Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D01430g8.846ON26326314030.0
SAKL0D01320g8.846ON2602675345e-67
Ecym_46178.846ON2492465327e-67
ABL120W8.846ON2492465318e-67
Kwal_27.102278.846ON2542185311e-66
KLTH0C03740g8.846ON2542485135e-64
NDAI0K003308.846ON3132904612e-55
YMR281W (GPI12)8.846ON3042444542e-54
Suva_13.4708.846ON3032474499e-54
Smik_13.4948.846ON3042424491e-53
Skud_13.4538.846ON3002434472e-53
NCAS0C003808.846ON2762254391e-52
KNAG0J002408.846ON2862344383e-52
TDEL0B005208.846ON2682534261e-50
ZYRO0G14300g8.846ON2802724156e-49
TPHA0I002808.846ON3012874168e-49
KAFR0B039608.846ON2782604103e-48
CAGL0M03047g8.846ON3042753914e-45
TBLA0B033008.846ON3193023891e-44
Kpol_1068.48.846ON2912403697e-42
TPHA0G018908.626ON89156750.63
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D01430g
         (263 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D01430g Chr4 complement(122369..123160) [792 bp, 263 aa] {O...   545   0.0  
SAKL0D01320g Chr4 complement(99898..100680) [783 bp, 260 aa] {ON...   210   5e-67
Ecym_4617 Chr4 (1209745..1210494) [750 bp, 249 aa] {ON} similar ...   209   7e-67
ABL120W Chr2 (175065..175814) [750 bp, 249 aa] {ON} Syntenic hom...   209   8e-67
Kwal_27.10227 s27 complement(249716..250480) [765 bp, 254 aa] {O...   209   1e-66
KLTH0C03740g Chr3 complement(323371..324135) [765 bp, 254 aa] {O...   202   5e-64
NDAI0K00330 Chr11 (63765..64706) [942 bp, 313 aa] {ON} Anc_8.846...   182   2e-55
YMR281W Chr13 (832339..833253) [915 bp, 304 aa] {ON}  GPI12ER me...   179   2e-54
Suva_13.470 Chr13 (815029..815940) [912 bp, 303 aa] {ON} YMR281W...   177   9e-54
Smik_13.494 Chr13 (815351..816265) [915 bp, 304 aa] {ON} YMR281W...   177   1e-53
Skud_13.453 Chr13 (805536..806438) [903 bp, 300 aa] {ON} YMR281W...   176   2e-53
NCAS0C00380 Chr3 complement(55971..56801) [831 bp, 276 aa] {ON} ...   173   1e-52
KNAG0J00240 Chr10 complement(32153..33013) [861 bp, 286 aa] {ON}...   173   3e-52
TDEL0B00520 Chr2 complement(94560..95366) [807 bp, 268 aa] {ON} ...   168   1e-50
ZYRO0G14300g Chr7 (1145709..1146551) [843 bp, 280 aa] {ON} simil...   164   6e-49
TPHA0I00280 Chr9 (54103..55008) [906 bp, 301 aa] {ON} Anc_8.846 ...   164   8e-49
KAFR0B03960 Chr2 (829312..830148) [837 bp, 278 aa] {ON} Anc_8.84...   162   3e-48
CAGL0M03047g Chr13 (346435..347349) [915 bp, 304 aa] {ON} weakly...   155   4e-45
TBLA0B03300 Chr2 (771332..772291) [960 bp, 319 aa] {ON} Anc_8.84...   154   1e-44
Kpol_1068.4 s1068 complement(6124..6999) [876 bp, 291 aa] {ON} c...   146   7e-42
TPHA0G01890 Chr7 (392062..394737) [2676 bp, 891 aa] {ON} Anc_8.6...    33   0.63 

>KLLA0D01430g Chr4 complement(122369..123160) [792 bp, 263 aa] {ON}
           similar to uniprot|Q75DZ3 Ashbya gossypii ABL120W
           ABL120Wp and weakly similar to YMR281W uniprot|P23797
           Saccharomyces cerevisiae YMR281W GPI12 ER membrane
           protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly the
           de- N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 263

 Score =  545 bits (1403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/263 (100%), Positives = 263/263 (100%)

Query: 1   MILLRGLNKFVLWYLVFLVIYGCLTKTIKEHNRWYFHELVSESMVSKLTSVTLVVAHPDD 60
           MILLRGLNKFVLWYLVFLVIYGCLTKTIKEHNRWYFHELVSESMVSKLTSVTLVVAHPDD
Sbjct: 1   MILLRGLNKFVLWYLVFLVIYGCLTKTIKEHNRWYFHELVSESMVSKLTSVTLVVAHPDD 60

