIEM 407

Query: 679 RRILFWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDDD 719
           R+ LF++IY LD++    LG+PR +   + +  LP+   D+
Sbjct: 408 RKRLFYTIYKLDIYVNAMLGLPRSISPDDFDQTLPIELSDE 448

>NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa] {ON}
           Anc_2.231 YIL130W
          Length = 930

 Score = 52.4 bits (124), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 25/41 (60%), Gaps = 1/41 (2%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSR 218
           RV +ACD CR KK++CDG++P C  C    +EC  +    R
Sbjct: 34  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTYNQPTKR 73

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 78/180 (43%), Gaps = 18/180 (10%)

Query: 617 SIQVLQCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLR--LHRCPSAVLGGDGSTVSKV 674
           S+  +Q + M+  ++     +S+ Y   G  V+M   LR  LHR       G  S  + +
Sbjct: 374 SLDSIQAILMMFIFLQCSARLSTCYSYIG--VAMRSALREGLHR-----QVGPNSGFNPI 426

Query: 675 QQGERRILFWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDDDRQVNLAGQMIALEGK 734
           +   R+ LF++IY LD++    LG+PR +   + +  LP+   D+   N+  Q    E +
Sbjct: 427 EIEMRKRLFYTIYKLDIYVNAMLGLPRSISANDFDQTLPLELSDE---NITEQGYFPENQ 483

Query: 735 VSQFSLSVI-----RFAKVMGNILDSTFK-RGMTTSLTKQAALVHENALDNWRHGLQKDL 788
               S + I     +   ++  I+   +  +   T ++ +     E  L NW   L  +L
Sbjct: 484 NGVLSSTGIANEHTKLLMILDAIVGELYPIKKTNTFISHETIATLEQKLRNWLDDLPNEL 543

>Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W
           (REAL)
          Length = 1012

 Score = 52.4 bits (124), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 23/33 (69%), Gaps = 1/33 (3%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210
           RV +ACD CR KK++CDG++P C  C    +EC
Sbjct: 16  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 47

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 77/177 (43%), Gaps = 18/177 (10%)

Query: 621 LQCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLR--LHRCPSAVLGGDGSTVSKVQQGE 678
           +Q + ML  ++     +S+ Y   G  V+M   LR   HR  S+      S  S ++   
Sbjct: 349 IQAILMLFIFLQCSARLSTCYTYIG--VAMRSALRAGFHRKLSS-----SSGFSPIEIEM 401

Query: 679 RRILFWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDDDRQVNLAGQMIALEGKVSQF 738
           R+ LF++IY LDV+    LG+PR +   + +  LP+   D+   N+       E + S  
Sbjct: 402 RKRLFYTIYKLDVYINAMLGLPRSISPDDFDQTLPLDLSDE---NITEVAYLPENQHSVL 458

Query: 739 SLSVI-----RFAKVMGNILDSTFKRGMTTSLTKQAALVH-ENALDNWRHGLQKDLF 789
           S + I     +   ++  I+   +    T+++     +   E  L NW   L K+L 
Sbjct: 459 SSTGISNEHTKLFLILNEIISELYPIKKTSNIISHETVTSLELKLRNWLDSLPKELI 515

>Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W
           (REAL)
          Length = 926

 Score = 52.4 bits (124), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 23/33 (69%), Gaps = 1/33 (3%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210
           RV +ACD CR KK++CDG++P C  C    +EC
Sbjct: 16  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 47

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 52/107 (48%), Gaps = 9/107 (8%)

Query: 621 LQCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLR--LHRCPSAVLGGDGSTVSKVQQGE 678
           +Q + ML  ++     +S+ Y   G  V+M   LR   HR  SA      S  + ++   
Sbjct: 346 IQAILMLFIFLQCSARLSTCYTYIG--VAMRSALRAGFHRKLSA-----NSGFTPIEIEM 398

Query: 679 RRILFWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDDDRQVNLA 725
           R+ LF++IY LDV+    LG+PR +   + +  LP+   D+    +A
Sbjct: 399 RKRLFYTIYKLDVYINAMLGLPRSISPEDFDQTLPLDLSDENITEVA 445

>YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc
           cluster protein proposed to function as a
           transcriptional regulator involved in the stress
           response; null mutants have a respiratory deficiency,
           calcofluor white sensitivity and slightly increased
           cycloheximide resistance
          Length = 964

 Score = 52.4 bits (124), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 23/33 (69%), Gaps = 1/33 (3%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210
           RV +ACD CR KK++CDG++P C  C    +EC
Sbjct: 16  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 47

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 77/177 (43%), Gaps = 18/177 (10%)

Query: 621 LQCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLR--LHRCPSAVLGGDGSTVSKVQQGE 678
           +Q + ML+ ++     +S+ Y   G  V+M   LR   HR  S       S  S ++   
Sbjct: 346 IQAILMLIIFLQCSARLSTCYTYIG--VAMRSALRAGFHRKLSP-----NSGFSPIEIEM 398

Query: 679 RRILFWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDDDRQVNLAGQMIALEGKVSQF 738
           R+ LF++IY LDV+    LG+PR +   + +  LP+   D+   N+       E + S  
Sbjct: 399 RKRLFYTIYKLDVYINAMLGLPRSISPDDFDQTLPLDLSDE---NITEVAYLPENQHSVL 455

Query: 739 SLSVI-----RFAKVMGNILDSTFKRGMTTSLTKQAALVH-ENALDNWRHGLQKDLF 789
           S + I     +   ++  I+   +    T+++     +   E  L NW   L K+L 
Sbjct: 456 SSTGISNEHTKLFLILNEIISELYPIKKTSNIISHETVTSLELKLRNWLDSLPKELI 512

>Kpol_1018.30 s1018 complement(81534..83840,83842..84180) [2646 bp,
           881 aa] {ON} complement(81534..83840,83842..84180) [2646
           nt, 882 aa]
          Length = 881

 Score = 52.4 bits (124), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 26/45 (57%)

Query: 181 QACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           Q CD CR KK++C  ++P+C +C    +EC  S K+ R    R +
Sbjct: 8   QVCDSCRLKKLKCSKEKPKCFKCLKHNWECNYSPKIKRSPLTRAH 52

 Score = 35.0 bits (79), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 64/284 (22%), Positives = 125/284 (44%), Gaps = 39/284 (13%)

Query: 524 DKNEFNSYYEKFKLNVTDPNFFVRKDDTVFNNRTRSI---SYKIFSCLLIIIVQMGMLSK 580
           DKN  NS+ E +  N    +  V K++ ++  +++S+   S + +  L  +++ +G    
Sbjct: 259 DKNMKNSFIENYIKNFYPFHPIVSKEE-IYAIQSQSLPIYSSEAYRALFNVVLAIGCWCS 317

Query: 581 IKRDKITSGKLSTLMKYYDKLMTHIWINPYFNSRNTSIQVLQCLSMLLFYMLNVGDISSI 640
            +RD I+S  +   +  Y++  T I  N +  S  TS+  L  LS+   Y      I+S 
Sbjct: 318 DERD-ISSTNIQYDLILYERSKTFIDKNFFQTSSITSVITLHLLSV---YTQFRNFINSS 373

Query: 641 YELRGKVVSMSQQLRLH-RCPSAVLGGDGSTVSKVQQGERRILFWSIYYLDVFSALQLGV 699
           Y   G  ++M+  L L    P  +   D S   K     RR ++WS++    F ++    
Sbjct: 374 YLYNGYAINMALTLGLSLELPENI---DQSIREK-----RRRIWWSLFNQHFFLSILFDR 425

Query: 700 PRLLKDFEIECALPVTSDDDRQVNLAGQMIALEGKVSQFSLSVIRFAKVMGNILDSTFKR 759
           P L  +F                NL    IAL   +++ +LS+     V   +++ST   
Sbjct: 426 P-LAYNF----------------NLQNCGIALPSSINEDTLSLTEEPTVYLTLMESTKLY 468

Query: 760 GMTTSLTKQAALVHENALDNWRHGL-----QKDLFFQLDVNGTI 798
            + +++       +++AL N    +     +K L+ ++D++ +I
Sbjct: 469 SIYSNVNNSYVNSNDSALTNLIDNIEKWSQEKKLYLKMDISSSI 512

>Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W (REAL)
          Length = 954

 Score = 52.4 bits (124), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 1/45 (2%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFP 222
           RV +ACD CR KK++CDG++P C  C    +EC       R   P
Sbjct: 16  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTYKKPTKRTQNP 59

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 81/186 (43%), Gaps = 20/186 (10%)

Query: 612 NSRNTSIQVLQCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLR--LHRCPSAVLGGDGS 669
           NSR+  +  +Q + ML  ++     +S+ Y   G  V+M   LR   HR       G  S
Sbjct: 340 NSRD--LNSIQAILMLFIFLQCSARLSTCYTYIG--VAMRSALRAGFHR-----KLGTNS 390

Query: 670 TVSKVQQGERRILFWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDDDRQVNLAGQMI 729
             S ++   R+ LF++IY LDV+    LG+PR +   + +  LP+   D+   N+     
Sbjct: 391 GFSPIEIEMRKRLFYTIYKLDVYINAMLGLPRSISPDDFDQTLPLDLSDE---NITETAY 447

Query: 730 ALEGKVSQFSLSVI-----RFAKVMGNILDSTFKRGMTTSLTKQAALVH-ENALDNWRHG 783
             E + +  S + I     +   ++  I+   +    T+++     +   E  L NW   
Sbjct: 448 LPENQNAVLSSTGISNEHTKLFLILNEIISELYPIKKTSNIISHETVTSLELKLRNWLDS 507

Query: 784 LQKDLF 789
           L K+L 
Sbjct: 508 LPKELI 513

>Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}
           similar to Ashbya gossypii AER183C
          Length = 898

 Score = 52.0 bits (123), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/42 (47%), Positives = 28/42 (66%), Gaps = 1/42 (2%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRR 219
           RV++ACD CRAKKI+C+G+ P C+ C     EC  +  + RR
Sbjct: 22  RVSKACDTCRAKKIKCNGEEP-CSNCGKHDLECAYTHVIKRR 62

>NCAS0G01100 Chr7 complement(193052..195859) [2808 bp, 935 aa] {ON}
           Anc_6.279
          Length = 935

 Score = 52.0 bits (123), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 26/45 (57%)

Query: 181 QACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           QACD CR KK++C  ++P+C +C    +EC  S K  R    R +
Sbjct: 11  QACDLCRVKKLKCSKEKPKCAKCLKNNWECCYSPKTRRSPLTRAH 55

>TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON} Anc_2.231
           YIL130W possible pseudogene; NNN added to avoid internal
           stop codon
          Length = 852

 Score = 52.0 bits (123), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 25/41 (60%), Gaps = 1/41 (2%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSR 218
           RV +ACD CR KK++CDG++P C  C    +EC  +    R
Sbjct: 15  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTYNQPTKR 54

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 78/177 (44%), Gaps = 18/177 (10%)

Query: 621 LQCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLR--LHRCPSAVLGGDGSTVSKVQQGE 678
           +Q + ML  ++     +S+ Y   G  V+M   LR  LHR  S       S  S ++   
Sbjct: 332 IQTILMLFIFLQCSARLSTCYAYIG--VAMRSALREGLHRSVSP-----DSGFSPIEIEM 384

Query: 679 RRILFWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDDDRQVNLAGQMIALEGKVSQF 738
           R+ LF++IY LDV+    LG+PR +   + +  LP+   D+   N+  +    E +  + 
Sbjct: 385 RKRLFYTIYKLDVYVNAMLGLPRSISSNDFDQTLPIELSDE---NITEEGYFPENQKGKL 441

Query: 739 SLSVI-----RFAKVMGNILDSTFKRGMTTSLTKQAALVH-ENALDNWRHGLQKDLF 789
           S + I     +   ++  I+   +    T +L +   +   E  L  W  GL ++L 
Sbjct: 442 SSAEIANQHTKLIMILNVIVGELYPIRKTNNLIRHEVVTELELKLRQWLDGLPRELI 498

>KAFR0J00690 Chr10 (124449..127043) [2595 bp, 864 aa] {ON} Anc_5.235
           YLR014C
          Length = 864

 Score = 52.0 bits (123), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 25/44 (56%)

Query: 182 ACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           AC RCRAKKI+CD + P C +CA V   C   D  +    PR Y
Sbjct: 33  ACKRCRAKKIKCDQEFPSCGKCAKVNEPCVSIDPATGEDIPRSY 76

 Score = 36.2 bits (82), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 51/232 (21%), Positives = 89/232 (38%), Gaps = 26/232 (11%)

Query: 613 SRNTSIQVLQCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLRLHRCPSAVLGGDGSTVS 672
           S N  ++ L    +L  Y +    +  ++ L G V+ ++  L LH   S +L    S   
Sbjct: 410 SSNDRLEALAGTLLLADYSIMRPSVPGVWYLMGSVLRLTVDLGLH---SEILN---SNYD 463

Query: 673 KVQQGERRILFWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDDDRQVNLAGQMIALE 732
              +  RR LFWS+Y LD       G P  + +  I    P   DD   V     +    
Sbjct: 464 PFTREIRRRLFWSVYALDRQVCSYFGRPFGIPEENITTRYPSILDDSVIVAKNFVLDDYS 523

Query: 733 GKVSQ------FSLSVIRFAKVMGNIL------DSTFKRGMTTSLTKQAALVHENALDNW 780
              SQ       ++++ +  K+  +I+      +S   RG +    +Q      N LD W
Sbjct: 524 DATSQCASSKVIAMAMFKVRKIQADIVKILYAPNSELPRGFSD--FEQWRDSARNKLDKW 581

Query: 781 RHGLQKDLFFQLDVNGTINMDEFNQQKQYSK----SLSPRTAAFTHNSLVLM 828
            + ++    F   +N   N+  F+    YSK     L+P+       +  ++
Sbjct: 582 -YSIEVPKSFDA-MNCKFNIFFFDLNYHYSKLILYGLAPKCPVLNEKAFQIV 631

>NCAS0D04190 Chr4 (793242..795914) [2673 bp, 890 aa] {ON} Anc_6.279
          Length = 890

 Score = 52.0 bits (123), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 27/45 (60%)

Query: 179 VAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPR 223
           + QACD CR KK++C  + P+C++C   G +C  S K+ R    R
Sbjct: 16  IEQACDNCRLKKLKCSKETPKCSKCLKNGMKCLYSPKVKRSPLTR 60

>TDEL0E03910 Chr5 (732533..735121) [2589 bp, 862 aa] {ON} Anc_5.235
           YLR014C
          Length = 862

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 25/44 (56%)

Query: 182 ACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           AC RCR KKI+CD + P C +CA V   C   D  + R  PR Y
Sbjct: 29  ACKRCRLKKIKCDQEFPSCLKCARVKVPCVSLDPATGRDVPRSY 72

>KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130W ASG1 Proposed transcriptional activator member
           of the Gal4p family of zinc cluster proteins
          Length = 782

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 23/33 (69%), Gaps = 1/33 (3%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210
           RV +ACD CR KK++CDG++P C  C    +EC
Sbjct: 10  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 41

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 81/186 (43%), Gaps = 21/186 (11%)

Query: 612 NSRNTSIQVLQCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLR--LHRCPSAVLGGDGS 669
           N+R+  +  +Q + ML  ++     +S+ Y   G  V+M   LR  +HR     L  D  
Sbjct: 287 NARD--LNSIQAIVMLFIFLQCSARLSTCYTYIG--VAMRNALREGMHRN----LNADTH 338

Query: 670 TVSKVQQGERRILFWSIYYLDVFSALQLGVPRLLKDFEIECALPV------TSDDDRQVN 723
           + + ++   R+ LF++IY +DV+    LG+PR +   + + ALP        + D     
Sbjct: 339 SYNPIEIEMRKRLFYTIYKMDVYVNTMLGLPRSVSQRDFDQALPAELTDEFITKDGLHFE 398

Query: 724 LAGQMIALEGKVSQFSLSVIRFAKVMGNILDSTFKRGMTTSLTKQAALVH-ENALDNWRH 782
             G +++  G  +Q +    +   ++ NI+   +    T +L     +   E  L  W  
Sbjct: 399 KQGNVLSSAGIANQHT----KLIMILDNIVAELYPVKKTNNLISHDVVTQLELKLRQWLD 454

Query: 783 GLQKDL 788
            L  +L
Sbjct: 455 NLPPEL 460

>CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa] {ON}
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130w
          Length = 847

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 25/41 (60%), Gaps = 1/41 (2%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSR 218
           +V +ACD CR KK++CDG +P C  C    +EC  +  L R
Sbjct: 15  KVTRACDDCRKKKVKCDGNQP-CIHCTVYSYECTYNHPLKR 54

>Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W
           (GIN1) - 1:1 [contig 5] FULL
          Length = 812

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 23/33 (69%), Gaps = 1/33 (3%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210
           RV +ACD CR KK++CDG++P C  C    +EC
Sbjct: 10  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 41

 Score = 46.2 bits (108), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 76/177 (42%), Gaps = 19/177 (10%)

Query: 621 LQCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLR--LHRCPSAVLGGDGSTVSKVQQGE 678
           +Q + ML  ++     +S+ Y   G  V+M   LR  +HR     L  D    S ++   
Sbjct: 325 IQAIVMLFIFLQCSARLSTCYTYIG--VAMRNALREGMHRN----LNTDTHGYSPIEIEM 378

Query: 679 RRILFWSIYYLDVFSALQLGVPRLLKDFEIECALPV------TSDDDRQVNLAGQMIALE 732
           R+ LF++IY +DV+    LG+PR +   + + ALP        ++D       G +++  
Sbjct: 379 RKRLFYTIYKMDVYVNTMLGLPRSVSQRDFDQALPAELTDEYITEDGLHPEKQGDVLSSA 438