Query: 61  EVMFFSPTLTQFNELLPISIPINVVCMTAGDADGLGHIRKQELVDSLRIMFHGRQFGCDV 120
           EVMFFSPTLTQFNELLPISIPINVVCMTAGDADGLGHIRKQELVDSLRIMFHGRQFGCDV
Sbjct: 61  EVMFFSPTLTQFNELLPISIPINVVCMTAGDADGLGHIRKQELVDSLRIMFHGRQFGCDV 120

Query: 121 LDFEDGMDAVWDQVLLEKQLRSSIPDSNPLVLTFDQFGVSGHINHISCGRLVEKLPYSHK 180
           LDFEDGMDAVWDQVLLEKQLRSSIPDSNPLVLTFDQFGVSGHINHISCGRLVEKLPYSHK
Sbjct: 121 LDFEDGMDAVWDQVLLEKQLRSSIPDSNPLVLTFDQFGVSGHINHISCGRLVEKLPYSHK 180

Query: 181 LHLRSDQPIYVKYSAFIAGIFQLGISTVYPDYGKPRCFISTLPQYLLAASAMSLAHTSQM 240
           LHLRSDQPIYVKYSAFIAGIFQLGISTVYPDYGKPRCFISTLPQYLLAASAMSLAHTSQM
Sbjct: 181 LHLRSDQPIYVKYSAFIAGIFQLGISTVYPDYGKPRCFISTLPQYLLAASAMSLAHTSQM 240

Query: 241 VWFRVGWWLFSRFCFINELITSI 263
           VWFRVGWWLFSRFCFINELITSI
Sbjct: 241 VWFRVGWWLFSRFCFINELITSI 263

>SAKL0D01320g Chr4 complement(99898..100680) [783 bp, 260 aa] {ON}
           similar to uniprot|P23797 Saccharomyces cerevisiae
           YMR281W GPI12 ER membrane protein involved in the second
           step of glycosylphosphatidylinositol (GPI) anchor
           assembly the de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 260

 Score =  210 bits (534), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 112/267 (41%), Positives = 155/267 (58%), Gaps = 17/267 (6%)

Query: 1   MILLRGLNKFVLWYLVFLVIYGCLTKTIKEHNRWYFHELVSESMVSKLTSVTLVVAHPDD 60
           M ++  + K +  Y +  V+Y C+++ I  HNR  F  +         TSV L+VAHPDD
Sbjct: 1   MRVVEVVAKLLKAYALLSVLYICVSQRIAAHNRQVFRNVFPSRTP---TSVNLIVAHPDD 57

Query: 61  EVMFFSPTLTQFNELLPISIPINVVCMTAGDADGLGHIRKQELVDSLRIMFHGRQFGCDV 120
           E MFFSPTL Q +   P S+P+ V+C+T GDADGLG +R+QEL  S++++   R     V
Sbjct: 58  ETMFFSPTLLQLHVNYPPSVPLRVICLTNGDADGLGAVREQELRLSMQLLLPARNTSVIV 117

Query: 121 LDFEDGMDAVWDQVLLEKQLRSSIPDSNPLVLTFDQFGVSGHINHISCGRLVEKLPYSHK 180
             FEDGM   WD   +   +   + D++PL+LTFD+ GVSGH+NH+SC   V  L    +
Sbjct: 118 EGFEDGMGVEWDTRQVVATINRHVSDASPLLLTFDEHGVSGHVNHVSCNTAVSALVEQRE 177

Query: 181 --------LHLRSDQPIYVKYSAFIAGIFQLGISTVYPDYGKPRCFISTLPQYLLAASAM 232
                   L+L S +    KY +F   + ++          +P  F+ST PQYLL+ +AM
Sbjct: 178 QREQRFTALYLNSKRYFPPKYGSFAVDLARIITGR------QPPVFMSTFPQYLLSLAAM 231

Query: 233 SLAHTSQMVWFRVGWWLFSRFCFINEL 259
             AH SQMVWFR GWWL SRF F+NEL
Sbjct: 232 CNAHVSQMVWFRWGWWLASRFVFVNEL 258

>Ecym_4617 Chr4 (1209745..1210494) [750 bp, 249 aa] {ON} similar to
           Ashbya gossypii ABL120W
          Length = 249

 Score =  209 bits (532), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 110/246 (44%), Positives = 145/246 (58%), Gaps = 8/246 (3%)