Query: 733 GKVSQFSLSVIRFAKVMGNILDSTFKRGMTTSLTKQAALVH-ENALDNWRHGLQKDL 788
           G  +Q +    +   ++ NI+   +    T +L     +   E  L  W   L  +L
Sbjct: 439 GIANQHT----KLIMILDNIVAELYPVKKTNNLISHDVVTQLEFKLRQWLDNLPPEL 491

>SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa] {ON}
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130W ASG1 Proposed transcriptional activator member
           of the Gal4p family of zinc cluster proteins
          Length = 823

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 25/41 (60%), Gaps = 1/41 (2%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSR 218
           RV +ACD CR KK++CDG++P C  C    +EC  +    R
Sbjct: 10  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTYNQPTKR 49

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 54/101 (53%), Gaps = 8/101 (7%)

Query: 621 LQCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLR--LHRCPSAVLGGDGSTVSKVQQGE 678
           +Q + ML  ++     +S+ Y   G  V+M   LR  LHR  +  +G  G T  +++  +
Sbjct: 280 IQTIVMLFIFLQCSARLSTCYAYIG--VAMRSALREGLHR--NLTMGAPGFTPIEIEMRK 335

Query: 679 RRILFWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDDD 719
           R  LF++IY +D++    LG+PR +   + + + P+  DD+
Sbjct: 336 R--LFFTIYKMDIYLNTMLGLPRAISQRDFDQSFPLEIDDE 374

>Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON}
           (29727..32705) [2979 nt, 993 aa]
          Length = 992

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210
           RV +ACD CR KK++CDG++P C  C    + C
Sbjct: 31  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYNC 62

 Score = 40.0 bits (92), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 33/171 (19%), Positives = 72/171 (42%), Gaps = 7/171 (4%)

Query: 621 LQCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLRLHRCPSAVLGGDGSTVSKVQQGERR 680
           +Q + ML  ++     +S+ Y   G  +  + +  LHR     +    S ++ +    R+
Sbjct: 470 IQTIIMLFLFLQFSARLSNCYSYIGIALRNALREGLHR----FVNPKSSNLNPLDIEMRK 525

Query: 681 ILFWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDDDRQVNLAGQMIALEGKVSQFSL 740
            +F++IY  D++    LG+P+ L   + +  LPV   D+             G+VS  ++
Sbjct: 526 RVFYTIYKCDLYLNSMLGLPKSLSSADFDQVLPVELSDENITEEGYFPDKQNGEVSSAAI 585

Query: 741 SV--IRFAKVMGNILDSTFKRGMTTSLTKQAALVH-ENALDNWRHGLQKDL 788
           +    +   ++ +I    +    + ++     +   E  L+NW   L + L
Sbjct: 586 ANYHTKLMLILADITKELYPNKKSNNIVSHETVTQLEMRLENWIQSLPQQL 636

>NCAS0D02540 Chr4 complement(484060..486732) [2673 bp, 890 aa] {ON}
           Anc_5.235
          Length = 890

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 26/44 (59%)

Query: 182 ACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           AC RCR+KKI+CD K P C +CA +   C   D  + +  PR Y
Sbjct: 40  ACKRCRSKKIKCDQKFPSCDRCAHLKVPCVSVDPATGQDVPRSY 83

>KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON} Anc_2.231
           YIL130W
          Length = 902

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 23/33 (69%), Gaps = 1/33 (3%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210
           RV +ACD CR KK++CDG++P C  C    +EC
Sbjct: 32  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 63

 Score = 42.4 bits (98), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 65/141 (46%), Gaps = 11/141 (7%)

Query: 621 LQCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLR--LHRCPSAVLGGDGSTVSKVQQGE 678
           +Q + ML  ++     +S+ Y   G  V+M   LR   HR       G  S +S ++   
Sbjct: 378 IQTVLMLFIFLQCSARLSTCYAYIG--VAMRSALREGFHR-----KVGPESDLSPLEIEI 430

Query: 679 RRILFWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDDDRQVNLAGQMIALEGKVSQF 738
           R+ LF++IY LDV+    LG+PR +   + +  LP+   D+     A      +G +S  
Sbjct: 431 RKRLFYTIYKLDVYVNAMLGLPRSISPEDFDQVLPLELSDENITEQAYYPEREDGSLSST 490

Query: 739 SLSVIRFAKVMGNILDSTFKR 759
            ++      +M  ILD+  ++
Sbjct: 491 GIANCHTRLIM--ILDTIMRK 509

>ZYRO0E08272g Chr5 (651705..654089) [2385 bp, 794 aa] {ON} similar
           to uniprot|P04386 Saccharomyces cerevisiae YPL248C GAL4
           DNA-binding transcription factor required for the
           activation of the GAL genes in response to galactose
           repressed by Gal80p and activated by Gal3p
          Length = 794

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 27/47 (57%)

Query: 179 VAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           +  ACD CR KK+RC  + P+C +C   G+EC  S K +R    R +
Sbjct: 7   IDHACDSCRQKKLRCSKEEPKCAKCIQNGWECCYSPKANRTPLTRAH 53

>NDAI0I02350 Chr9 (536448..539117) [2670 bp, 889 aa] {ON} Anc_5.235
          Length = 889

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 24/44 (54%)

Query: 182 ACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           AC RCR KKI+CD   P C++CA +   C   D  +    PR Y
Sbjct: 21  ACKRCRLKKIKCDNNVPSCSRCAKLRVPCVAVDSATGEDVPRSY 64

>TPHA0H01980 Chr8 (467688..470669) [2982 bp, 993 aa] {ON} Anc_6.279
           YPL248C
          Length = 993

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 26/47 (55%)

Query: 179 VAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           V QACD CR KK+RC  + P+C +C    +EC  S +  R    R +
Sbjct: 8   VDQACDSCRIKKLRCSKENPKCAKCLKNKWECCYSPRKRRSPLTRAH 54

>KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]
           {ON} some similarities with uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger; overexpression increases salt
           tolerance through increased expression of the
           ENA1(Na+/Li+ extrusion pump) gene while gene disruption
           decreases both salt tolerance and ENA1 expression
          Length = 902

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/45 (48%), Positives = 29/45 (64%), Gaps = 1/45 (2%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFP 222
           RV++ACD CRAKKI+CDG  P C+ C  V  EC  +  + +R  P
Sbjct: 9   RVSKACDACRAKKIKCDGCDP-CSNCKKVSQECGYTYVVKKRQKP 52

>TBLA0G01800 Chr7 complement(469668..473132) [3465 bp, 1154 aa] {ON}
           Anc_6.279 YPL248C
          Length = 1154

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 26/45 (57%)

Query: 181 QACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           QACD CR KK++C  ++P+C +C    +EC  S +  R    R +
Sbjct: 16  QACDSCRLKKLKCSKEKPKCAKCLKNIWECCYSPRAKRSPLTRNH 60

>Suva_10.94 Chr10 complement(178366..181086) [2721 bp, 906 aa] {ON}
           YLR014C (REAL)
          Length = 906

 Score = 50.4 bits (119), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 25/44 (56%)

Query: 182 ACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           AC RCR KKI+CD + P C +CA +   C   D  + +  PR Y
Sbjct: 33  ACKRCRQKKIKCDQEFPSCKRCAKLKVPCVSLDPATGKDVPRSY 76

 Score = 36.6 bits (83), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 57/280 (20%), Positives = 111/280 (39%), Gaps = 40/280 (14%)

Query: 568 LLIIIVQMGMLSKIKRDKITSGKLSTLMKYYDKLMTHIWINPYFNSRNTSIQVLQCLSML 627
            L II  +G  +++ +  IT+  ++T  +   K  T ++      S +  ++ L    ++
Sbjct: 396 FLNIIFAIGHATQVLKSDITT--VATYKRRATKYTTSLF------SSSDRLEALAGTMLI 447

Query: 628 LFYMLNVGDISSIYELRGKVVSMSQQLRLHRCPSAVLGGDGSTVSKVQQGERRILFWSIY 687
           + Y +   +I  ++   G V+ ++  L LH   S  +  +    ++     RR LFW +Y
Sbjct: 448 VIYSIMRPNIPGVWYTMGSVLRLTVDLGLH---SEKINKNYDAFTR---EIRRRLFWCVY 501

Query: 688 YLDVFSALQLGVPRLLKDFEIECALPVTSDD------DRQVNLAGQMIALEGKVSQFSLS 741
            LD       G P  + +  I    P   DD      +  V+    +          +L+
Sbjct: 502 SLDRQICSYFGRPFGIPEESITTRYPSLLDDSFITLTNLDVDDYSDLPNPNPSSKVIALA 561

Query: 742 VIRFAKVMGNILDSTFKRGMTTSLTKQAALVHENALDNWRHGLQKDL--FFQLDV----- 794
           + +  ++  NI+   +  G    L ++        L++WR     +L  +FQ+DV     
Sbjct: 562 MYKIRRIQANIVRILYAPG--AELPRKFT-----DLESWRIETYNELEHWFQVDVPKNFD 614

Query: 795 --NGTINMDEFNQQKQYSKS----LSPRTAAFTHNSLVLM 828
             N   N   F+    YSKS    LSP+       +  ++
Sbjct: 615 IMNCKFNSIWFDLNYHYSKSILYGLSPKCPTLNETAFQIV 654

>SAKL0A02860g Chr1 complement(259388..261625) [2238 bp, 745 aa] {ON}
           similar to uniprot|P04386 Saccharomyces cerevisiae
           YPL248C GAL4 DNA-binding transcription factor required
           for the activation of the GAL genes in response to
           galactose repressed by Gal80p and activated by Gal3p
          Length = 745

 Score = 50.1 bits (118), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 26/45 (57%)

Query: 179 VAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPR 223
           V QACD CR +K+RC  + P+C++C    +EC  S K  R    R
Sbjct: 5   VQQACDSCRKRKLRCSKELPKCSKCLKHNWECCYSPKAVRSPLTR 49

>Suva_16.59 Chr16 complement(88631..91318) [2688 bp, 895 aa] {ON}
           YPL248C (REAL)
          Length = 895

 Score = 50.1 bits (118), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 27/45 (60%)

Query: 179 VAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPR 223
           + QACD CR KK++C  ++P+C++C    +EC  S K  R    R
Sbjct: 7   MEQACDICRLKKLKCSKEKPKCSKCLKNNWECCYSPKTKRSPLTR 51

>Smik_12.77 Chr12 complement(159125..161836) [2712 bp, 903 aa] {ON}
           YLR014C (REAL)
          Length = 903

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 25/44 (56%)

Query: 182 ACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           AC RCR KKI+CD + P C +CA +   C   D  + +  PR Y
Sbjct: 32  ACKRCRLKKIKCDQEFPSCKRCAKLQVPCVSLDPATGKDVPRSY 75

>TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {ON}
           Anc_2.231 YIL130W
          Length = 890

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210
           RV +ACD CR KK++CDG+ P C  C    ++C
Sbjct: 67  RVTRACDECRKKKVKCDGQNP-CIHCTVYSYKC 98

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/173 (22%), Positives = 81/173 (46%), Gaps = 11/173 (6%)

Query: 621 LQCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLRLHRCPSAVLGGDGSTVSKVQQGERR 680
           +Q + +LLF+      +++ Y   G  +  + +   HR     +  + +T++ ++   R+
Sbjct: 419 IQTIIILLFFCQCSARLTTCYSYIGAALRAALKEGYHR----RVDPNNTTLNPIEIEMRK 474

Query: 681 ILFWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDDDRQVNLAGQMIALEGKVSQFSL 740
            +F++IY LDV+    +G+PR L + + +  LP+   D+  +   G +   EG+    S+
Sbjct: 475 RIFYTIYKLDVYVNSMMGLPRSLSEDDFDQELPIEISDE-CITENGYLSEQEGQQLS-SI 532

Query: 741 SVIRFAKVMGNILDSTFKRGMTT-----SLTKQAALVHENALDNWRHGLQKDL 788
           S+  +   +  IL    +R  +      S+T+   +  EN L  W   L  +L
Sbjct: 533 SIANYHTKLYLILADIVQRLYSIKKKNRSITENTVISLENKLRKWADSLPHEL 585

>ZYRO0A10956g Chr1 (881429..883996) [2568 bp, 855 aa] {ON} similar
           to uniprot|P07272 Saccharomyces cerevisiae YLR014C PPR1
           Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 855

 Score = 49.7 bits (117), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 24/44 (54%)

Query: 182 ACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           AC RCR KKI+CD + P C +CA     C   D  + R  PR Y
Sbjct: 32  ACKRCRTKKIKCDHEFPSCKKCARANKPCVSLDPATGRDVPRSY 75

>KAFR0F01040 Chr6 complement(195192..197696) [2505 bp, 834 aa] {ON}
           Anc_6.279 YPL248C
          Length = 834

 Score = 49.3 bits (116), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%)

Query: 179 VAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           + QACD CR KK+RC  ++P C +C      C  S +  R    R +
Sbjct: 1   MEQACDICRVKKLRCSKEKPSCFKCLKNNLTCTYSPRAKRSPLTRAH 47

>SAKL0H24860g Chr8 complement(2162455..2165370) [2916 bp, 971 aa]
           {ON} conserved hypothetical protein
          Length = 971

 Score = 49.3 bits (116), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 88/197 (44%), Gaps = 34/197 (17%)

Query: 650 MSQQLRLHRCPSAVLGGDGSTVSKVQQGERRILFWSIYYLDVFSALQLGVPRLLKDFEIE 709
           ++Q++ L R P++  G    T+ +     RRILFW I+ LD  ++L   +P L+K  E +
Sbjct: 388 LAQRVMLTRDPTSYHGITDPTLVQ----SRRILFWQIFQLDTLTSLHNNLPPLIKLDEFD 443

Query: 710 CALPVTSDDDRQVNLAGQMIALEGKVSQFSLSVIRFAKVMGNILDSTFKRGMTTSLTKQA 769
            ALPV   +  Q  L   +  L  K         RF  ++ N L S  K+G    L ++ 
Sbjct: 444 TALPV---EVVQGQLNPSLCFLNAKY--------RFVLLL-NELCSQSKKGTFQGLKERI 491

Query: 770 ALVHENALDNWRHGLQKDLFFQLDVNGTINMDEFNQQKQYSKSLSPRTAAFTHNSLVLMT 829
             +H                        ++++ ++QQ++ + +L+   A F   ++ ++ 
Sbjct: 492 VDLHACC-----------------TGSALSLNSYSQQQKEANALTSYEAKFIEWAVYMLN 534

Query: 830 LYFMAKC-MIHLPVVAT 845
            +    C ++HL ++ T
Sbjct: 535 TFADRACLLLHLNIIKT 551

>Kwal_23.2905 s23 (69235..71880) [2646 bp, 881 aa] {ON} YLR014C
           (PPR1) - zinc-finger transcription factor of the
           Zn(2)-Cys(6) binuclear cluster domain type [contig 246]
           FULL
          Length = 881

 Score = 49.3 bits (116), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 26/48 (54%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           R   AC RCR +K++CD K P C++C +    C   D  + R  PR Y
Sbjct: 44  RSIAACKRCRIRKVKCDQKFPSCSRCVSANEPCVSIDPATGRDVPRSY 91

>KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly
           similar to uniprot|P52960 Saccharomyces cerevisiae
           YOR363C PIP2 peroxisome induction pathway 2 (PIP2)
           transcriptional activator of peroxisome proliferation
           may form heterodimer with Oaf1 to activate
           oleate-inducible gene expression activator of peroxisome
           proliferation
          Length = 847

 Score = 49.3 bits (116), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 31/47 (65%), Gaps = 2/47 (4%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECK--ISDKLSRRAFP 222
           R++  C  CR +KI+CD  +P+C +CA +G EC   +S+++S +  P
Sbjct: 27  RLSFVCRNCRKRKIKCDKAQPKCGRCAKLGLECNYDLSEQISLKKTP 73

>YLR014C Chr12 complement(172268..174982) [2715 bp, 904 aa] {ON}
           PPR1Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain, positively
           regulates transcription of URA1, URA3, URA4, and URA10,
           which are involved in de novo pyrimidine biosynthesis,
           in response to pyrimidine starvation; activity may be
           modulated by interaction with Tup1p
          Length = 904

 Score = 49.3 bits (116), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 25/44 (56%)

Query: 182 ACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           AC RCR KKI+CD + P C +CA +   C   D  + +  PR Y
Sbjct: 33  ACKRCRLKKIKCDQEFPSCKRCAKLEVPCVSLDPATGKDVPRSY 76

>AER183C Chr5 complement(975879..978518) [2640 bp, 879 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YOL089C
           (HAL9)
          Length = 879

 Score = 49.3 bits (116), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/42 (47%), Positives = 26/42 (61%), Gaps = 1/42 (2%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRR 219
           RV++ACD CRAKKIRC+G+ P C  C      C  +  + RR
Sbjct: 76  RVSKACDICRAKKIRCNGEEP-CVNCEKFNLGCTYTHVIKRR 116

>KLTH0G07898g Chr7 (636890..639490) [2601 bp, 866 aa] {ON} similar
           to uniprot|P07272 Saccharomyces cerevisiae YLR014C PPR1
           Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 866

 Score = 48.9 bits (115), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 25/48 (52%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           R   AC RCR +K++CD K P C++C      C   D  + R  PR Y
Sbjct: 33  RSIAACKRCRVRKVKCDQKFPSCSRCVTANEPCVSVDPATGRDVPRSY 80

>Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON}
           (71447..74704) [3258 nt, 1086 aa]
          Length = 1085

 Score = 48.9 bits (115), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 24/37 (64%), Gaps = 4/37 (10%)

Query: 178 RVAQACDRCRAKKIRCDG----KRPQCTQCAAVGFEC 210
           RVA+ACDRCR +KI+CD     K  +C+ C   G EC
Sbjct: 118 RVARACDRCRKRKIKCDEIKNLKVNKCSNCVKYGAEC 154

>NDAI0I00740 Chr9 complement(160212..163313) [3102 bp, 1033 aa] {ON}
           Anc_6.279 YPL248C
          Length = 1033

 Score = 48.9 bits (115), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 24/45 (53%)

Query: 179 VAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPR 223
           + QACD CR KK++C    P+C QC    + C  S K+ R    R
Sbjct: 7   IEQACDNCRLKKLKCSKHFPKCGQCLKNNWPCIYSPKVKRSPLTR 51

>SAKL0C02024g Chr3 complement(174858..177554) [2697 bp, 898 aa] {ON}
           similar to uniprot|P07272 Saccharomyces cerevisiae
           YLR014C PPR1 Zinc finger transcription factor containing
           a Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 898

 Score = 48.9 bits (115), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 26/48 (54%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           R   AC+RCR KK +CD   P C +CA++G  C   D  + R   R Y
Sbjct: 48  RSIVACERCRTKKTKCDQNFPSCARCASLGEPCISVDPATGRVVSRSY 95

>TDEL0E00160 Chr5 (16083..17978) [1896 bp, 631 aa] {ON} 
          Length = 631

 Score = 48.9 bits (115), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 177 YRVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPR 223
           + + +ACD CR KK++C   RP+C +C   G++C  S ++ R    R
Sbjct: 2   FEMDRACDSCRHKKLKCSKTRPKCKKCLKNGWDCCYSPRIKRSPLTR 48

>AGR280C Chr7 complement(1266912..1270232) [3321 bp, 1106 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR278C
          Length = 1106

 Score = 48.9 bits (115), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 66/294 (22%), Positives = 134/294 (45%), Gaps = 58/294 (19%)

Query: 510 QLFFQDWYELI----PLFDKNEFNSYYEKFKLNVTDPNFFVRKDDTVFNNRTRSISYKIF 565
           Q+F   ++  I    PL D+ E  ++++ +   V+D       D   F      + + I 
Sbjct: 279 QVFLDTYFTRIQFKYPLLDEREVYAFHDAY---VSDSVQAYGTDAFHFACGRMWMVFSIA 335

Query: 566 SCLLIIIVQMGMLSKIKRDKITSGKLSTLM--KYYDKLMTHIWINPYFNSRNTSIQVLQC 623
           +CL                 +T+G+   L   +Y    ++H+      NS  T +Q ++ 
Sbjct: 336 ACL----------------HMTTGEYLGLPPNRYLSTAISHL---TKCNSALTPVQEVEL 376

Query: 624 LSMLLFYMLNVG-DISSIYELRGKVVSMSQ-QLRLHRCPSAVLGGDGSTVSKVQQGERRI 681
           L++L+FY + +  D +++YE+   VV++ + +L LH+             +     +R+ 
Sbjct: 377 LTLLVFYTIRIDRDSAALYEIIEDVVAICKNKLNLHQ------------HTPYGNSDRKF 424

Query: 682 -LFWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDDDRQV---NLAGQMIALEGKVSQ 737
            LFW +Y L+    + +G P ++K+ EI   LP+  +D+  +   +++G  +     ++Q
Sbjct: 425 RLFWCVYLLERMICVAVGKPYVIKESEI--GLPLFQEDEPSLVNHDISGSAVTGVHFINQ 482

Query: 738 -FSLSVI--RFAKVMGNI--LDSTFKRGMT---TSLTKQAALVHE--NALDNWR 781
              L  I  RF +V+G I  ++  +++      + L +Q +LV E    L+ WR
Sbjct: 483 AIKLRRIESRFVEVLGIIPQVEDQWQQCSQLPRSKLQEQLSLVKEFFRELEIWR 536

 Score = 36.6 bits (83), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 18/31 (58%)

Query: 180 AQACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210
           +++C  C+ +K RCD K P CT C   G  C
Sbjct: 38  SRSCLLCQRRKQRCDHKIPSCTACLKAGVRC 68

>SAKL0C03938g Chr3 complement(377431..379773) [2343 bp, 780 aa] {ON}
           weakly similar to uniprot|P40467 Saccharomyces
           cerevisiae YIL130W ASG1 Proposed transcriptional
           activator member of the Gal4p family of zinc cluster
           proteins and to YJL206C uniprot|P39529 Saccharomyces
           cerevisiae YJL206C
          Length = 780

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 23/33 (69%), Gaps = 1/33 (3%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210
           RV++ACD CR +K+RCDG++P C  C    + C
Sbjct: 27  RVSRACDVCRQRKVRCDGRQP-CIHCTVYSYNC 58

 Score = 37.0 bits (84), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 60/233 (25%), Positives = 100/233 (42%), Gaps = 29/233 (12%)

Query: 616 TSIQVLQCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLRLHRCPSAVLGGDGSTVSKVQ 675
           T +  +Q + ML  ++     +++ Y   G  +  +    LH   S      G +  + +
Sbjct: 336 TDVYAIQTVFMLTIFLQCSAKLTTCYSYIGVALRAAITQGLHTKVSTA----GKSPVEAE 391

Query: 676 QGERRILFWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDDDRQVNLAGQMIALEGKV 735
             +R  LFW+IY +DV+    LG+PR + + +++  LP   DDDR  +L G      GK+
Sbjct: 392 TCKR--LFWTIYKMDVYMNCILGLPRSISEEDVDQDLPQDLDDDRITDL-GIEPQPAGKI 448

Query: 736 SQFSLS--VIRFAKVMGNI---LDSTFKRGMTTSLTKQAALVHENALDNWRHGLQKDLFF 790
           S   ++    +   +M +I   L          +L  ++    EN L NW   LQ  L  
Sbjct: 449 SSCGMNNQHTKLIVIMNHIHCKLSPLKNDAPPATLLLESVHELENELQNW--TLQ--LPL 504

Query: 791 QLDVNGTINMDEFNQQKQYSKSLSPRTAAFTHNSLVLMTLYFMAKCMIHLPVV 843
           QL  N T     F  Q +    L P       N L+L+  +  AK M++ P +
Sbjct: 505 QLRPNYT-----FLDQAEADLYLKP-------NKLLLLD-FLHAKIMLYRPFI 544

>Skud_12.82 Chr12 complement(164119..166818) [2700 bp, 899 aa] {ON}
           YLR014C (REAL)
          Length = 899

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 25/44 (56%)

Query: 182 ACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           AC RCR KKI+CD + P C +CA +   C   D  + +  PR Y
Sbjct: 33  ACKRCRLKKIKCDQEFPSCKRCANLEVPCVSLDPATGKDVPRSY 76

 Score = 35.0 bits (79), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 57/264 (21%), Positives = 105/264 (39%), Gaps = 32/264 (12%)

Query: 568 LLIIIVQMGMLSKIKRDKITSGKLSTLMKYYDKLMTHIWINPYFNSRNTSIQVLQCLSML 627
            L II  +G  +++ +  IT     T+  Y  + +   +I   F+S +  ++ L    ++
Sbjct: 390 FLNIIFAIGHATQVLKSDIT-----TVATYKRRAVG--YITSLFSSSD-RLEALAGTLLM 441

Query: 628 LFYMLNVGDISSIYELRGKVVSMSQQLRLHRCPSAVLGGDGSTVSKVQQGERRILFWSIY 687
           + Y +   +I  ++   G V+ ++  L LH   S  +  +    ++     RR LFW +Y
Sbjct: 442 VIYSIMRPNIPGVWYTMGSVLRLTVDLGLH---SEKINKNYDAFTR---EVRRRLFWCVY 495

Query: 688 YLDVFSALQLGVPRLLKDFEIECALPVTSDD------DRQVNLAGQMIALEGKVSQFSLS 741
            LD       G P  + +  I    P   DD      ++ V+    +          +L+
Sbjct: 496 SLDRQICSYFGRPFGIPEESITTRYPSLLDDSFITLTNQDVDDYSDLPNANPSSKVIALA 555

Query: 742 VIRFAKVMGNILDSTFKRGMT-----TSLTKQAALVHENALDNWRHGLQKDLFFQLDVNG 796
           + +  ++  NI+   +  G       T L       H N L+ W H ++    F + +N 
Sbjct: 556 MFKIRRIQANIVRILYAPGAELPRKFTDLESWRIETH-NELERWFH-MEVPKNFDI-MNC 612

Query: 797 TINMDEFNQQKQYSKS----LSPR 816
             N   F     YSKS    LSP+
Sbjct: 613 KFNSTWFELNYHYSKSILYGLSPK 636

>Ecym_3112 Chr3 (203876..207310) [3435 bp, 1144 aa] {ON} similar to
           Ashbya gossypii AGR280C
          Length = 1144

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/211 (23%), Positives = 93/211 (44%), Gaps = 32/211 (15%)

Query: 508 LMQLFFQDWYELIPLFDKNEFNSYYEKFKLNVTDPNFFVRKDDTVFNNRTRSISYKIFSC 567
           L+  +F       PL D+ E   ++E +   +TD       +D  F +    + + + +C
Sbjct: 301 LLDTYFNRIQSKYPLLDEQEIYKFHEDY---ITDNLSEYSLNDYHFYSGRMWMVFSVAAC 357

Query: 568 LLIIIVQMGMLSKIKRDKITSGKLSTLMKYYDKLMTHIWINPYFNSRNTSIQVLQCLSML 627
           + I I +   LS  +         ST + Y  K  T + +           Q L+ L++L
Sbjct: 358 IHITIGRSLTLSPHRF-------FSTAIHYVSKCGTALSL----------FQQLEILTLL 400

Query: 628 LFYMLNVGDISSIYELRGKVVSMSQ-QLRLHRCPSAVLGGDGSTVSKVQQGERRILFWSI 686
           +FY++     S  Y++   V+++S+ +L LH+  S+               ++  LFWS+
Sbjct: 401 VFYVIRRDKDSVGYDIIKDVINISKNKLYLHKRTSS---------DNFASRKKLRLFWSV 451

Query: 687 YYLDVFSALQLGVPRLLKDFEIECALPVTSD 717
           Y L+    + +G P  + + EIE  LP+ S+
Sbjct: 452 YLLERMICVSIGKPYTISESEIE--LPIFSE 480

 Score = 36.2 bits (82), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 18/31 (58%)

Query: 180 AQACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210
           +++C  C+ +K +CD K P CT C   G  C
Sbjct: 38  SRSCLLCQRRKQKCDHKIPSCTACLKAGVRC 68

>ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly
           similar to uniprot|P50104 Saccharomyces cerevisiae
           YMR019W STB4 Protein that binds Sin3p in a two- hybrid
           assay
          Length = 912

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPR 223
           RV +AC+ C+ +K++CDG +P C  C   G ECK      RR + R
Sbjct: 12  RVRKACEICKRRKVKCDGSQP-CANCVKHGQECKYISGTVRRRYRR 56

>SAKL0A09856g Chr1 complement(867959..871021) [3063 bp, 1020 aa]
           {ON} some similarities with uniprot|P32862 Saccharomyces
           cerevisiae YKL038W RGT1 Glucose-responsive transcription
           factor that regulates expression of several glucose
           transporter (HXT) genes in response to glucose binds to
           promoters and acts both as a transcriptional activator
           and repressor
          Length = 1020

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 178 RVAQACDRCRAKKIRCDGKR--PQCTQCAAVGFECKISDKLSRRAFPRGY 225
           +V++ACD+CR KKI+CD     P C+ C  VG  C       +R   +GY
Sbjct: 31  KVSRACDQCRKKKIKCDVSEDNPVCSGCFKVGDRCTFERVPLKRGPSKGY 80

>NDAI0A08790 Chr1 complement(2026171..2029350) [3180 bp, 1059 aa]
           {ON} Anc_7.17
          Length = 1059

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 21/34 (61%)

Query: 177 YRVAQACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210
           YR++  C  CR  K +CD ++P C++C  +G  C
Sbjct: 47  YRLSFVCQECRKSKTKCDKEKPSCSRCLKIGITC 80

>AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL130W
          Length = 801

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 1/33 (3%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210
           RV +ACD CR KK++CD + P C  C    +EC
Sbjct: 13  RVTRACDECRKKKVKCDSRHP-CIHCTVYSYEC 44

 Score = 33.1 bits (74), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 53/109 (48%), Gaps = 9/109 (8%)

Query: 612 NSRNTSIQVLQCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLR--LHRCPSAVLGGDGS 669
           N+R+T  + +Q L +L  +      +S+ +      ++M   LR   HR  S     D  
Sbjct: 300 NARDT--EAIQTLCILFVFSQCSARLSTGHSY--VCLAMKSALREGFHRKLSP---EDEK 352

Query: 670 TVSKVQQGERRILFWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDD 718
             S ++Q  R+ LF+++Y ++VF    LG+P  L   + + +LP+   D
Sbjct: 353 KYSPLEQEMRKRLFYTLYKMEVFVNTMLGLPSSLSKDDYDQSLPLEISD 401

>Smik_2.438 Chr2 (786437..787846) [1410 bp, 469 aa] {ON} YBR297W
           (REAL)
          Length = 469

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 26/42 (61%), Gaps = 1/42 (2%)

Query: 179 VAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRA 220
           V  ACD CR ++++CDGK+P C++C    FEC     L +R 
Sbjct: 4   VKYACDFCRVRRVKCDGKKP-CSRCIQHDFECTYQQPLRKRG 44

>KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]
           {ON} some similarities with uniprot|P52960 Saccharomyces
           cerevisiae YOR363C PIP2 peroxisome induction pathway 2
           (PIP2) transcriptional activator of peroxisome
           proliferation may form heterodimer with Oaf1 to activate
           oleate-inducible gene expression activator of peroxisome
           proliferation
          Length = 619

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (63%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210
           R    CD CR +K++CD  +P C++CA  G EC
Sbjct: 10  RRLHVCDACRIRKLKCDKAKPNCSRCAKHGLEC 42

>TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa] {ON}
           Anc_4.113 YGL013C
          Length = 1207

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 23/36 (63%), Gaps = 1/36 (2%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKIS 213
           +V++ACD CR +KI+C G+RP C  C     EC  S
Sbjct: 12  KVSKACDNCRRRKIKCSGERP-CAGCKTYNCECIFS 46

 Score = 38.1 bits (87), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 38/175 (21%), Positives = 71/175 (40%), Gaps = 30/175 (17%)

Query: 597 YYDKLMTHIWINPYFNSRNTSIQVLQCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLRL 656
           YY+  + H+  + +FN+    I+ L+ L + L   L   +      +    ++ + Q+  
Sbjct: 542 YYNSTLYHL--DDHFNT----IEYLELLIVFLKQQLVASEFYGFERVLDVAINYAIQMGF 595

Query: 657 HRCPSAVLGGDGSTVSKVQQGERRILFWSIYYLDVFSALQLGVPRLLKDFEIECALP--- 713
            R    V       + + Q  +RR L+W +Y ++    ++ G P ++ + +I C LP   
Sbjct: 596 SRWEFYV------GLQEYQAEKRRQLWWKLYMIEKLHCMKRGFPSVINEDKINCLLPEKF 649

Query: 714 -----VTSDDDRQVNLAGQMIALEGKVSQFSLS----------VIRFAKVMGNIL 753
                + S+D            L   +S+ SLS           I F+K   NIL
Sbjct: 650 RFLGYLDSNDYFNKINNPNFNNLSENLSKLSLSDLKDYGNLGLTIIFSKFSNNIL 704

>NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON} 
          Length = 508

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 22/33 (66%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210
           R    C  CRA+K++CD +RP+C +C  +G EC
Sbjct: 15  RSYSGCWTCRARKVKCDTQRPKCCRCKQLGIEC 47

>Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar to
           Ashbya gossypii AER370W
          Length = 826

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210
           R+ +ACD CR KK++CD + P C  C    +EC
Sbjct: 17  RITRACDECRKKKVKCDNRHP-CIHCTVYSYEC 48

 Score = 36.2 bits (82), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 51/106 (48%), Gaps = 11/106 (10%)

Query: 617 SIQVLQCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLR--LHR--CPSAVLGGDGSTVS 672
           S++ +Q L +L  +       S+ Y      ++M   LR  LHR   P A +     + S
Sbjct: 307 SLEAIQTLCLLFMFAQCSARPSAGYMYLS--LAMKSALREGLHRNLTPEASM-----SFS 359

Query: 673 KVQQGERRILFWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDD 718
            ++   R+ +F++IY +DV     LG+PR +   + +  LP+T  D
Sbjct: 360 PIEIEMRKRVFYTIYRMDVMLNTMLGLPRSISKEDFDQELPLTISD 405

>SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON}
           weakly similar to uniprot|P39720 Saccharomyces
           cerevisiae YAL051W OAF1 Oleate-activated transcription
           factor acts alone and as a heterodimer with Pip2p
           activates genes involved in beta-oxidation of fatty
           acids and peroxisome organization and biogenesis
          Length = 922

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 28/46 (60%), Gaps = 2/46 (4%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPR 223
           R++  C  CR +KI+CD +RP C QCA  G  C + D + R+  PR
Sbjct: 20  RLSFVCLECRRRKIKCDKQRPCCIQCAEQGLTC-VYD-IERQPAPR 63