Query: 14  YLVFLVIYGCLTKTIKEHNRWYFHELVSESMVSKLTSVTLVVAHPDDEVMFFSPTLTQFN 73
           YLV L +Y    K ++ HN   +  LV        TSVTL++AHPDDEVMFF+PTL Q +
Sbjct: 12  YLVLLAVYCGSYKHLETHNSKVYEYLVGSH--GNYTSVTLIIAHPDDEVMFFAPTLLQLD 69

Query: 74  ELLPISIPINVVCMTAGDADGLGHIRKQELVDSLRIMFHGRQFGCDVLDFEDGMDAVWDQ 133
             +  S+P  VVC+T GDADGLG +R++EL  +LR++   R     +  F+DGMD  W  
Sbjct: 70  ARMAQSVPFRVVCLTDGDADGLGEVRRRELHKALRLLVLERDVEIQMGGFKDGMDEEWKM 129

Query: 134 VLLEKQLRSSIPDSNPLVLTFDQFGVSGHINHISCGRLVEKLPYSHKLHLRSDQPIYVKY 193
            ++ ++L   + D  PLVLTFD+ GVSGH NHI+C     KL + H LHL S   +  KY
Sbjct: 130 EVVREELAQVVTDRRPLVLTFDERGVSGHRNHIACAHAAAKLGH-HTLHLDSGHNLIRKY 188

Query: 194 SAFIAGIFQLGISTVYPDYGKPRCFISTLPQYLLAASAMSLAHTSQMVWFRVGWWLFSRF 253
           S F   +F+L        Y  P  F+ST  QYL +   M +AH SQMVWFR GWW  SR+
Sbjct: 189 SFFFVDLFRLLFG-----YPMPTVFLSTFSQYLHSLVTMLVAHKSQMVWFRWGWWTASRY 243

Query: 254 CFINEL 259
            + NE 
Sbjct: 244 VYANEF 249

>ABL120W Chr2 (175065..175814) [750 bp, 249 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR281W (GPI12)
          Length = 249

 Score =  209 bits (531), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 112/246 (45%), Positives = 149/246 (60%), Gaps = 10/246 (4%)

Query: 14  YLVFLVIYGCLTKTIKEHNRWYFHELVSESMVSKLTSVTLVVAHPDDEVMFFSPTLTQFN 73
           YL+ L +Y    + ++ HN   F  LV     S+ TS+TLV+AHPDDEVMFF+PTL Q +
Sbjct: 12  YLLLLAVYCWSRRRLERHNTQVFERLVGGD--SQHTSLTLVIAHPDDEVMFFAPTLLQLD 69

Query: 74  ELLPISIPINVVCMTAGDADGLGHIRKQELVDSLRIMFHGRQFGCDVLDFEDGMDAVWDQ 133
             LP  +P  VVC+T G A+GLG +R+ EL  +LR++        +V DF DGM   WD 
Sbjct: 70  ARLPAWMPFRVVCLTDGGAEGLGQLRRAELQKALRLLVLEHDVTLEVADFTDGMKEDWDL 129

Query: 134 VLLEKQLRSSIPDSNPLVLTFDQFGVSGHINHISCGRLVEKLPYSHK-LHLRSDQPIYVK 192
             +  +L   + D+ PLVLTFD+ GVSGH NHI C     +L   HK L LRS++ +  K
Sbjct: 130 AEVRTRLGELVTDAKPLVLTFDERGVSGHRNHIGCALAAARL--GHKTLFLRSERNLLRK 187

Query: 193 YSAFIAGIFQLGISTVYPDYGKPRCFISTLPQYLLAASAMSLAHTSQMVWFRVGWWLFSR 252
           YS F+  +F++   T       P  F+STL QYL A  AM +AH SQMVWFR GWW+ SR
Sbjct: 188 YSFFVLDVFRVVFGT-----PPPTVFVSTLAQYLHALVAMVVAHRSQMVWFRWGWWMASR 242

Query: 253 FCFINE 258
           + + NE
Sbjct: 243 YVYANE 248

>Kwal_27.10227 s27 complement(249716..250480) [765 bp, 254 aa] {ON}
           YMR281W (GPI12) -
           N-acetylglucosaminylphosphatidylinositol de-N-acetylase
           [contig 39] FULL
          Length = 254

 Score =  209 bits (531), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 109/218 (50%), Positives = 141/218 (64%), Gaps = 10/218 (4%)