>CAGL0A00451g Chr1 (47557..50880) [3324 bp, 1107 aa] {ON} similar to
           uniprot|P12383 Saccharomyces cerevisiae YGL013c PDR1
           transcription factor
          Length = 1107

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 26/42 (61%), Gaps = 1/42 (2%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRR 219
           +V +ACD CR +KI+C+G +P C  C   G EC  +D  S +
Sbjct: 26  KVGKACDSCRRRKIKCNGLKP-CPSCTIYGCECTYTDAKSTK 66

 Score = 33.5 bits (75), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 6/67 (8%)

Query: 647 VVSMSQQLRLHRCPSAVLGGDGSTVSKVQQGERRILFWSIYYLDVFSALQLGVPRLLKDF 706
            V+ ++++  HR    V G + ST  K     RR+L+W +Y  +  S ++ G   ++ D 
Sbjct: 566 AVANAKKMGFHRWEFYV-GYEESTAEK-----RRLLWWKLYNYEKASTMKKGFFSVIDDA 619

Query: 707 EIECALP 713
            + C LP
Sbjct: 620 TVNCLLP 626

>KLTH0B00352g Chr2 complement(31952..34756) [2805 bp, 934 aa] {ON}
           weakly similar to uniprot|P25611 Saccharomyces
           cerevisiae YCR106W RDS1 Regulator of drug sensitivity
           transcriptional regulator
          Length = 934

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 24/43 (55%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRA 220
           R +  C  CR +KI+CD KRP+C++C   G  C      SR A
Sbjct: 14  RPSFVCQECRRRKIKCDKKRPRCSRCVDTGLPCTYLASGSRSA 56

>KAFR0F03410 Chr6 complement(677156..680143) [2988 bp, 995 aa] {ON}
           Anc_4.113 YGL013C
          Length = 995

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 25/37 (67%), Gaps = 1/37 (2%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISD 214
           +V QACD CR +K++C GK+P C+ C A   +C  S+
Sbjct: 18  KVRQACDNCRKRKLKCTGKQP-CSTCEAYSCDCIYSE 53

>YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}
           MAL33MAL-activator protein, part of complex locus MAL3;
           nonfunctional in genomic reference strain S288C
          Length = 468

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 26/41 (63%), Gaps = 1/41 (2%)

Query: 179 VAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRR 219
           V  ACD CR ++++CDGK+P C++C    F+C     L +R
Sbjct: 4   VKYACDYCRVRRVKCDGKKP-CSRCIEHNFDCTYQQPLKKR 43

>TBLA0A01210 Chr1 (276151..280419) [4269 bp, 1422 aa] {ON} Anc_1.380
           YLR256W
          Length = 1422

 Score = 47.4 bits (111), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 19/30 (63%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVG 207
           R+  +C  CR +K++CD KRP C QC   G
Sbjct: 113 RIPLSCTICRKRKVKCDKKRPHCNQCTKTG 142

>KNAG0I00560 Chr9 complement(93785..95776) [1992 bp, 663 aa] {ON}
           Anc_1.128 YJL206C
          Length = 663

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 83/183 (45%), Gaps = 18/183 (9%)

Query: 618 IQVLQCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLRLHRCPSAVLGGDGSTVSKVQQG 677
           ++ +Q + M+  Y+    D+S+ + L G  +  S +   H   S V    G TV  ++  
Sbjct: 266 LRTIQTVFMMSLYLQFCADLSAAHNLIGIALRSSIREGYHLKSSLV----GPTV--IEDE 319

Query: 678 ERRILFWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDDDRQVNLAGQ--MIALEGKV 735
            ++ LFWSIY ++ +    LG P  L D  I+  +P+  DDDR   L  Q  +    G  
Sbjct: 320 VKKRLFWSIYKMNAYLTSLLGFPTTLSDTLIDQEIPLDIDDDRITVLGIQEPLGTTAGDT 379

Query: 736 SQFSLSVI-----RFAKVMGNILD--STFKRGMTTS---LTKQAALVHENALDNWRHGLQ 785
           ++ S   +     R   V+ ++ +  STF  G T S     ++     E  +++WR  L 
Sbjct: 380 TRISSCGMNNEHTRLMTVLSHVYEYTSTFTLGATLSQVDTIREHISSLEREIESWRRDLP 439

Query: 786 KDL 788
           + L
Sbjct: 440 EPL 442

 Score = 37.7 bits (86), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210
           RV  AC  CR KK +CDG+ P C+ C    ++C
Sbjct: 30  RVRTACSMCRRKKRKCDGRVP-CSFCTKNHYQC 61

>Smik_11.240 Chr11 (395459..395932,395981..398437) [2931 bp, 976 aa]
           {ON} YKL015W (REAL)
          Length = 976

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 76/179 (42%), Gaps = 29/179 (16%)

Query: 618 IQVLQCLSMLLFYMLNVGDIS-SIYELRGKVVSMSQQLRLHRCPSAVLGGDGSTVSKVQQ 676
           I+VL    +L  + L V D + + Y   G+ +     L LH      +     T++K + 
Sbjct: 458 IEVL----LLYAFFLQVADYTLASYFYFGQALRTCLILGLH------VDSQSDTLTKYEI 507

Query: 677 GERRILFWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDDDRQVNLAGQMIALEGKVS 736
              R L+W++Y  +   + + G+P    D+ I  ALP   DD+           +EGK +
Sbjct: 508 EHHRRLWWTVYMFERMLSSKAGLPLSFTDYTISTALPADIDDE----------TIEGKNN 557

Query: 737 QFSL-------SVIRFAKVMGNILDSTFKRGMTTSLTKQAALVHENALDNWRHGLQKDL 788
           Q+         + +   K+   IL   ++R   T++     +V +  L+ WR+ L   L
Sbjct: 558 QYVFRKAELISNCVTIVKINAQILSKLYQRQPETNIIITLKVVIKQLLE-WRNNLSDSL 615

>KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa] {ON}
           some similarities with uniprot|P32862 Saccharomyces
           cerevisiae YKL038W RGT1 Glucose-responsive transcription
           factor that regulates expression of several glucose
           transporter (HXT) genes in response to glucose binds to
           promoters and acts both as a transcriptional activator
           and repressor
          Length = 979

 Score = 46.6 bits (109), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 178 RVAQACDRCRAKKIRCD--GKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           + ++ACD+CR KK RCD   +RP C+ C  +G  C       +R   +GY
Sbjct: 30  KTSRACDQCREKKTRCDFSDERPICSACQRMGKTCTFERVPMKRGPTKGY 79

>KAFR0E02330 Chr5 (468300..470414) [2115 bp, 704 aa] {ON} Anc_5.59
           YHR178W
          Length = 704

 Score = 46.6 bits (109), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 75/334 (22%), Positives = 134/334 (40%), Gaps = 56/334 (16%)

Query: 505 VEELMQLFFQDWYELIPLFDKNEF---NSYYEKFKLNVTDPNFFVRKDDTVFNNRTRSIS 561
           ++  +  FF+  + L P+ DK  F    S    F   + +  F    +D VF  +     
Sbjct: 262 LDRFIAAFFKHNHRLFPVIDKLSFIDRVSTIRVFDYELLNSAF----NDDVFIFQL---- 313

Query: 562 YKIFSCLLIIIVQMGMLSKIKRDKITSGKLSTL-MKYYDKLMTHIWINPYFNSRNTSIQV 620
           Y I +     + + GML  +K ++  S  L+ L MK +  +M              +I+ 
Sbjct: 314 YMIMAIGCTTLRRAGML--LKDEEELSEHLAFLSMKKFRTVMAL-----------QNIET 360

Query: 621 LQCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLRLHRCPSAVLGGDGSTVSKVQQGERR 680
           ++CL +L  Y       SS + + G ++ +   L L+R P   +     T+  ++   R 
Sbjct: 361 IKCLLLLGIYSFFEPKGSSSWTISGIIMRLVIALGLNRAP---VSKKLKTMPAIEVESRY 417

Query: 681 ILFWSIYYLDVFSALQLGVPRLLKDFEIECALP--VTSDDDRQVNLAGQMIALEGKVSQF 738
            +FWS Y  +   +  LG    + D EI   LP  + SD+   +++   MI L       
Sbjct: 418 RVFWSAYCFERLISTCLGRMSAIDDDEISVPLPHAMYSDEKEDIDVTNTMITLR------ 471

Query: 739 SLSVIRFAKVMGNILDSTFKRGMTTSLTKQAALVHENALDNWRHGLQKDLFFQLDVNGTI 798
                   ++ G I    +K   +    KQ   + E      R  +  DL  +LD  G  
Sbjct: 472 --------RIAGKI----YKNVHSVHAGKQDLTIEE------RQKIIVDLREELD--GIY 511

Query: 799 NMDEFNQQKQYSKSLSPRTAAFTHNSLVLMTLYF 832
            +++    KQ  KS S ++    H+S   +T+ +
Sbjct: 512 KLEQAKMDKQNKKSGSRKSNISFHSSESWLTMRY 545

 Score = 40.0 bits (92), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 20/38 (52%)

Query: 182 ACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRR 219
           +C RCR  K +C  + P C  C  VG EC    + +RR
Sbjct: 14  SCSRCRKLKKKCPREVPVCGHCVRVGAECSYPGRAARR 51

>KNAG0B05120 Chr2 (982236..984902) [2667 bp, 888 aa] {ON} 
          Length = 888

 Score = 46.6 bits (109), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 23/44 (52%)

Query: 182 ACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           AC RCR+KK +CD K P C +C  +   C   D  +    PR Y
Sbjct: 45  ACKRCRSKKTKCDQKLPSCGKCTKLNTPCISVDPATGEDVPRSY 88

>CAGL0M12298g Chr13 complement(1227303..1230287) [2985 bp, 994 aa]
           {ON} similar to uniprot|P39720 Saccharomyces cerevisiae
           YAL051w OAF1 peroxisome proliferating transcription
           factor or uniprot|P52960 Saccharomyces cerevisiae
           YOR363c PIP2
          Length = 994

 Score = 46.6 bits (109), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 29/46 (63%), Gaps = 2/46 (4%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPR 223
           R++  C  CR  K RCD ++P CT+C  +  EC + D +++++ PR
Sbjct: 22  RISFVCQACRRSKTRCDKEKPICTRCKKLKLEC-VYD-MAKQSAPR 65

>KNAG0E00210 Chr5 (24545..27391) [2847 bp, 948 aa] {ON} Anc_7.17
           YOR363C
          Length = 948

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210
           R++  C  CR  K +CD ++PQC +C  +G EC
Sbjct: 24  RLSYVCKACRTAKAKCDKEKPQCGRCYKLGVEC 56

>KLTH0G15180g Chr7 (1326581..1329871) [3291 bp, 1096 aa] {ON}
           similar to uniprot|Q05854 Saccharomyces cerevisiae
           YLR278C Protein of unknown function localizes to the
           nucleus potential Cdc28p substrate
          Length = 1096

 Score = 46.6 bits (109), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 74/324 (22%), Positives = 131/324 (40%), Gaps = 68/324 (20%)

Query: 487 FMTHTAVDHSSTHLNFAEVEELMQLFFQDWYELI----PLFDKNEFNSYYEKFKLNVTDP 542
           F  +   D  S    F   E+L + F   ++  +    PL D+ E  +++          
Sbjct: 224 FAKYCLKDFLSYDPAFEFEEQLSRAFLDTYFTRLQFKYPLLDEQEIYNFH---------- 273

Query: 543 NFFVRKDDTVFNN-RTRSISYKIFSC---LLIIIVQMGMLSKIKRDKITSGKLSTLM--K 596
                 DD + NN  + S +   F+C    LI  +   +       ++++GK   L+  +
Sbjct: 274 ------DDYINNNVHSYSTNEFHFACGRMWLIFSISACL-------QMSTGKYRGLLPNR 320

Query: 597 YYDKLMTHIWINPYFNSRNTSIQVLQCLSMLLFYMLNVG-DISSIYELRGKVVSMSQ-QL 654
           Y+   + HI       S  T IQ ++ LS+LL Y++    D S +YE+   V+++ + +L
Sbjct: 321 YFSTAIRHI---TKCGSNLTYIQQVEVLSLLLLYIIRTDRDSSGLYEIIKDVMAICKNKL 377

Query: 655 RLHRCPSAVLGGDGSTVSKVQQGERRILFWSIYYLDVFSALQLGVPRLLKDFEIECALPV 714
            L+R               + + ++  LFW +Y L+    + +G P  + + EI+  LP+
Sbjct: 378 FLNRW----------NQHDIFRNKKLRLFWCVYSLERMICVAVGKPYTISEAEID--LPL 425

Query: 715 ----------TSDDDRQ---VNLAGQMIALEGKVSQFSLSVIRFAKVMGNILDSTFKRGM 761
                     T D  RQ   ++   Q + L    SQF  S+    +      D+      
Sbjct: 426 FDNVSFNHNSTGDHKRQKKDIHFINQSLKLRRIESQFVESLQIIPQTPSKAKDT---HKT 482

Query: 762 TTSLTKQAALVHE--NALDNWRHG 783
           T  L KQ   V +    L+ WR G
Sbjct: 483 TAELAKQLPQVRKYFRDLEVWRAG 506

 Score = 35.8 bits (81), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 18/31 (58%)

Query: 180 AQACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210
           +++C  C+ +K RCD K P CT C     +C
Sbjct: 38  SRSCLLCQRRKRRCDHKMPSCTACLKAAVKC 68

>SAKL0B06732g Chr2 complement(578508..581144) [2637 bp, 878 aa] {ON}
           some similarities with uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger overexpression increases salt
           tolerance through increased expression of the ENA1 (Na
           /Li extrusion pump) gene while gene disruption decreases
           both salt tolerance and ENA1 expression
          Length = 878

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 28/42 (66%), Gaps = 1/42 (2%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRR 219
           RV++ACD CR+KKI+C+G++  C+ C   G  C  +  + +R
Sbjct: 11  RVSKACDSCRSKKIKCNGEQ-TCSNCLKYGCPCTYTHTIKKR 51

>Smik_11.210 Chr11 (352056..355565) [3510 bp, 1169 aa] {ON} YKL038W
           (REAL)
          Length = 1169

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 178 RVAQACDRCRAKKIRCDGK--RPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           + ++ACD+CR KKI+CD K  R  CT C   G  C       +R   +GY
Sbjct: 42  KASRACDQCRKKKIKCDYKDERGVCTNCQRNGDRCSFERVPLKRGPSKGY 91

>YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON}
           PDR1Zinc cluster protein that is a master regulator
           involved in recruiting other zinc cluster proteins to
           pleiotropic drug response elements (PDREs) to fine tune
           the regulation of multidrug resistance genes
          Length = 1068

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDK 215
           +V++ACD CR +KI+C+GK P C  C     EC  S +
Sbjct: 41  KVSKACDNCRKRKIKCNGKFP-CASCEIYSCECTFSTR 77

>KLLA0D12672g Chr4 complement(1076011..1078608) [2598 bp, 865 aa]
           {ON} uniprot|P08657 Kluyveromyces lactis LAC9 Lactose
           regulatory protein LAC9
          Length = 865

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 22/45 (48%)

Query: 181 QACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           QACD CR KK +C    P CT C     +C  S ++ R    R +
Sbjct: 93  QACDACRKKKWKCSKTVPTCTNCLKYNLDCVYSPQVVRTPLTRAH 137

 Score = 37.4 bits (85), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 54/116 (46%), Gaps = 10/116 (8%)

Query: 624 LSMLLFYMLNVGDISSIYELRGKVVSMSQQLRLHRCPSAVLGGDGSTVSKVQQGERRILF 683
           L +L  Y+  +   ++ + L G    M+  L LHR        D    +   Q  RR+L+
Sbjct: 473 LILLTHYVQKMHKPNTAWSLIGLCSHMATSLGLHR--------DLPNSTIHDQQLRRVLW 524

Query: 684 WSIYYLDVFSALQLGVPRLLKDFE-IECALPVTSDDDRQVNLAGQMIALEGKVSQF 738
           W+IY      +L+ G P LL + + I+  LP +S   ++ ++   +I  E + SQ 
Sbjct: 525 WTIYCTGCDLSLETGRPSLLPNLQAIDIPLPASSATIKEPSIYSSIIQ-ESQWSQI 579

>Smik_18.8 Chr18 (12069..14396) [2328 bp, 775 aa] {ON} YOR172W
           (REAL)
          Length = 775

 Score = 46.2 bits (108), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 25/38 (65%), Gaps = 9/38 (23%)

Query: 181 QACDRCRAKKIRCDGKRPQCTQCA---------AVGFE 209
           ++C+ CR +K+RCDGKRP+C+ C          A+GFE
Sbjct: 10  RSCELCRKRKLRCDGKRPRCSTCVRKKSSECTYAIGFE 47

>Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}
           YJL206C (REAL)
          Length = 833

 Score = 46.2 bits (108), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 53/104 (50%), Gaps = 6/104 (5%)

Query: 616 TSIQVLQCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLRLHRCPSAVLGGDGSTVSKVQ 675
           T I  +Q + M+  ++    ++ + Y   G  +  + +  LHR  S+++G      + +Q
Sbjct: 272 TEIYSIQAIFMMTIFLQCSANLKACYSFIGIALRAALKEGLHR-KSSIVGP-----TPIQ 325

Query: 676 QGERRILFWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDDD 719
              ++ LFWS+Y LD++    LG P  + + +I+   P+  DD+
Sbjct: 326 DETKKRLFWSVYKLDLYMNCILGFPSGIDESDIDQEFPLDVDDE 369