Query: 46  SKLTSVTLVVAHPDDEVMFFSPTLTQFNELLPISIPINVVCMTAGDADGLGHIRKQELVD 105
           S  TS+ LV+AHPDDEVMFF+PTL Q +E LP SI +NV+ +T G ADGLG +R +EL D
Sbjct: 40  SAPTSINLVIAHPDDEVMFFAPTLLQIDEWLPGSIEVNVISLTDGGADGLGDLRTKELQD 99

Query: 106 SLRIMFHGRQFGCDVLDFEDGMDAVWDQVLLEKQLRSSIPDSNPLVLTFDQFGVSGHINH 165
            +R++   R+   +VLDF DGMD  WD     K L+  I D +PL LTFD+ G+SGH+NH
Sbjct: 100 CVRLLLRKRKASVEVLDFLDGMDVEWDLERAVKALQERILDESPLFLTFDENGISGHVNH 159

Query: 166 ISCGRLVEKLP--YSHK--LHLRSDQPIYVKYSAFIAGIFQLGISTVYPDYGKPRCFIST 221
           ISC + V+K+   YS      L S + ++ KYS FI  +F   IS+       P   I++
Sbjct: 160 ISCYKAVQKVRKHYSKSSCFKLVSKRYLFEKYSGFIPALFHSFISS------SPSTLINS 213

Query: 222 LPQYLLAASAMSLAHTSQMVWFRVGWWLFSRFCFINEL 259
             QYLLA S+M  AH SQMVWFR GWWLFS + + NEL
Sbjct: 214 FRQYLLALSSMMNAHVSQMVWFRYGWWLFSYYVYANEL 251

>KLTH0C03740g Chr3 complement(323371..324135) [765 bp, 254 aa] {ON}
           weakly similar to uniprot|P23797 Saccharomyces
           cerevisiae YMR281W GPI12 ER membrane protein involved in
           the second step of glycosylphosphatidylinositol (GPI)
           anchor assembly the de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 254

 Score =  202 bits (513), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 110/248 (44%), Positives = 141/248 (56%), Gaps = 13/248 (5%)

Query: 16  VFLVIYGCLTKTIKEHNRWYFHELVSESMVSKLTSVTLVVAHPDDEVMFFSPTLTQFNEL 75
           V  ++Y   +  IK  N   F  L S   V   TS+ LV+AHPDDEVMFF+PTL Q +  
Sbjct: 13  VLCILYFASSARIKASNEQAFTTLFS---VLNPTSINLVIAHPDDEVMFFAPTLLQLDHY 69

Query: 76  LPISIPINVVCMTAGDADGLGHIRKQELVDSLRIMFHGRQFGCDVLDFEDGMDAVWDQVL 135
               IP++V  +T G ADGLG +R++EL DS+ ++F  R+    VL+FEDGM   WD   
Sbjct: 70  FDTDIPVSVFSLTDGGADGLGKLREEELRDSVHLLFRRRKAEVTVLNFEDGMKVEWDLQK 129

Query: 136 LEKQLRSSIPDSNPLVLTFDQFGVSGHINHISCGRLVEKL----PYSHKLHLRSDQPIYV 191
             + LR  +    PL LTFD  GVS HINHISC   V  L    P S    L S + I+ 
Sbjct: 130 TSEALRKQVVGDQPLFLTFDDHGVSSHINHISCYETVRNLRAAHPESRSFSLTSKRSIFQ 189

Query: 192 KYSAFIAGIFQLGISTVYPDYGKPRCFISTLPQYLLAASAMSLAHTSQMVWFRVGWWLFS 251
           KY+AF+  +  +   +      +   F+ST  QYLLA S M  AHTSQMVWFR GWW FS
Sbjct: 190 KYTAFVPSLITVLRGS------RQAVFMSTFKQYLLALSVMMNAHTSQMVWFRYGWWFFS 243

Query: 252 RFCFINEL 259
            + F NE+
Sbjct: 244 CYVFANEV 251

>NDAI0K00330 Chr11 (63765..64706) [942 bp, 313 aa] {ON} Anc_8.846
           YMR281W
          Length = 313

 Score =  182 bits (461), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 107/290 (36%), Positives = 162/290 (55%), Gaps = 43/290 (14%)

Query: 14  YLVFLVIYGCLTKTIKEHNRWYFHELVSESMVSK----------LTSVTLVVAHPDDEVM 63
           +L+  + Y   T+ I  +N+  F   V   ++ +          +T ++LV+AHPDDE+M
Sbjct: 16  FLLLWMFYMISTQKISSYNKKSFDNSVLNQILRQDHSHADISEPITQLSLVIAHPDDELM 75