 Score = 40.8 bits (94), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 1/34 (2%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECK 211
           R  +AC  CR +K+RC G+ P C  C    FECK
Sbjct: 29  RAHRACVACRKRKVRCSGQTP-CRLCQNNSFECK 61

>KNAG0A07100 Chr1 complement(1113008..1116868) [3861 bp, 1286 aa]
           {ON} Anc_2.547 YKL038W
          Length = 1286

 Score = 46.2 bits (108), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 178 RVAQACDRCRAKKIRCD--GKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           + ++ACD+CR KKI+CD    R  CT C  +G  C       +R   +GY
Sbjct: 50  KASRACDQCRRKKIKCDYNDMRNICTNCQRIGERCSFERVPLKRGPTKGY 99

>TDEL0C05680 Chr3 complement(1020646..1022721) [2076 bp, 691 aa]
           {ON} Anc_1.128 YJL206C
          Length = 691

 Score = 45.8 bits (107), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 48/228 (21%), Positives = 99/228 (43%), Gaps = 26/228 (11%)

Query: 618 IQVLQCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLRLHRCPSAVLGGDGSTVSKVQQG 677
           I  +Q + ML  ++    ++ + Y   G  +  +    LHR  ++++G      + ++  
Sbjct: 290 IYAMQTMFMLTMFLQCSANLKTCYSYIGIALRAAISEGLHR-KNSLIGP-----TPIEDE 343

Query: 678 ERRILFWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDDDRQVNLAGQMIALEGKVSQ 737
            ++ LFWS+Y +D++    LG+PR L +  I   LP   DD++ +   G +    GK+S 
Sbjct: 344 TKKRLFWSVYKVDLYMNCILGLPRTLSESAINQELPRDVDDEK-ITTKGILAQDWGKISS 402

Query: 738 FSLS--VIRFAKVMGNILDSTFKRGMTTSLTKQAALVHENALDNWRHGLQKDLFFQLDVN 795
             ++    +   VM  I +S +        T    +  ++ L+ W        F +L + 
Sbjct: 403 CGMNNQHTKLMLVMARIHESLYPVLKWDQATYVNIINLQDKLNEW--------FIELPMQ 454

Query: 796 GTINMDEFNQQKQYSKSLSPRTAAFTHNSLVLMTLYFMAKCMIHLPVV 843
              +   FN+++        R      N L+ +  Y +AK +++ P +
Sbjct: 455 LKPDYQFFNEEE--------RNYYLKPNKLLYLD-YLLAKIILYKPFI 493

 Score = 42.0 bits (97), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 23/30 (76%), Gaps = 1/30 (3%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVG 207
           RV++AC+ CR+KK +CDG++P C  C  VG
Sbjct: 125 RVSRACEFCRSKKKKCDGQQP-CDLCKLVG 153

>KAFR0B01450 Chr2 (273614..276880) [3267 bp, 1088 aa] {ON} Anc_2.547
           YKL038W
          Length = 1088

 Score = 45.8 bits (107), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 178 RVAQACDRCRAKKIRCDG--KRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           + ++ACD+CR KK++CD    R  CT C   G +C       +R   +GY
Sbjct: 58  KASRACDQCRKKKVKCDNGDDRSVCTNCQRNGEKCTFERVPLKRGPSKGY 107

>CAGL0K05841g Chr11 (573144..577262) [4119 bp, 1372 aa] {ON} similar
           to uniprot|P12351 Saccharomyces cerevisiae YLR256w HAP1
           transcription factor
          Length = 1372

 Score = 45.8 bits (107), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVG 207
           RV  +C  CR +K++CD  RP CTQC   G
Sbjct: 66  RVPLSCTICRRRKVKCDKSRPNCTQCVKTG 95

>YJL206C Chr10 complement(47659..49935) [2277 bp, 758 aa] {ON}
           Putative protein of unknown function; similar to
           transcriptional regulators from the Zn[2]-Cys[6]
           binuclear cluster protein family; mRNA is weakly cell
           cycle regulated, peaking in S phase; induced rapidly
           upon MMS treatment
          Length = 758

 Score = 45.8 bits (107), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 53/104 (50%), Gaps = 6/104 (5%)

Query: 616 TSIQVLQCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLRLHRCPSAVLGGDGSTVSKVQ 675
           T I  +Q + M+  ++    ++ + Y   G  +  + +  LHR  S+++G      + +Q
Sbjct: 284 TDIYSIQAIFMMTIFLQCSANLKACYSFIGIALRAALKEGLHR-RSSIVGP-----TPIQ 337

Query: 676 QGERRILFWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDDD 719
              ++ LFWS+Y LD++    LG P  + + +I+   P+  DD+
Sbjct: 338 DETKKRLFWSVYKLDLYMNCILGFPSGIDESDIDQEFPLDVDDE 381

 Score = 38.9 bits (89), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECK 211
           R  +AC  CR +K+RC G  P C  C    +ECK
Sbjct: 42  RAHRACIACRKRKVRCSGNIP-CRLCQTNSYECK 74

>KLLA0F09559g Chr6 complement(876719..878695) [1977 bp, 658 aa] {ON}
           some similarities with uniprot|P35995 Saccharomyces
           cerevisiae YKL222c
          Length = 658

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGF-ECKISD 214
           +V ++C  CR +K++CD KRP CT C   G  EC  +D
Sbjct: 85  KVIKSCTFCRKRKLKCDRKRPMCTGCKMRGLSECVYTD 122

>TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON}
           Anc_3.109 YOL089C
          Length = 1178

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 4/37 (10%)

Query: 178 RVAQACDRCRAKKIRCDGKRP----QCTQCAAVGFEC 210
           RV++ACD CR +KI+CD KR     +C+ C     EC
Sbjct: 248 RVSRACDHCRKRKIKCDEKRDPNTNKCSNCIKYNSEC 284

>KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa] {ON}
           
          Length = 1136

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 28/46 (60%), Gaps = 2/46 (4%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPR 223
           R++  C  CR  K++CD ++P+CT+C   G +C   ++  R+  PR
Sbjct: 45  RISFVCQNCRKSKMKCDREKPECTRCLKQGIKCVYDEE--RQPRPR 88

>CAGL0L01903g Chr12 (220700..224563) [3864 bp, 1287 aa] {ON} similar
           to uniprot|P32862 Saccharomyces cerevisiae YKL038w RGT1
          Length = 1287

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 179 VAQACDRCRAKKIRCD--GKRPQCTQCAAVGFECKISDKLSRRAFPRG 224
           V++ACD+CR KKI+CD   +R  CT C   G  CK      +R   +G
Sbjct: 12  VSRACDQCRRKKIKCDRNQERNICTSCQRNGERCKFERVPLKRGPSKG 59

>Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa] {ON}
           YGL013C (REAL)
          Length = 1069

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDK 215
           +V++ACD CR +KI+C+GK P C  C     EC  + +
Sbjct: 38  KVSKACDNCRKRKIKCNGKFP-CASCEIYSCECTFTTR 74

>KLTH0H02684g Chr8 complement(235527..237776) [2250 bp, 749 aa] {ON}
           weakly similar to uniprot|P04386 Saccharomyces
           cerevisiae YPL248C GAL4 DNA-binding transcription factor
           required for the activation of the GAL genes in response
           to galactose repressed by Gal80p and activated by Gal3p
          Length = 749

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 24/45 (53%)

Query: 181 QACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           QACD CR KK++C  + P C+ C    ++C  S K  R    R +
Sbjct: 9   QACDWCRRKKLKCSREHPICSNCFKHNWDCHYSPKKVRSPLTRAH 53

>Skud_2.427 Chr2 (769889..771295) [1407 bp, 468 aa] {ON} YGR288W
           (REAL)
          Length = 468

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 182 ACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRR 219
           ACD CR ++++CDGK+P C +C    FEC     L +R
Sbjct: 7   ACDYCRVRRVKCDGKKP-CRRCLQHNFECTHQQPLKKR 43

>Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa] {ON}
           YGL013C (REAL)
          Length = 1080

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDK 215
           +V++ACD CR +KI+C+GK P C  C     EC  + +
Sbjct: 38  KVSKACDNCRKRKIKCNGKFP-CASCEIYSCECTFTSR 74

>NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON} 
          Length = 865

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 22/33 (66%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210
           R +  C  C+ +K+RCD +RP C++C  +G +C
Sbjct: 26  RRSHVCITCKNQKLRCDRERPSCSRCRRIGRDC 58

>TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON} Anc_6.60
           YLR266C
          Length = 795

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 22/33 (66%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210
           ++ +AC  CR +K++CD  +P+C QC++    C
Sbjct: 9   KIIKACVFCRKRKLKCDLTKPKCKQCSSRNLNC 41

>NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa] {ON}
           
          Length = 1113

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISD 214
           +V++AC  CR +KI+C G  P C+ CAA   EC   D
Sbjct: 32  KVSKACANCRRRKIKCTGTYP-CSNCAAYQCECIFDD 67

>Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {ON}
           YOL089C (REAL)
          Length = 1029

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 27/47 (57%), Gaps = 5/47 (10%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQ---CTQCAAVGFEC--KISDKLSRR 219
           RV++ACD CR +KIRCD   PQ   C+ C      C  K  D++ R+
Sbjct: 128 RVSKACDHCRKRKIRCDEVDPQTNKCSNCVKFQSACTFKHRDEILRK 174

>KLLA0A09119g Chr1 complement(797533..800781) [3249 bp, 1082 aa]
           {ON} weakly similar to uniprot|P12383 Saccharomyces
           cerevisiae YGL013C PDR1 Zinc cluster protein that is a
           master regulator involved in recruiting other zinc
           cluster proteins to pleiotropic drug response elements
           (PDREs) to fine tune the regulation of multidrug
           resistance genes
          Length = 1082

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 22/36 (61%), Gaps = 1/36 (2%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKIS 213
           +V++ACD CR KKI+C G  P C  C   G EC  S
Sbjct: 50  KVSRACDSCRKKKIKCSGTLP-CKSCETYGCECVYS 84

>Suva_6.285 Chr6 (499581..501941) [2361 bp, 786 aa] {ON} YJL206C
           (REAL)
          Length = 786

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 52/104 (50%), Gaps = 6/104 (5%)

Query: 616 TSIQVLQCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLRLHRCPSAVLGGDGSTVSKVQ 675
           T I  +Q + M+  ++    ++ + Y   G  +  + +  LHR  S++ G      + +Q
Sbjct: 305 TDIYSIQAIFMMTIFLQCSANLKACYSFIGIALRAALKEGLHR-KSSITGP-----TAIQ 358

Query: 676 QGERRILFWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDDD 719
              ++ LFWS+Y LD++    LG P  + + +I+   P+  DD+
Sbjct: 359 DETKKRLFWSVYKLDLYMNCILGFPSGIDESDIDQEFPLDVDDE 402

>KLLA0F22990g Chr6 (2134385..2138146) [3762 bp, 1253 aa] {ON}
           uniprot|Q6DR96 Kluyveromyces lactis HAP1
          Length = 1253

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVG 207
           RV  +C  CR +K++CD  RPQC QC   G
Sbjct: 20  RVPLSCTICRKRKVKCDKGRPQCQQCVKTG 49

>TBLA0G01130 Chr7 (287952..291350) [3399 bp, 1132 aa] {ON} Anc_8.879
           YML099C
          Length = 1132

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 21/34 (61%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECK 211
           R    C  CR++KI+CD ++PQC +C     +C+
Sbjct: 11  RTYSGCWTCRSRKIKCDQQKPQCKRCLKANLKCE 44

>TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.109
           YOL089C
          Length = 996

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 27/47 (57%), Gaps = 5/47 (10%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQ---CTQCAAVGFEC--KISDKLSRR 219
           RVA+ACD CR +KI+CD   PQ   C+ C      C  ++ D + +R
Sbjct: 113 RVARACDHCRRRKIKCDPVNPQTNKCSNCTKYDANCTFRVRDDVEKR 159

>SAKL0D01100g Chr4 complement(81235..84057) [2823 bp, 940 aa] {ON}
           weakly similar to uniprot|P33200 Saccharomyces
           cerevisiae YBL005W PDR3 Transcriptional activator of the
           pleiotropic drug resistance network regulates expression
           of ATP-binding cassette (ABC) transporters through
           binding to cis-acting sites known as PDREs (PDR
           responsive elements)
          Length = 940

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 25/36 (69%), Gaps = 1/36 (2%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKIS 213
           +V++ACD CR +KI+C GK+P C+ C A    C+ S
Sbjct: 23  KVSRACDNCRRRKIKCTGKQP-CSNCQAYQCHCEYS 57

>TPHA0N00230 Chr14 (39855..43553) [3699 bp, 1232 aa] {ON} Anc_7.17
           YOR363C
          Length = 1232

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 19/33 (57%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210
           R++  C  CR  K +CD K+P C +C   G +C
Sbjct: 47  RISFVCQHCRKSKTKCDKKQPHCARCIKHGIQC 79

>Ecym_2732 Chr2 (1410290..1413886) [3597 bp, 1198 aa] {ON} similar
           to Ashbya gossypii AFR117C
          Length = 1198

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 19/30 (63%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVG 207
           R+  +C  CR +K+RCD  +P CTQC   G
Sbjct: 14  RIPLSCTICRKRKVRCDKTKPHCTQCVKTG 43

>TBLA0D00630 Chr4 complement(164651..167884) [3234 bp, 1077 aa] {ON}
           Anc_7.389 YBL066C
          Length = 1077

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 3/39 (7%)

Query: 177 YRVAQACDRCRAKKIRCDG--KRPQ-CTQCAAVGFECKI 212
           +R   +C  CR +KIRC+   K+PQ CT+CA +  +C I
Sbjct: 25  HRPVTSCTHCRQQKIRCNALQKQPQPCTRCAKLNLKCNI 63

>SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON}
           similar to uniprot|P05085 Saccharomyces cerevisiae
           YML099C ARG81 Zinc-finger transcription factor of the
           Zn(2)-Cys(6) binuclear cluster domain type involved in
           the regulation of arginine-responsive genes acts with
           Arg80p and Arg82p
          Length = 848

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 19/29 (65%)

Query: 182 ACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210
            C  CR++K++CD  RP C +C   GFEC
Sbjct: 19  GCWTCRSRKVKCDLGRPSCKRCERSGFEC 47

>Skud_11.190 Chr11 (345221..348736) [3516 bp, 1171 aa] {ON} YKL038W
           (REAL)
          Length = 1171

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 178 RVAQACDRCRAKKIRCDGK--RPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           + ++ACD+CR KKI+CD K  R  C+ C   G  C       +R   +GY
Sbjct: 42  KASRACDQCRKKKIKCDYKDERGVCSNCQRNGDRCSFERVPLKRGPSKGY 91

>NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}
           Anc_7.17 YAL051W
          Length = 944

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 22/34 (64%)

Query: 177 YRVAQACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210
           YR++  C  CR  K++CD ++P C++C+    EC
Sbjct: 34  YRLSFVCQGCRRSKVKCDQEKPVCSRCSKHDLEC 67

>SAKL0A00704g Chr1 complement(78811..80967) [2157 bp, 718 aa] {ON}
           similar to uniprot|P35995 Saccharomyces cerevisiae
           YKL222C Hypothetical ORF and similar to uniprot|Q12340
           Saccharomyces cerevisiae YOR172W
          Length = 718

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 1/46 (2%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGF-ECKISDKLSRRAFP 222
           +V ++C  CR +K++CD K+P+C+ CAA    EC   +K +    P
Sbjct: 14  KVIKSCLFCRKRKLKCDHKKPKCSTCAARNLPECVYVEKFTHEIDP 59

>Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911 aa]
           {ON} YMR019W (REAL)
          Length = 911

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPR 223
           RV +AC+ C+ +K++CDG RP C  C+    EC+   K + R   R
Sbjct: 41  RVQKACEICKRRKVKCDGNRP-CLNCSKHKKECRYDFKATNRRKKR 85

>TBLA0A09760 Chr1 complement(2398683..2403275) [4593 bp, 1530 aa]
           {ON} Anc_6.75 YLR278C
          Length = 1530

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 23/43 (53%)

Query: 180 AQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFP 222
           +++C  CR +K RCD K P CT C   G +C    + S  A P
Sbjct: 38  SKSCLLCRRRKQRCDHKLPSCTACLKAGVKCVQPARYSNNAAP 80

 Score = 33.9 bits (76), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 46/215 (21%), Positives = 92/215 (42%), Gaps = 39/215 (18%)

Query: 513 FQDWYELIPLFDKNE------FNSYYEK--FKLNVTDPNFFVRKDDTVFNNRTRSISYKI 564
            Q+++   P F+ NE       N+Y+ +  FK  V D N      +   NN+  S S   
Sbjct: 344 LQEFFNYDPAFEFNEELSRLFLNTYFTRLQFKYPVLDENEIYSFHENYINNKIHSFSNND 403

Query: 565 F-----SCLLIIIVQMGMLSKIKRDKITSGKLSTL--MKYYDKLMTHIWINPYFNSRNTS 617
           F        LI  +   +        +T+GK + L  ++Y+   + HI      ++  T 
Sbjct: 404 FHFNYGKMWLIFSISAYL-------HMTTGKYNGLPPVRYFSTAVRHI---TRCSNNLTD 453

Query: 618 IQVLQCLSMLLFYMLNVG-DISSIYELRGKVVSMSQ-QLRLHRCPSAVLGGDGSTVSKVQ 675
           +Q ++ L++L+ Y++    D   +Y++   V+ ++Q  L+L                   
Sbjct: 454 LQKVELLALLVLYIMKTDQDSLLLYDIIKDVMQIAQFNLKL-----------NKYNPNNP 502

Query: 676 QGERRI-LFWSIYYLDVFSALQLGVPRLLKDFEIE 709
              R+I +FWS+Y L+    + +G   ++ + +I+
Sbjct: 503 NKFRQIRIFWSLYLLERTICVAVGKSYIISEKDID 537

>TPHA0A06090 Chr1 complement(1372559..1375102) [2544 bp, 847 aa]
           {ON} 
          Length = 847

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 19/33 (57%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210
           R+   C  CR KK++CD K+P C +C   G  C
Sbjct: 9   RLNNGCWTCRTKKVKCDSKKPFCDKCKDSGLHC 41

>Suva_16.25 Chr16 complement(31437..31868) [432 bp, 143 aa] {ON}
           YGR288W (REAL)
          Length = 143

 Score = 41.6 bits (96), Expect = 0.003,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 1/42 (2%)

Query: 179 VAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRA 220
           V QACD CR ++++CDGK P C +C      C     L +R 
Sbjct: 37  VKQACDCCRVRRVKCDGKGP-CGRCLQRDLNCTYLQPLRKRG 77

>Kwal_26.8109 s26 complement(650270..653182) [2913 bp, 970 aa] {ON}
           YKL038W (RGT1) - 1:1 [contig 55] FULL
          Length = 970

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 178 RVAQACDRCRAKKIRCD--GKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           + ++ACD+CR KK RCD   + P CT C  +   C       +R   +GY
Sbjct: 34  KTSRACDQCRGKKTRCDFSDENPVCTSCQRMSKTCTFERVPMKRGPTKGY 83

>ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some
           similarities with uniprot|P39529 Saccharomyces
           cerevisiae YJL206C
          Length = 571

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDK 215
           RV+ ACD CR KK +CDG++P C  C     EC  SD+
Sbjct: 23  RVSHACDNCRLKKKKCDGQQP-CKLCKNSENECIYSDR 59

 Score = 40.4 bits (93), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 24/108 (22%), Positives = 52/108 (48%), Gaps = 6/108 (5%)

Query: 616 TSIQVLQCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLRLHRCPSAVLGGDGSTVSKVQ 675
           T +  +Q + ML  ++   G++   Y   G  +  +    LHR  S+++G      + ++
Sbjct: 184 TDVYSIQTMFMLTMFLQCSGNLKRCYSYMGIALRAAIAEGLHR-KSSLMGP-----TPIE 237

Query: 676 QGERRILFWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDDDRQVN 723
              ++ LFW++Y +D++    +G+P+ +    +   LP   DD+   N
Sbjct: 238 DESKKRLFWTVYKVDIYMNCIMGLPQSISQKTVNMELPKDLDDENITN 285

>Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}
           YJL206C (REAL)
          Length = 772

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 53/104 (50%), Gaps = 6/104 (5%)

Query: 616 TSIQVLQCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLRLHRCPSAVLGGDGSTVSKVQ 675
           T I  +Q + M+  ++    ++ + Y   G  +  + +  LHR  S+++G      + ++
Sbjct: 296 TDIYSIQAIFMMTIFLQCSANLKACYSFIGIALRAALKDGLHR-KSSIVGP-----TPIE 349

Query: 676 QGERRILFWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDDD 719
              ++ LFWS+Y LD++    LG P  + + +I+   P+  DD+
Sbjct: 350 DETKKRLFWSVYKLDLYMNCILGFPSGIDESDIDQEFPLDVDDE 393

 Score = 40.8 bits (94), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 1/34 (2%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECK 211
           R  +AC  CR +K+RC G+ P C  C    FECK
Sbjct: 53  RAHRACVACRKRKVRCSGQTP-CRLCQNNSFECK 85

>Skud_11.214 Chr11 (389377..389855,389895..392361) [2946 bp, 981 aa]
           {ON} YKL015W (REAL)
          Length = 981

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/177 (22%), Positives = 78/177 (44%), Gaps = 17/177 (9%)

Query: 618 IQVLQCLSMLLFYMLNVGDIS-SIYELRGKVVSMSQQLRLHRCPSAVLGGDGSTVSKVQQ 676
           I+VL    +L  + L V D + + Y   G+ +     L LH      +     T+S+ + 
Sbjct: 460 IEVL----LLYAFFLQVADYTLASYFYFGQGLRTCLILGLH------VDSQSDTLSRYEI 509

Query: 677 GERRILFWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDDDRQVNLAGQMIALEGKVS 736
              R L+W++Y  +   + + G+P    D+ I  ALP   DD++  +     +    ++ 
Sbjct: 510 EHHRRLWWTVYMFERMLSSKAGLPLSFTDYTISTALPADIDDEKPEHKDNHYVFRRAELI 569

Query: 737 QFSLSVIRFAKVMGNILDSTFKRGMTTSLTKQAALVHENALDNWRHGLQKDLFFQLD 793
              ++++   K+   IL   ++R   T++     +V +  L  WR+ L    F Q+D
Sbjct: 570 SNCVTIV---KINAQILSKLYQRQPETNIIITLKVVIKQLLQ-WRNNLSD--FLQVD 620

>Kpol_538.42 s538 complement(89752..93018) [3267 bp, 1088 aa] {ON}
           complement(89752..93018) [3267 nt, 1089 aa]
          Length = 1088

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 23/42 (54%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRR 219
           R++  C +CR  K RCD ++P CT+C      C    +L ++
Sbjct: 34  RISFVCQQCRKAKTRCDKEQPNCTRCIKNNLNCIYDIELQKK 75

>KAFR0L02130 Chr12 (403953..406601) [2649 bp, 882 aa] {ON} Anc_8.879
           YML099C
          Length = 882

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 19/29 (65%)

Query: 182 ACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210
            C  CRA+K++CD  RP CT+C   G +C
Sbjct: 21  GCWTCRARKVKCDLTRPSCTRCERSGLKC 49

>NCAS0C00220 Chr3 (22532..25051) [2520 bp, 839 aa] {ON} Anc_8.879
          Length = 839

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 19/29 (65%)

Query: 182 ACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210
            C  CR++K++CD +RP C +C   G EC
Sbjct: 20  GCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48

>Suva_11.213 Chr11 (392506..392993,393045..395514) [2958 bp, 985 aa]
           {ON} YKL015W (REAL)
          Length = 985

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 50/251 (19%), Positives = 107/251 (42%), Gaps = 25/251 (9%)

Query: 552 VFNNRTRSISYKIFSCLLIIIVQMGML------SKIKRDKITSGKL--STLMKYYDKLMT 603
           VF+N    I   ++ C +++I+ +G +      +++ ++     KL  S   +   K+  
Sbjct: 389 VFDNENDPILQAVWFCKILLILAVGEMYLGSINNEMLKNYSNQPKLPGSKFFQMGSKIFN 448

Query: 604 HIWINPYFNSRNTSIQVLQCLSMLLFYMLNVGDIS-SIYELRGKVVSMSQQLRLHRCPSA 662
            ++      ++   I+VL    +L  + L V D + + Y   G+ +     L LH     
Sbjct: 449 CLFSRLENVTKKGGIEVL----LLYAFFLQVADYTLASYFYFGQALRTCLILGLH----- 499

Query: 663 VLGGDGSTVSKVQQGERRILFWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDDDRQV 722
            +     T+S+ +    R L+W++Y  +   + + G+P    D+ I   LP   DD    
Sbjct: 500 -VDSQSDTLSRFEIEHHRRLWWTVYMFERMLSSKAGLPLSFTDYTISTELPADIDDKSSR 558

Query: 723 NLAGQMIALEGKVSQFSLSVIRFAKVMGNILDSTFKRGMTTSLTKQAALVHENALDNWRH 782
           +     +  + ++    ++++   K+   IL   ++R   T++     +V +  L  WR+
Sbjct: 559 SKNNHYVFRKAELISNCVTIV---KINAQILSKLYQRQPETNIMITLKVVIKQLLQ-WRN 614

Query: 783 GLQKDLFFQLD 793
            L    F Q+D
Sbjct: 615 NLSD--FLQVD 623

>KNAG0A02550 Chr1 complement(262867..265059) [2193 bp, 730 aa] {ON}
           Anc_8.423 YLR228C
          Length = 730

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 22/38 (57%)

Query: 182 ACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRR 219
            CD C+ ++++CD  +P C +CA +  EC  +    RR
Sbjct: 33  GCDNCKRRRVKCDEGKPFCQKCANMRLECVFTPPQPRR 70

>SAKL0D14520g Chr4 complement(1192788..1195739) [2952 bp, 983 aa]
           {ON} similar to uniprot|P39720 Saccharomyces cerevisiae
           YAL051W OAF1 Oleate-activated transcription factor acts
           alone and as a heterodimer with Pip2p activates genes
           involved in beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 983

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210
           R++  C  CR  K +CD ++P CT+C   G EC
Sbjct: 23  RISFVCKACRKSKTKCDREKPSCTRCIKNGIEC 55

>Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {ON}
           YOL089C (REAL)
          Length = 1032

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 23/33 (69%), Gaps = 1/33 (3%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCA-AVGFE 209
           RV++ACD CR +KIRCD   PQ  +C+  V F+
Sbjct: 131 RVSKACDHCRKRKIRCDEVDPQTDKCSNCVKFQ 163

>SAKL0C09944g Chr3 complement(899127..902312) [3186 bp, 1061 aa]
           {ON} weakly similar to uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger overexpression increases salt
           tolerance through increased expression of the ENA1 (Na
           /Li extrusion pump) gene while gene disruption decreases
           both salt tolerance and ENA1 expression
          Length = 1061

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 3/36 (8%)

Query: 178 RVAQACDRCRAKKIRCDGKRP---QCTQCAAVGFEC 210
           RV++ACD CR +KI+CD  +P   +C+ C     EC
Sbjct: 134 RVSKACDHCRKRKIKCDDVKPRTGKCSNCTKFNAEC 169

 Score = 38.1 bits (87), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 53/116 (45%), Gaps = 10/116 (8%)

Query: 618 IQVLQCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLRLHRCPSAVLGGDGSTVSKVQQG 677
           I+ +Q + +L  YM     +   Y +    V  +Q + LH   +         +S  +  
Sbjct: 495 IKPIQGMLLLYQYMRTNLSVEIGYSIFATAVRFAQDMSLHNLDTY------KRLSYKECL 548

Query: 678 ERRILFWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDDDRQVNLAGQMIALEG 733
           +RRIL+W  Y  D F +L+L  P L+ + +    + V +D+   V + GQ++   G
Sbjct: 549 KRRILWWHCYTTDKFLSLKLCKPSLINERD----MTVLTDESYVVLIKGQLLPQVG 600

>NCAS0A04750 Chr1 (944929..948354) [3426 bp, 1141 aa] {ON} Anc_2.547
          Length = 1141

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 178 RVAQACDRCRAKKIRCD--GKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           + ++ACD+CR KKI+CD   ++  C+ C   G +C       +R   +GY
Sbjct: 70  KASRACDQCRKKKIKCDFSEEKTLCSNCQRNGEKCTFERVPLKRGPSKGY 119

>NDAI0D03550 Chr4 complement(843265..846621) [3357 bp, 1118 aa] {ON}
           Anc_4.113
          Length = 1118

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRR 219
           +V +ACD CR +KI+C GK P C  C A    C  S +  R+
Sbjct: 58  KVTKACDNCRRRKIKCTGKTP-CATCEAYQCLCIYSTQRGRK 98

>ACL058W Chr3 (261723..264176) [2454 bp, 817 aa] {ON} NOHBY305; No
           homolog in Saccharomyces cerevisiae
          Length = 817

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 50/88 (56%), Gaps = 8/88 (9%)

Query: 636 DISSIYELRGKVVSMSQQLRLHRCPSAVLGGDGSTVSKVQQGERRILFWSIYYLDVFSAL 695
           +ISS+ +L      ++Q+L+L   P  V G     ++ VQ   RRI+FW I+ LD  ++L
Sbjct: 269 NISSVAQL----ARLAQRLQLTADPEYVPGS--REMADVQ--FRRIIFWQIFQLDTLTSL 320

Query: 696 QLGVPRLLKDFEIECALPVTSDDDRQVN 723
           Q  +P LL+  E E +LP   D+  ++N
Sbjct: 321 QNRLPPLLRYNECETSLPSEFDEGGKLN 348

>Kpol_345.3 s345 complement(7411..11517) [4107 bp, 1368 aa] {ON}
           complement(7411..11517) [4107 nt, 1369 aa]
          Length = 1368

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 48/216 (22%), Positives = 95/216 (43%), Gaps = 40/216 (18%)

Query: 508 LMQLFFQDWYELIPLFDKNEFNSYYEKFKLNVTDPNFFVRKDDTVFNNRTRSISYKIFSC 567
            + +FF       PL D+NE   +++++   + +  + + + D  F      +++ I +C
Sbjct: 351 FLDIFFTRLQFKYPLLDENEIYEFHDRY---IRNDVYSLSEIDFHFACGRMWLAFSISAC 407

Query: 568 LLIIIVQMGMLSKIKRDKITSGKLSTL--MKYYDKLMTHIWINPYFNSRNTSIQVLQCLS 625
           L                 +T+GK   L   +Y+   + HI +     S    +Q ++ L+
Sbjct: 408 L----------------HMTTGKYRGLPPERYFSTAIRHITL---CGSNLNYVQQVEILT 448

Query: 626 MLLFYMLNVG-DISSIYELRGKVVSMSQ-QLRLHRC-PSAVLGGDGSTVSKVQQGERRIL 682
           +L+ Y+L    D   +YE+   V+ +++  L L+R  P+   G            ++  L
Sbjct: 449 LLVLYILRTDRDSLVLYEIIKDVMMIAKNHLNLNRLQPNDPFGN-----------KKLRL 497

Query: 683 FWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDD 718
           FW IY L+    + +G P  + + EI+  LP+ S D
Sbjct: 498 FWCIYLLERMICVAVGRPYTISESEID--LPLFSID 531

 Score = 39.3 bits (90), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 17/31 (54%)

Query: 180 AQACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210
           +++C  CR +K RCD K P CT C      C
Sbjct: 38  SRSCLLCRRRKQRCDHKMPSCTACLKAAVRC 68

>KLLA0F25630g Chr6 (2378464..2381487) [3024 bp, 1007 aa] {ON} some
           similarities with uniprot|P32862 Saccharomyces
           cerevisiae YKL038W RGT1 Glucose-responsive transcription
           factor that regulates expression of several glucose
           transporter (HXT) genes in response to glucose binds to
           promoters and acts both as a transcriptional activator
           and repressor
          Length = 1007

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 7/55 (12%)

Query: 178 RVAQACDRCRAKKIRCD-------GKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           +V++ACD+CR KKI+CD            CT C  +G +C       +R   +GY
Sbjct: 112 KVSRACDQCRKKKIKCDFIEGHDINPDQSCTGCRKIGEKCSFERIPLKRGPSKGY 166

>CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some
           similarities with uniprot|Q12180 Saccharomyces
           cerevisiae YOL089c HAL9 or uniprot|P38114 Saccharomyces
           cerevisiae YBR150c TBS1
          Length = 1049

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 3/36 (8%)

Query: 178 RVAQACDRCRAKKIRCDGKRP---QCTQCAAVGFEC 210
           R  +ACD CR +KIRCD   P   +C+ C     EC
Sbjct: 36  RSTKACDHCRKRKIRCDEVNPVTNKCSNCVKFKVEC 71

>CAGL0B03421g Chr2 complement(336071..340138) [4068 bp, 1355 aa]
           {ON} similar to uniprot|P12351 Saccharomyces cerevisiae
           YLR256w HAP1 transcription factor
          Length = 1355

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVG 207
           R+  +C  CR +K++CD  RP C QC   G
Sbjct: 18  RIPLSCTICRKRKVKCDKTRPHCNQCTKTG 47

>KAFR0I02030 Chr9 complement(416471..420172) [3702 bp, 1233 aa] {ON}
           Anc_1.380 YLR256W
          Length = 1233

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVG 207
           R+  +C  CR +K++CD  RP C QC   G
Sbjct: 33  RIPLSCTICRKRKVKCDKIRPHCNQCTKTG 62

>YKL015W Chr11 (408544..411483) [2940 bp, 979 aa] {ON}
           PUT3Transcriptional activator of proline utilization
           genes, constitutively binds PUT1 and PUT2 promoter
           sequences as a dimer and undergoes a conformational
           change to form the active state; differentially
           phosphorylated in the presence of different nitrogen
           sources; has a Zn(2)-Cys(6) binuclear cluster domain
          Length = 979

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 75/172 (43%), Gaps = 15/172 (8%)

Query: 618 IQVLQCLSMLLFYMLNVGDIS-SIYELRGKVVSMSQQLRLHRCPSAVLGGDGSTVSKVQQ 676
           I+VL    +L  + L V D + + Y   G+ +     L LH      +     T+S+ + 
Sbjct: 461 IEVL----LLYAFFLQVADYTLASYFYFGQALRTCLILGLH------VDSQSDTLSRYEI 510

Query: 677 GERRILFWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDDDRQVNLAGQMIALEGKVS 736
              R L+W++Y  +   + + G+P    D+ I  ALP   DD+         +  + ++ 
Sbjct: 511 EHHRRLWWTVYMFERMLSSKAGLPLSFTDYTISTALPADIDDETIEEKNSHYVFRKAELI 570

Query: 737 QFSLSVIRFAKVMGNILDSTFKRGMTTSLTKQAALVHENALDNWRHGLQKDL 788
              ++++   K+   IL   ++R   T++     +V +  L+ WR+ L   L
Sbjct: 571 SNCVTIV---KINAQILSKLYQRQPETNIIITLKVVIKQLLE-WRNNLSDSL 618