Query: 64  FFSPTLTQFNELLPISIPINVVCMTAGDADGLGHIRKQELVDSLRIMF---HGRQFGCDV 120
           FF+PTL Q N  LP SIP N++C + GDA+GLG++R++EL DS+ ++    + R+    +
Sbjct: 76  FFAPTLLQLNRFLPTSIPFNIICFSDGDAEGLGYLRRKELHDSINLLLSSSNNRKINISI 135

Query: 121 LDFEDGMDAVWD--QVL--LEKQLRSSIPDS--NPLVLTFDQFGVSGHINHISCGRLVEK 174
           LDF DGMD VWD  Q+L  L+ +L  ++P S  N ++LTFD  G+S H NHI+C + V  
Sbjct: 136 LDFIDGMDQVWDGKQLLSSLQNELLVNVPPSIKNNILLTFDANGISNHPNHIACNKAVHD 195

Query: 175 L-PYSHK-----------LHLRSDQ-----PIYVKYSAFIAGIFQL------GISTVYPD 211
           L  Y              L  +SD+      +  KY+ F+  + ++      G     P+
Sbjct: 196 LISYDGGKDKEMNIIGLMLSSKSDEYNIVMNLLSKYTFFVIDLVKVYWNLATGTFNTIPN 255

Query: 212 YGKPR-CFISTLPQYLLAASAMSLAHTSQMVWFRVGWWLFSRFCFINELI 260
                  FI+T  QY+L+ ++M   H SQMVWFR GWW FSRF F N+L+
Sbjct: 256 SASLELSFINTYSQYILSYASMLNTHKSQMVWFRYGWWWFSRFVFSNDLL 305

>YMR281W Chr13 (832339..833253) [915 bp, 304 aa] {ON}  GPI12ER
           membrane protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly, the
           de-N-acetylation of the
           N-acetylglucosaminylphosphatidylinositol intermediate;
           functional homolog of human PIG-Lp
          Length = 304

 Score =  179 bits (454), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 95/244 (38%), Positives = 138/244 (56%), Gaps = 34/244 (13%)

Query: 50  SVTLVVAHPDDEVMFFSPTLTQFNELLPISIPINVVCMTAGDADGLGHIRKQELVDSLRI 109
            + LV+AHPDDEVMFFSP ++Q N   P ++P N++C++ G+A+GLG  R +EL +S  +
Sbjct: 56  EINLVIAHPDDEVMFFSPIISQLNSYFPRTVPFNIICLSKGNAEGLGETRVRELNESAAL 115

Query: 110 MFHG-RQFGCDVLDFEDGMDAVWDQVLLEKQLRSSIP----DSNPLVLTFDQFGVSGHIN 164
           + H  R     V+DF+DGMD +WD   +   L   I     + N +++TFD +GVS HIN
Sbjct: 116 LLHNERAVSVQVMDFQDGMDEIWDIDSITSSLSQKIDIKNHNLNQIIVTFDSYGVSNHIN 175

Query: 165 HISCGRLVEKL--PYSHKLHLRSDQP--------------IYVKYSAFIAGI-------- 200
           H SC   V+KL   Y+     R++QP              I +KY++FI  I        
Sbjct: 176 HKSCYAAVKKLVDDYAQPKTKRNEQPPHVTALYLRSYKNNIVLKYNSFIWEILKILYDLI 235

Query: 201 --FQLGISTVYPDYGKPR---CFISTLPQYLLAASAMSLAHTSQMVWFRVGWWLFSRFCF 255
             F+  I  + P+    +     ++T  QY+LA + M  AH SQ+VWFR GWW+FSRF F
Sbjct: 236 SPFRRIIQALPPNTAAEKDKLSLMNTHAQYVLAFATMLNAHESQVVWFRYGWWIFSRFVF 295

Query: 256 INEL 259
           +NE 
Sbjct: 296 VNEF 299

>Suva_13.470 Chr13 (815029..815940) [912 bp, 303 aa] {ON} YMR281W
           (REAL)
          Length = 303

 Score =  177 bits (449), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 99/247 (40%), Positives = 141/247 (57%), Gaps = 37/247 (14%)