>KAFR0C04980 Chr3 (987900..990755) [2856 bp, 951 aa] {ON} Anc_7.17
           YOR363C
          Length = 951

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 22/41 (53%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSR 218
           R++  C  CR  K +CD ++P C++C     EC    +L R
Sbjct: 60  RISFVCQACRKAKTKCDKEKPMCSRCRKQDLECVYDIELQR 100

>YKL038W Chr11 (365605..369117) [3513 bp, 1170 aa] {ON}
           RGT1Glucose-responsive transcription factor that
           regulates expression of several glucose transporter
           (HXT) genes in response to glucose; binds to promoters
           and acts both as a transcriptional activator and
           repressor
          Length = 1170

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQ--CTQCAAVGFECKISDKLSRRAFPRGY 225
           + ++ACD+CR KKI+CD K  +  C+ C   G  C       +R   +GY
Sbjct: 42  KASRACDQCRKKKIKCDYKDEKGVCSNCQRNGDRCSFDRVPLKRGPSKGY 91

>KNAG0I01450 Chr9 (277513..281943) [4431 bp, 1476 aa] {ON} 
          Length = 1476

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVG 207
           R+  +C  CR +K++CD  RP C QC   G
Sbjct: 47  RIPLSCTICRKRKVKCDKTRPHCNQCTKTG 76

>Suva_7.268 Chr7 complement(460629..463631) [3003 bp, 1000 aa] {ON}
           YGL013C (REAL)
          Length = 1000

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDK 215
           +V++ACD CR +KI+C+GK P C  C     EC  + +
Sbjct: 38  KVSKACDNCRKRKIKCNGKFP-CASCEIYLCECTFTTR 74

 Score = 35.8 bits (81), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 50/122 (40%), Gaps = 20/122 (16%)

Query: 592 STLMKYYDKLMTHIWINPYFNSRNTSIQVLQCLSMLLFYMLNVGDISSIYELRGKVVSMS 651
           STL  Y D           F    T ++ L   S LLF++  +     +  +    VS  
Sbjct: 452 STLYNYVD-----------FTCDVTHLEQLLYFSDLLFWLAEIYGFEKVLNVAVHFVS-- 498

Query: 652 QQLRLHRCPSAVLGGDGSTVSKVQQGERRILFWSIYYLDVFSALQLGVPRLLKDFEIECA 711
            ++ L R    V G D +   +     RR L+W  YY +   A +LG P  + D +I C 
Sbjct: 499 -RVGLSRWEFYV-GLDEAFAER-----RRSLWWKAYYFEKTLASKLGYPSNIDDSKINCL 551

Query: 712 LP 713
           LP
Sbjct: 552 LP 553

>NDAI0G05260 Chr7 (1277631..1282376) [4746 bp, 1581 aa] {ON}
           Anc_1.380 YLR256W
          Length = 1581

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVG 207
           RV  +C  CR +K++CD  RP C QC   G
Sbjct: 61  RVPLSCTICRKRKVKCDKIRPHCQQCTKTG 90

>NCAS0C02730 Chr3 (513280..515607) [2328 bp, 775 aa] {ON} Anc_8.423
          Length = 775

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 22/39 (56%)

Query: 182 ACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRA 220
            CD C+ ++++CD  +P C +C  +  EC  S    R+A
Sbjct: 57  GCDNCKRRRVKCDELKPTCQKCINMNLECVYSMPKPRKA 95

>Smik_1.13 Chr1 (31514..34654) [3141 bp, 1046 aa] {ON} YAL051W
           (REAL)
          Length = 1046

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 29/46 (63%), Gaps = 2/46 (4%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPR 223
           R++  C  CR  K +CD ++P+C++C   G +C + D +S++  PR
Sbjct: 61  RISFVCQACRKSKTKCDREKPECSRCIKHGLKC-VYD-VSKQPAPR 104

>Kpol_467.1 s467 (471..4340) [3870 bp, 1289 aa] {ON} (471..4340)
           [3870 nt, 1290 aa]
          Length = 1289

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVG 207
           R+  +C  CR +K++CD  RP C QC   G
Sbjct: 22  RIPLSCTICRKRKVKCDKTRPHCNQCTKTG 51

>KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa] {ON}
           conserved hypothetical protein
          Length = 370

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 24/37 (64%), Gaps = 1/37 (2%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISD 214
           RV++ACD CR  K +CDG+RP C++C      C  S+
Sbjct: 17  RVSKACDACRKSKTKCDGERP-CSRCLKENKLCTYSN 52

>ZYRO0A13596g Chr1 complement(1080653..1082599) [1947 bp, 648 aa]
           {ON} similar to gnl|GLV|KLLA0D10153g Kluyveromyces
           lactis KLLA0D10153g and weakly similar to uniprot|P35995
           Saccharomyces cerevisiae YKL222C Hypothetical ORF
          Length = 648

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 23/37 (62%)

Query: 180 AQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKL 216
           ++ C  C+ KK+RCD K P CT C+  G+ C  + K+
Sbjct: 8   SKTCTNCQRKKVRCDRKVPACTACSERGYNCIYNVKI 44

>Skud_15.546 Chr15 (990335..991963) [1629 bp, 542 aa] {ON} YOR380W
           (REAL)
          Length = 542

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPR 223
           RV +AC  CR +K +C+GK P C  C A G+ C  +D       PR
Sbjct: 15  RVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHYTDVDGSSTSPR 59

>Suva_4.400 Chr4 complement(710591..713704) [3114 bp, 1037 aa] {ON}
           YBR150C (REAL)
          Length = 1037

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 41/99 (41%), Gaps = 9/99 (9%)

Query: 130 PTLSNSESPVNASLLSSITTPLL----HQTGSASHXXXXXXXXXXXXXXXXYRVAQACDR 185
           P LSN +  ++A ++S ++ P L     Q   A                   RV +ACD 
Sbjct: 38  PVLSNFQPDLSAPIISPMSGPFLDHRSRQQALAHMISADKNFLAYNMDSFKSRVTKACDY 97

Query: 186 CRAKKIRCDGKRP---QCTQCAAVGFEC--KISDKLSRR 219
           CR +KIRC    P   +C  C     +C     ++L RR
Sbjct: 98  CRKRKIRCTEIDPNYGKCRNCIKYNKDCTFHFHEELKRR 136

>NCAS0A08840 Chr1 (1746841..1751277) [4437 bp, 1478 aa] {ON}
           Anc_1.380
          Length = 1478

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVG 207
           RV  +C  CR +K++CD  RP C QC   G
Sbjct: 38  RVPLSCTICRKRKVKCDKIRPHCQQCTKTG 67

>Skud_7.638 Chr7 (1060062..1061483) [1422 bp, 473 aa] {ON} YFL052W
           (REAL)
          Length = 473

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (61%), Gaps = 1/39 (2%)

Query: 181 QACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRR 219
           QACD CR ++++CDGK+P C +C     +C     L +R
Sbjct: 11  QACDCCRVRRVKCDGKKP-CNRCLQHDLKCTYLQPLRKR 48

>Suva_11.187 Chr11 (348570..352085) [3516 bp, 1171 aa] {ON} YKL038W
           (REAL)
          Length = 1171

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQ--CTQCAAVGFECKISDKLSRRAFPRGY 225
           + ++ACD+CR KKI+CD K  +  C+ C   G  C       +R   +GY
Sbjct: 42  KASRACDQCRKKKIKCDYKDEKGLCSNCQRNGDRCSFERVPLKRGPSKGY 91

>NCAS0A03070 Chr1 (603639..605609) [1971 bp, 656 aa] {ON} 
          Length = 656

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 20/33 (60%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210
           R    C  CR +K+RC+ +RP C++C  +G  C
Sbjct: 10  RPTHVCAACRTQKLRCNRERPSCSRCQRIGRTC 42

>KLLA0C03201g Chr3 complement(286973..288925) [1953 bp, 650 aa] {ON}
           similar to uniprot|P39529 Saccharomyces cerevisiae
           YJL206C and some similarities with YIL130W
           uniprot|P40467 Saccharomyces cerevisiae YIL130W ASG1
           Proposed transcriptional activator member of the Gal4p
           family of zinc cluster proteins
          Length = 650

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 74/170 (43%), Gaps = 10/170 (5%)

Query: 618 IQVLQCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLRLHRCPSAVLGGDGSTVSKVQQG 677
           ++ LQ + ML  ++    ++SS Y   G  +  + +   HR  S         ++ ++Q 
Sbjct: 258 VESLQAIFMLTIFLQCSANLSSGYTYIGIALRTAIKQNFHRKTSL------QNLNLLEQE 311

Query: 678 ERRILFWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDDDRQVNLAGQMIALEGKVSQ 737
             + LFW+IY  D++    LG+P  L +  I+   P   DDDR +     ++   GK+S 
Sbjct: 312 TIKKLFWTIYKTDIYMNCILGLPNSLDESLIDQEFPSDIDDDRILE-NRLLVQPSGKLSS 370

Query: 738 FSLS--VIRFAKVMGNILDSTFKRGMT-TSLTKQAALVHENALDNWRHGL 784
             ++    +   +M N     +   +T TS++       E  L NW   L
Sbjct: 371 VGMNNEHTKLILIMNNAHKILYPMSLTVTSISHSEISKLEGELSNWLERL 420

 Score = 40.0 bits (92), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 1/35 (2%)

Query: 177 YRVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECK 211
           ++V  AC  C+ +K+RCDG+ P C  C     +C+
Sbjct: 30  HKVKHACSSCKERKVRCDGQSP-CASCINARVKCE 63

>Ecym_2522 Chr2 (1017930..1020710) [2781 bp, 926 aa] {ON} similar to
           Ashbya gossypii AGL233C
          Length = 926

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 24/34 (70%), Gaps = 1/34 (2%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGF-EC 210
           +V+++C  CR ++++CD  RP+C+ C + G  EC
Sbjct: 14  KVSKSCVFCRKRRVKCDKARPKCSTCVSKGLPEC 47

>KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa]
           {ON} some similarities with uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger overexpression increases salt
           tolerance through increased expression of the ENA1 (Na
           /Li extrusion pump) gene while gene disruption decreases
           both salt tolerance and ENA1 expression
          Length = 1148

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 3/36 (8%)

Query: 178 RVAQACDRCRAKKIRCDGKRP---QCTQCAAVGFEC 210
           RV++ACDRCR +KI+CD   P   +C+ C      C
Sbjct: 29  RVSKACDRCRRRKIKCDDLDPVSGKCSNCIKYKVPC 64

>YLR256W Chr12 (646415..650923) [4509 bp, 1502 aa] {ON}  HAP1Zinc
           finger transcription factor involved in the complex
           regulation of gene expression in response to levels of
           heme and oxygen; the S288C sequence differs from other
           strain backgrounds due to a Ty1 insertion in the carboxy
           terminus
          Length = 1502

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVG 207
           R+  +C  CR +K++CD  RP C QC   G
Sbjct: 59  RIPLSCTICRKRKVKCDKLRPHCQQCTKTG 88

>SAKL0D07898g Chr4 complement(653332..657066) [3735 bp, 1244 aa]
           {ON} similar to uniprot|P12351 Saccharomyces cerevisiae
           YLR256W HAP1
          Length = 1244

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 19/30 (63%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVG 207
           RV  +C  CR +K++CD  RP C QC+  G
Sbjct: 11  RVPLSCTICRKRKVKCDKTRPHCQQCSKTG 40

>TPHA0B03630 Chr2 (844571..848860) [4290 bp, 1429 aa] {ON} Anc_1.380
           YLR256W
          Length = 1429

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 18/32 (56%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFE 209
           R+  +C  CR +K++CD   P C QC   G +
Sbjct: 40  RIPLSCTICRKRKVKCDKTHPHCNQCVKTGVQ 71

>SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa] {ON}
           conserved hypothetical protein
          Length = 362

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 24/37 (64%), Gaps = 1/37 (2%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISD 214
           RV++ACD CR  K +CDG+RP C +C +    C  S+
Sbjct: 6   RVSKACDTCRKSKTKCDGERP-CQRCLSENKICTYSN 41

>NCAS0A01630 Chr1 complement(317259..320390) [3132 bp, 1043 aa] {ON}
           Anc_4.113
          Length = 1043

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210
           +V++ACD CR +KI+C GK+P C  C A    C
Sbjct: 43  KVSKACDNCRKRKIKCTGKQP-CATCEAYQCPC 74

>Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019W
           (REAL)
          Length = 894

 Score = 43.1 bits (100), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 26/40 (65%), Gaps = 1/40 (2%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLS 217
           RV +AC+ C+ +K++CDG +P C  C+    EC+   K++
Sbjct: 27  RVQKACELCKKRKVKCDGNKP-CLNCSKHQKECRYDFKVT 65

>Kwal_YGOB_0.139 s0 complement(61752..63560,63594..65507) [3723 bp,
           1240 aa] {ON} ANNOTATED BY YGOB -
          Length = 1240

 Score = 43.1 bits (100), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 19/30 (63%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVG 207
           RV  +C  CR +K++CD  RP C QC+  G
Sbjct: 11  RVPLSCTICRKRKVKCDKTRPHCQQCSKTG 40

>SAKL0D13464g Chr4 (1116277..1118340) [2064 bp, 687 aa] {ON} weakly
           similar to uniprot|P50104 Saccharomyces cerevisiae
           YMR019W STB4 Protein that binds Sin3p in a two- hybrid
           assay
          Length = 687

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFEC--KISDKLSRRAFPR 223
           RV +AC+ C+ +KI+CDG +P CT C     +C  K +D  S  + P+
Sbjct: 23  RVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFTDTASPISKPK 69

>ZYRO0G22550g Chr7 complement(1856064..1858238) [2175 bp, 724 aa]
           {ON} weakly similar to uniprot|P39961 Saccharomyces
           cerevisiae YER184C Hypothetical ORF
          Length = 724

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISD 214
           +V +AC  CR +KIRCDG  P C+ C ++  EC   D
Sbjct: 8   KVKRACQICRRRKIRCDGYLP-CSSCVSLKKECNYHD 43

>Suva_1.14 Chr1 (25653..28790) [3138 bp, 1045 aa] {ON} YAL051W
           (REAL)
          Length = 1045

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 28/46 (60%), Gaps = 2/46 (4%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPR 223
           R++  C  CR  K +CD ++P+C +C   G +C + D +S++  PR
Sbjct: 61  RISFVCQACRKSKTKCDREKPECGRCTKHGLKC-VYD-VSKQPAPR 104

>CAGL0F07865g Chr6 complement(768270..770804) [2535 bp, 844 aa] {ON}
           similar to uniprot|Q12151 Saccharomyces cerevisiae
           YDR213w UPC2
          Length = 844

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 10/29 (34%), Positives = 18/29 (62%)

Query: 182 ACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210
            CD C+ ++++CD  +P C +C  +  EC
Sbjct: 53  GCDHCKRRRVKCDEGKPMCDKCVKMKLEC 81

>NDAI0H01990 Chr8 complement(481983..485468) [3486 bp, 1161 aa] {ON}
           Anc_7.17
          Length = 1161

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 19/33 (57%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210
           R++  C  CR  K +CD ++P CT+C     +C
Sbjct: 64  RISFVCQECRKAKTKCDKEKPYCTRCVKQNIKC 96

>Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}
           YKL222C (REAL)
          Length = 688

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 19/33 (57%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210
           +  +AC  CR KK +CD  RPQC QC     EC
Sbjct: 11  KAIKACLNCRRKKQKCDQARPQCYQCRIRKTEC 43

>NDAI0A03420 Chr1 complement(782010..785336) [3327 bp, 1108 aa] {ON}
           
          Length = 1108

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 1/33 (3%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210
           +V +AC  CR +KI+C G  P C+ CAA   EC
Sbjct: 12  KVVKACLNCRRRKIKCTGTFP-CSNCAAYQCEC 43

>AFL160C Chr6 complement(130842..132788) [1947 bp, 648 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL248C
           (GAL4)
          Length = 648

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%)

Query: 179 VAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225
           V QACD CR +K++C    P+C +C      C  S K+ R    R +
Sbjct: 5   VIQACDSCRRRKMKCSKTFPKCAKCREDNRVCLYSPKIRRSPLTRAH 51

>YGR288W Chr7 (1070293..1071714) [1422 bp, 473 aa] {ON}
           MAL13MAL-activator protein, part of complex locus MAL1;
           nonfunctional in genomic reference strain S288C
          Length = 473

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 21/30 (70%), Gaps = 1/30 (3%)

Query: 181 QACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210
           QACD CR ++++CDGKRP C+ C     +C
Sbjct: 11  QACDCCRIRRVKCDGKRP-CSSCLQNSLDC 39

>NDAI0E03460 Chr5 (742144..744993) [2850 bp, 949 aa] {ON} Anc_8.423
          Length = 949

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 12/42 (28%), Positives = 22/42 (52%)

Query: 182 ACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPR 223
            CD C+ ++++CD  +P C +C  +   C  +    RR+  R
Sbjct: 63  GCDNCKRRRVKCDESKPHCQKCVNMQLHCVYTPPQPRRSKGR 104

>Skud_9.220 Chr9 complement(396576..398957) [2382 bp, 793 aa] {ON}
           YER184C (REAL)
          Length = 793

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 23/33 (69%), Gaps = 1/33 (3%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210
           RV++AC+RC  KKI+CD K+P C  CA    +C
Sbjct: 13  RVSKACERCHRKKIKCDSKKP-CFGCAGSRSKC 44

>TBLA0C01120 Chr3 complement(233451..237911) [4461 bp, 1486 aa] {ON}
           Anc_1.380 YLR256W
          Length = 1486