Query: 49  TSVTLVVAHPDDEVMFFSPTLTQFNELLPISIPINVVCMTAGDADGLGHIRKQELVDSLR 108
           + + LV+AHPDDEVMFFSP ++Q +   P ++P N++C++ GDA+GLG  R +EL DS  
Sbjct: 53  SQINLVIAHPDDEVMFFSPVISQLHAYFPDTVPFNILCLSKGDAEGLGETRAKELNDSAV 112

Query: 109 IMFHG-RQFGCDVLDFEDGMDAVWDQVLLEKQLRSSIPDSNP----LVLTFDQFGVSGHI 163
           ++    R     V+DFEDGMD VWD   +   L  +I  +N     +++TFD +GVS HI
Sbjct: 113 LLLRNERPVSVQVMDFEDGMDEVWDIDSITSTLSQTIDVNNEKVSQIIVTFDSYGVSNHI 172

Query: 164 NHISC-------------GRLVEKLPYSH--KLHLRS-DQPIYVKYSAFIAGIFQLGIST 207
           NH SC              +  EK   +H   L+LRS    I++KY++FI  I ++   T
Sbjct: 173 NHKSCHIAVEKFIDDYVGSKTKEKAENAHITALYLRSYKNNIFLKYNSFIWEILKMLYRT 232

Query: 208 VYPDYGK-------PRC--------FISTLPQYLLAASAMSLAHTSQMVWFRVGWWLFSR 252
           V P +G+       P           ++T  QY+LA +AM  AH SQ+VWFR GWW+ SR
Sbjct: 233 VSP-FGRSIQPLAAPSTTTEKNGLLLMNTHSQYILAFAAMLNAHKSQVVWFRYGWWILSR 291

Query: 253 FCFINEL 259
           F F+NE 
Sbjct: 292 FVFVNEF 298

>Smik_13.494 Chr13 (815351..816265) [915 bp, 304 aa] {ON} YMR281W
           (REAL)
          Length = 304

 Score =  177 bits (449), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 94/242 (38%), Positives = 136/242 (56%), Gaps = 34/242 (14%)

Query: 51  VTLVVAHPDDEVMFFSPTLTQFNELLPISIPINVVCMTAGDADGLGHIRKQELVDSLRIM 110
           + L++AHPDDEVMFFSP ++Q +   P ++P N++C++ G+A+GLG  R +EL DS  ++
Sbjct: 57  INLIIAHPDDEVMFFSPMISQLHSYFPNTVPFNIICLSKGNAEGLGQTRVRELNDSAALL 116

Query: 111 FHG-RQFGCDVLDFEDGMDAVWDQVLLEKQLRSSI----PDSNPLVLTFDQFGVSGHINH 165
            H  R     V+DF+DGM+ VWD   +   L  +I     + N +++TFD +GVSGHINH
Sbjct: 117 LHNERAVSVQVMDFQDGMNEVWDIDSITSTLSQTIGINNNELNQIIVTFDSYGVSGHINH 176

Query: 166 ISCGRLVEKL---------------PYSHKLHLRS-DQPIYVKYSAFIAGIFQLGISTVY 209
            SC   V KL               P    L+LRS    I +KY++FI  I ++    + 
Sbjct: 177 KSCHTAVRKLIADYTRSNVRKEVKTPLITALYLRSYKNNIVLKYNSFIWEILRMLYGLIS 236

Query: 210 PDYGKPRC-------------FISTLPQYLLAASAMSLAHTSQMVWFRVGWWLFSRFCFI 256
           P     +               ++T  QY+LA +AM  AH SQ+VWFR GWW+ SRF F+
Sbjct: 237 PFRKTTQALPSDVVAEKNSLLLMNTHAQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFV 296

Query: 257 NE 258
           NE
Sbjct: 297 NE 298

>Skud_13.453 Chr13 (805536..806438) [903 bp, 300 aa] {ON} YMR281W
           (REAL)
          Length = 300

 Score =  176 bits (447), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 95/243 (39%), Positives = 137/243 (56%), Gaps = 32/243 (13%)

Query: 49  TSVTLVVAHPDDEVMFFSPTLTQFNELLPISIPINVVCMTAGDADGLGHIRKQELVDSLR 108
           + + LV+AHPDDEVMFFSP ++Q +   PI++P N++C++ G+ADGLG  R +EL  S  
Sbjct: 53  SQINLVIAHPDDEVMFFSPVISQLHSYFPITVPFNIICLSKGNADGLGESRVKELNGSAA 112