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 17/31 (54%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGF 208
           R+  +C  CR +K++CD   P C QC   G 
Sbjct: 14  RIPLSCTICRKRKVKCDKTHPYCVQCTKTGM 44

>Suva_10.323 Chr10 complement(566314..568755) [2442 bp, 813 aa] {ON}
           YLR228C (REAL)
          Length = 813

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 21/38 (55%)

Query: 182 ACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRR 219
            CD C+ ++++CD  +P C +C  +  EC  S    RR
Sbjct: 42  GCDNCKRRRVKCDEGKPFCKKCTNMKLECVYSPIQPRR 79

>TPHA0L01060 Chr12 (220857..223778) [2922 bp, 973 aa] {ON} Anc_8.423
           YLR228C
          Length = 973

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 9/29 (31%), Positives = 19/29 (65%)

Query: 182 ACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210
            CD C+ ++++CD  +P C +C+ +  +C
Sbjct: 51  GCDNCKRRRVKCDEAKPACVKCSNMKLDC 79

>KLTH0H11572g Chr8 complement(989095..992808) [3714 bp, 1237 aa]
           {ON} similar to uniprot|P12351 Saccharomyces cerevisiae
           YLR256W HAP1
          Length = 1237

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 19/30 (63%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVG 207
           RV  +C  CR +K++CD  RP C QC+  G
Sbjct: 11  RVPLSCTICRKRKVKCDKTRPHCQQCSKTG 40

>Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig
           274] FULL
          Length = 628

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 22/33 (66%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210
           R++  CD CR +K++C+ ++P C++C     +C
Sbjct: 10  RISHVCDACRIRKLKCNKQKPSCSRCVKHDLQC 42

>Skud_12.335 Chr12 (592952..597391) [4440 bp, 1479 aa] {ON} YLR256W
           (REAL)
          Length = 1479

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVG 207
           R+  +C  CR +K++CD  RP C QC   G
Sbjct: 60  RIPLSCTICRKRKVKCDKFRPHCQQCTKTG 89

>Skud_1.10 Chr1 (24510..27632) [3123 bp, 1040 aa] {ON} YAL051W
           (REAL)
          Length = 1040

 Score = 42.7 bits (99), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 28/46 (60%), Gaps = 2/46 (4%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPR 223
           R++  C  CR  K +CD ++P+C +C   G +C + D +S++  PR
Sbjct: 61  RISFVCQACRKSKTKCDREKPECGRCIKHGLKC-VYD-VSKQPAPR 104

>Smik_12.327 Chr12 (590984..595495) [4512 bp, 1503 aa] {ON} YLR256W
           (REAL)
          Length = 1503

 Score = 42.7 bits (99), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVG 207
           R+  +C  CR +K++CD  RP C QC   G
Sbjct: 58  RIPLSCTICRKRKVKCDKFRPHCQQCTKTG 87

>TBLA0B04800 Chr2 complement(1127000..1129333) [2334 bp, 777 aa]
           {ON} 
          Length = 777

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 20/26 (76%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQC 203
           R+++ C+ CR +K++CD +RP C +C
Sbjct: 10  RISRVCNSCRIQKLKCDRERPSCKRC 35

>TBLA0G00490 Chr7 (99344..102100) [2757 bp, 918 aa] {ON} 
          Length = 918

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 181 QACDRCRAKKIRCDGKRPQCTQCAAVGF-ECKISDKL 216
           ++C  CR +K++CD  +P C+ C A  F EC  SD +
Sbjct: 33  KSCSFCRRRKLKCDKSKPLCSTCRARNFTECIYSDAI 69

>NDAI0C04840 Chr3 (1117201..1120047) [2847 bp, 948 aa] {ON}
           Anc_8.423
          Length = 948

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 23/43 (53%), Gaps = 1/43 (2%)

Query: 182 ACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRG 224
            CD C+ ++++CD  +P C +C  +   C +   L  R  P+G
Sbjct: 62  GCDNCKKRRVKCDEVKPSCKKCTNMQLTC-VYSPLQPRKRPKG 103

>AFR117C Chr6 complement(646829..650287) [3459 bp, 1152 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR256W
           (HAP1)
          Length = 1152

 Score = 42.7 bits (99), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVG 207
           RV  +C  CR +K++CD  RP C QC   G
Sbjct: 14  RVPLSCTICRKRKVKCDKTRPHCNQCTKTG 43

>Smik_15.561 Chr15 (997239..998879) [1641 bp, 546 aa] {ON} YOR380W
           (REAL)
          Length = 546

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 27/47 (57%), Gaps = 3/47 (6%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDK--LSRRAFP 222
           RV +AC  CR +K +C+GK P C  C + G+ C   DK   S  +FP
Sbjct: 15  RVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYMDKDRSSSSSFP 60

>KAFR0I00230 Chr9 (48095..51232) [3138 bp, 1045 aa] {ON} Anc_7.17
           YOR363C
          Length = 1045

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 20/33 (60%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210
           R++  C  CR  K +CD ++P+C++CA     C
Sbjct: 24  RISLVCQACRKSKTKCDREKPRCSRCAKNNLRC 56

>KLLA0A04169g Chr1 complement(376273..378600) [2328 bp, 775 aa] {ON}
           similar to uniprot|Q05958 Saccharomyces cerevisiae
           YLR228C ECM22 Sterol regulatory element binding protein
           regulates transcription of the sterol biosynthetic genes
           ERG2 and ERG3 member of the fungus-specific Zn[2]-Cys[6]
           binuclear cluster family of transcription factors
           homologous to Upc2p
          Length = 775

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 10/29 (34%), Positives = 17/29 (58%)

Query: 182 ACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210
            CD C+ ++++CD  RP C  C  +  +C
Sbjct: 56  GCDHCKRRRVKCDETRPHCLNCKKMSLDC 84

>Suva_8.436 Chr8 (788699..790336) [1638 bp, 545 aa] {ON} YOR380W
           (REAL)
          Length = 545

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDK 215
           RV +AC  CR +K +C+GK P C  C A G+ C  +++
Sbjct: 15  RVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYTEE 51

>Skud_5.331 Chr5 complement(543439..543951) [513 bp, 170 aa] {ON}
           YER184C (REAL)
          Length = 170

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 26/38 (68%), Gaps = 1/38 (2%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDK 215
           RV++AC+RCR KK++CD K+P C  C     +C+  ++
Sbjct: 13  RVSKACERCRRKKVKCDSKKP-CFGCIGSQSKCRYKNQ 49

>CAGL0A04455g Chr1 (437546..440842) [3297 bp, 1098 aa] {ON} similar
           to uniprot|P34228 Saccharomyces cerevisiae YBL066c SEF1
          Length = 1098

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 24/43 (55%), Gaps = 3/43 (6%)

Query: 177 YRVAQACDRCRAKKIRCDGKR---PQCTQCAAVGFECKISDKL 216
           +R   +C  CR  KI+CD  +     CT+CA  GF C+I+ + 
Sbjct: 81  HRPVTSCTHCRQHKIKCDASQNFPAPCTRCAKNGFHCEINPQF 123

>YOR380W Chr15 (1051290..1052930) [1641 bp, 546 aa] {ON}
           RDR1Transcriptional repressor involved in the control of
           multidrug resistance; negatively regulates expression of
           the PDR5 gene; member of the Gal4p family of zinc
           cluster proteins
          Length = 546

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPR 223
           RV +AC  CR +K +C+GK P C  C A G+ C   D     A P+
Sbjct: 15  RVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYIDGRVPSASPQ 59

>Kwal_26.7095 s26 (211883..214399) [2517 bp, 838 aa] {ON} YOR363C
           (PIP2) - activator of peroxisome proliferation [contig
           46] FULL
          Length = 838

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 3/48 (6%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKI---SDKLSRRAFP 222
           R +  C  C+ +KI+CD  RP C +C+ +  EC      +K  RR  P
Sbjct: 25  RQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENKDGRRGLP 72

>NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa] {ON}
           
          Length = 1107

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRR 219
           +V++ACD CR +KI+C GK P C  C A    C  S    R+
Sbjct: 39  KVSKACDNCRKRKIKCTGKMP-CPTCEAYQCPCIYSAPKPRK 79

>Kwal_23.3122 s23 complement(166388..168754) [2367 bp, 788 aa] {ON}
           YDR213W (UPC2) - zinc finger transcription factor of the
           Zn(2)-Cys(6) binuclear cluster domain type [contig 249]
           FULL
          Length = 788

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 22/38 (57%)

Query: 182 ACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRR 219
            CD C+ ++++CD  +P C +C  +  EC  +   SR+
Sbjct: 49  GCDNCKRRRVKCDEDKPSCQKCLNMKLECVYTPVTSRK 86

>CAGL0F09229g Chr6 complement(908186..910693) [2508 bp, 835 aa] {ON}
           weakly similar to uniprot|P39961 Saccharomyces
           cerevisiae YER184c
          Length = 835

 Score = 42.4 bits (98), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210
           RV +ACD CR +K++CDG +P C+ C      C
Sbjct: 16  RVIRACDVCRKRKVKCDGDQP-CSSCMTASTVC 47

>ZYRO0G19338g Chr7 complement(1601895..1603856) [1962 bp, 653 aa]
           {ON} similar to uniprot|Q754A1 Ashbya gossypii AFR171W
           AFR171Wp and some similarites with YDR034C
           uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co-inducer
          Length = 653

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 22/29 (75%)

Query: 182 ACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210
            C+ C+ +K++CD ++P+C QC+ +G +C
Sbjct: 20  GCNECKKRKVKCDEQKPECWQCSHLGKKC 48

>TPHA0F00830 Chr6 complement(188299..191877) [3579 bp, 1192 aa] {ON}
           Anc_4.113 YGL013C
          Length = 1192

 Score = 42.4 bits (98), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 9/49 (18%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKIS--------DKLSR 218
           +V++AC  CR +KI+C+G  P C+ C     EC  S        DKL R
Sbjct: 23  KVSKACQSCRRRKIKCNGINP-CSNCTTYECECIYSIPDSNSQTDKLGR 70

>YAL051W Chr1 (48564..51707) [3144 bp, 1047 aa] {ON}
           OAF1Oleate-activated transcription factor, acts alone
           and as a heterodimer with Pip2p; activates genes
           involved in beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 1047

 Score = 42.4 bits (98), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 2/46 (4%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPR 223
           R+   C  CR  K +CD ++P+C +C   G +C + D +S++  PR
Sbjct: 61  RILFVCQACRKSKTKCDREKPECGRCVKHGLKC-VYD-VSKQPAPR 104

>ZYRO0C00726g Chr3 (53977..57084) [3108 bp, 1035 aa] {ON} similar to
           uniprot|P39720 Saccharomyces cerevisiae YAL051W OAF1
           Oleate-activated transcription factor acts alone and as
           a heterodimer with Pip2p activates genes involved in
           beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 1035

 Score = 42.4 bits (98), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 2/46 (4%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPR 223
           R++  C  CR  K +CD ++P+C +C   G  C + D + ++A PR
Sbjct: 55  RISFVCKACRRSKTKCDREKPKCGRCVQHGIAC-VYD-VEKQAAPR 98

>KNAG0A02300 Chr1 (214177..216363) [2187 bp, 729 aa] {ON}  gene
           extends into a gap in the genome sequence
          Length = 729

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 20/31 (64%), Gaps = 1/31 (3%)

Query: 181 QACDRCRAKKIRCDGKRPQCTQCAAVGF-EC 210
           + C  CR +K+RCD  RP C+ C A GF EC
Sbjct: 23  RTCTFCRQRKVRCDQGRPLCSSCKARGFSEC 53

>NDAI0G04140 Chr7 (994071..997076) [3006 bp, 1001 aa] {ON} Anc_3.109
           YBR150C
          Length = 1001

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 26/45 (57%), Gaps = 3/45 (6%)

Query: 178 RVAQACDRCRAKKIRCDG---KRPQCTQCAAVGFECKISDKLSRR 219
           R ++ACD CR +KI+CD    +  +C+ C     EC  S++  R+
Sbjct: 98  RASKACDLCRRRKIKCDAFDDRLKKCSNCIKYHSECTFSNQNKRK 142

>Suva_10.351 Chr10 (613486..614460) [975 bp, 324 aa] {ON} YLR256W
           (REAL)
          Length = 324

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVG 207
           R+  +C  CR +K++CD  RP C QC   G
Sbjct: 60  RIPLSCTICRKRKVKCDKFRPHCQQCTKTG 89

>YMR019W Chr13 (312156..315005) [2850 bp, 949 aa] {ON}  STB4Putative
           transcription factor; contains a Zn(II)2Cys6 zinc finger
           domain characteristic of DNA-binding proteins;
           computational analysis suggests a role in regulation of
           expression of genes encoding transporters; binds Sin3p
           in a two-hybrid assay;
          Length = 949

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPR 223
           RV +AC+ C+ +K++CDG  P C  C+    EC+   K + R   R
Sbjct: 82  RVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNRKRRR 126

>TBLA0G00510 Chr7 (104797..107604) [2808 bp, 935 aa] {ON} Anc_6.60
           YLR266C
          Length = 935

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 179 VAQACDRCRAKKIRCDGKRPQCTQCAAVGF-ECKISD 214
           + + C  CR KK++CD +RP C+ C A  F EC   D
Sbjct: 78  IIKTCLFCREKKLKCDKRRPLCSSCIARNFTECVYVD 114

>Kwal_0.142 s0 complement(63621..65507) [1887 bp, 629 aa] {OFF}
           YLR256W (HAP1) - zinc-finger transcription factor of the
           Zn(2)-Cys(6) binuclear cluster domain type [contig 78]
           PARTIAL
          Length = 629

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 19/30 (63%)

Query: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVG 207
           RV  +C  CR +K++CD  RP C QC+  G
Sbjct: 11  RVPLSCTICRKRKVKCDKTRPHCQQCSKTG 40

>Smik_12.357 Chr12 complement(638342..642208) [3867 bp, 1288 aa]
           {ON} YLR278C (REAL)
          Length = 1288

 Score = 42.0 bits (97), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 22/41 (53%)

Query: 180 AQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRA 220
           +++C  CR +K RCD K P CT C   G +C    K S  A
Sbjct: 38  SRSCLLCRRRKQRCDHKLPSCTACLKAGIKCVQPSKYSSIA 78

>Kwal_47.17681 s47 complement(513119..515683) [2565 bp, 854 aa] {ON}
           [contig 206] FULL
          Length = 854

 Score = 42.0 bits (97), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 68/342 (19%), Positives = 138/342 (40%), Gaps = 52/342 (15%)

Query: 505 VEELMQLFFQDWYELIPLFDKNEFNSYYEKFKLNVTDPNFFVRKDDTVFNNRTRSISYKI 564
            +EL+ LFF+  + L+P+ ++ EF + Y                          + S  +
Sbjct: 199 CDELVDLFFRYIHPLMPIINQTEFRAAYA-----------------------ANTCSIFL 235

Query: 565 FSCLLIIIVQMGMLSKIKRDKITSGKLSTLMKYYDKLMTHIWINPYFNSRNTSIQVLQCL 624
              +L + V++   + +  DK +S  L++ + Y  +    ++   Y  +    +Q +  L
Sbjct: 236 LQAILCVSVKLSR-NPLLMDKDSSTDLASNIFY--QRAKSLYDGRYEENEICLLQGMMLL 292

Query: 625 SMLLFYMLNVGDISSIYELRGKVVSMSQQLRLHRCPSAVLGGDGSTVSKVQQGERRILFW 684
           S   F   N   +  +Y ++   V+++Q   LHR           T++  ++  R++++W
Sbjct: 293 SKQAFNEKNTIHM-PMYFIKN-AVTVAQTYGLHRS-----ADFHPTLTANEKRTRKLIWW 345

Query: 685 SIYYLDVFSALQLGVPRLLKDFEIECALPVTSDDDRQVNLAGQMIALEGKVSQFSLSVIR 744
            +Y +D   ++ +G P+ +     +C +PV + DD          A+        +S ++
Sbjct: 346 ILYVIDTLVSISIGRPQAIN--LDDCDVPVLTHDDFIFEGGAPDHAVAVDYMDCIISTVQ 403

Query: 745 FAKVMGNILDSTFKRGMTTSLTKQAALVH-ENALDNWRHGLQKDLFFQLDVNGTINMDEF 803
             ++M  I      R   +    +  + H +  L  WR  L + L +    N  I     
Sbjct: 404 IVEIMSRI-SRELNRPAASQCDAKVLIQHFDMLLQRWRKNLPESLTYH--SNAEI----- 455

Query: 804 NQQKQYSKSLSPRTAAFTHNSLVLMTLYFMAKCMIHLPVVAT 845
                ++K   P+  AF  N+L   TL  + K  IH  V A+
Sbjct: 456 -----FTKHSIPK--AFV-NALYYKTLCLLHKSNIHDMVQAS 489

 Score = 40.4 bits (93), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 1/38 (2%)

Query: 178 RVAQACDRCRAKKIRCDGK-RPQCTQCAAVGFECKISD 214
           R  +AC+ C  +K+RCD   R  CT C   G  C++ D
Sbjct: 14  RTNRACEVCHDRKVRCDANIRVPCTSCQTFGLVCRLRD 51

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 133,913,731
Number of extensions: 5531772
Number of successful extensions: 18593
Number of sequences better than 10.0: 661
Number of HSP's gapped: 19114
Number of HSP's successfully gapped: 774
Length of query: 1445
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1323
Effective length of database: 39,492,147
Effective search space: 52248110481
Effective search space used: 52248110481
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 72 (32.3 bits)