Query: 109 IMFHG-RQFGCDVLDFEDGMDAVWDQVLLEKQLRSSIPDSNP----LVLTFDQFGVSGHI 163
           ++    R     V+DFEDGMD VWD   +   +  +I  SN     +++TFD +GVS HI
Sbjct: 113 LLLQNERPVSVQVMDFEDGMDEVWDINSIVSTISQTIDLSNEQLNQIIVTFDSYGVSDHI 172

Query: 164 NHISCGRLVEKL---------------PYSHKLHLRS-DQPIYVKYSAFIAGIFQLGIST 207
           NH SC   V++L               P+   L+L+S    I +KY++FI  I ++  S 
Sbjct: 173 NHKSCHTAVKRLIDRYAESKAETNEETPHITALYLKSYKNNIVLKYNSFIWEILKILYSV 232

Query: 208 VYP-----------DYGKPRCFISTLPQYLLAASAMSLAHTSQMVWFRVGWWLFSRFCFI 256
           + P                   ++T  QY+LA +AM  AH SQ+VWFR GWW+ SRF F+
Sbjct: 233 IVPFPKTIQPPTTTTQRSKLLLMNTHAQYVLAYAAMLNAHKSQVVWFRYGWWILSRFVFV 292

Query: 257 NEL 259
           NE 
Sbjct: 293 NEF 295

>NCAS0C00380 Chr3 complement(55971..56801) [831 bp, 276 aa] {ON}
           Anc_8.846 YMR281W
          Length = 276

 Score =  173 bits (439), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 98/225 (43%), Positives = 131/225 (58%), Gaps = 19/225 (8%)

Query: 49  TSVTLVVAHPDDEVMFFSPTLTQFNELLPISIPINVVCMTAGDADGLGHIRKQELVDSLR 108
           T++ LV+AHPDDEVMFF+PTL Q + L+P+SIPINV+C + GDA GLG  R+ EL  S+ 
Sbjct: 53  TTLNLVIAHPDDEVMFFAPTLLQLDNLMPLSIPINVICFSNGDAQGLGEKRQHELQSSIH 112

Query: 109 IMFHG-RQFGCDVLDFEDGMDAVWDQVLLEKQLRSSIPDSN-PLVLTFDQFGVSGHINHI 166
            +    RQ    VL F+DG D +WD      Q+   +P ++    LTFD  GVSGH NHI
Sbjct: 113 ALIQNQRQTNVTVLHFQDGNDQIWD----IDQMTQYLPQNDHQAFLTFDSHGVSGHKNHI 168

Query: 167 SCGRLVEKLPYSHK----LHLRS-DQPIYVKYSAFIAGIFQLGISTVYPDYGKPR----- 216
           +C   V  L  ++     L L S    +  KY+ FI  + +L  + ++ D  +P+     
Sbjct: 169 ACHNAVWNLKNTNNNVTILTLDSIHHSLLAKYTFFIIDLVKLYWN-LWKDQQQPQWESHD 227

Query: 217 --CFISTLPQYLLAASAMSLAHTSQMVWFRVGWWLFSRFCFINEL 259
              F +   QY+LA S M  AH SQ+VWFR GWW FSRF F N L
Sbjct: 228 KITFFNAYSQYILAYSTMLNAHKSQVVWFRYGWWAFSRFVFSNHL 272

>KNAG0J00240 Chr10 complement(32153..33013) [861 bp, 286 aa] {ON}
           Anc_8.846 YMR281W
          Length = 286

 Score =  173 bits (438), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 98/234 (41%), Positives = 137/234 (58%), Gaps = 22/234 (9%)

Query: 48  LTSVTLVVAHPDDEVMFFSPTLTQFNE-LLPISIPINVVCMTAGDADGLGHIRKQELVDS 106
           + SV LV+AHPDDEVMFF+P+L   NE +   S   N++C + G ADGLG++R+QEL DS
Sbjct: 48  INSVNLVIAHPDDEVMFFAPSLINLNEQIRDPSTVFNIICFSNGGADGLGNVREQELSDS 107

Query: 107 LRIMFHGRQFGCDVLDFEDGMDAVWDQVLLEKQLRSSIPD-SNPLVLTFDQFGVSGHINH 165
           + ++   R     VLDF+DGM   WD   +  +LR+ +P   + ++LTFD  GVSGH+NH
Sbjct: 108 IAMLLPTRNTSIVVLDFKDGMKEKWDVKEMIAKLRNIVPKLGHNVLLTFDGKGVSGHLNH 167

Query: 166 ISCGRLV----EKLPYSHKLHLRSDQP----IYVKYSAFIAGIFQLGIST--------VY 209
           I+C R       +     KL + S Q     I  KYS++I  + +L  S+        V 
Sbjct: 168 IACYRAALGYYNEFKSKQKLTVLSLQSYSKNIVKKYSSYIWELIKLLYSSWVPSRLGNVL 227

Query: 210 PDYG----KPRCFISTLPQYLLAASAMSLAHTSQMVWFRVGWWLFSRFCFINEL 259
           P  G    +     ST PQY+L+ +AM  AH +Q+VWFR GWW FSR  F+N+L
Sbjct: 228 PKRGSNVARKITIFSTYPQYVLSLAAMLNAHKTQVVWFRYGWWFFSRLVFVNDL 281

>TDEL0B00520 Chr2 complement(94560..95366) [807 bp, 268 aa] {ON}
           Anc_8.846 YMR281W
          Length = 268

 Score =  168 bits (426), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 102/253 (40%), Positives = 145/253 (57%), Gaps = 19/253 (7%)

Query: 19  VIYGCLTKTIKEHN--RWYFHELVSESMVSKLTSVTLVVAHPDDEVMFFSPTLTQFNELL 76
           ++Y  LT  I   N  +W  H     + +    S+TL++AHPDDEVMFFSP+L Q + LL
Sbjct: 19  ILYVALTARINGRNEVQWQQHA----AAIGTPESLTLLIAHPDDEVMFFSPSLLQLDRLL 74

Query: 77  PISIPINVVCMTAGDADGLGHIRKQELVDSLRIMFHGRQFGCDV--LDFEDGMDAVW--D 132
           P S+  N VC++ GDAD LG  R+ EL  SL ++    Q    +   D+ DG D  W  +
Sbjct: 75  PQSVRFNFVCLSKGDADHLGETRELELQRSLNLLTSNSQRKTQLYQFDYPDGFDEKWEIE 134

Query: 133 QVLLEKQLRSSIPDSNPLVLTFDQFGVSGHINHISC----GRLVEKLPYSHK-LHLRS-D 186
            V+   + +  I     L+LTFD  GVS H NH++C     RL+EK    HK L+L S  
Sbjct: 135 SVVSIVESKVFIGSGFNLLLTFDAHGVSNHPNHVACHNAVARLIEK---GHKALYLNSHS 191

Query: 187 QPIYVKYSAFIAGIFQLGISTVYPDYGKPRCFISTLPQYLLAASAMSLAHTSQMVWFRVG 246
           + + +KYS FI  + ++   +V         F+++ PQY+LA +AM+ AH SQ+VWFR G
Sbjct: 192 RNLPLKYSGFIWELIRMLSDSVMKLERTGLTFMNSFPQYILAFAAMANAHESQLVWFRYG 251

Query: 247 WWLFSRFCFINEL 259
           WW  SRF F+N+L
Sbjct: 252 WWSLSRFVFVNDL 264

>ZYRO0G14300g Chr7 (1145709..1146551) [843 bp, 280 aa] {ON} similar
           to uniprot|P23797 Saccharomyces cerevisiae YMR281W GPI12
           ER membrane protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly the
           de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 280

 Score =  164 bits (415), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 100/272 (36%), Positives = 150/272 (55%), Gaps = 23/272 (8%)

Query: 9   KFVLWYLVFLVIYGCLTKTIKEHNRWYFHELVSESMVSKLTSVTLVVAHPDDEVMFFSPT 68
           KF   Y +  V++   +  IK  N   F++ +    + ++ S++LVVAHPDDEVMFF+PT
Sbjct: 6   KFPKVYFLLWVLFIAFSVRIKSRNGSVFNDNLK--FLDEIDSLSLVVAHPDDEVMFFAPT 63

Query: 69  LTQFNELLPISIPINVVCMTAGDADGLGHIRKQELVDSLRIMFHG--RQFGCDVLDFEDG 126
           + + +  LP ++  NVVC++ G AD LG  R QEL +S+ ++     RQ+     D+ DG
Sbjct: 64  ILELDSRLPPNVEFNVVCLSKGGADELGDTRVQELKESVNLLLANSKRQYQLQQHDYPDG 123

Query: 127 MDAVWDQVLLEKQLRSSIPDS--NPLVLTFDQFGVSGHINHISCGRLVEKLPYSHK---- 180
            +  WDQ  ++  ++ S+     + ++LTFD  GVS H+NHI+C   V  L         
Sbjct: 124 HEETWDQESVQSTIKDSVLQGRRSSVLLTFDDKGVSKHVNHIACHEAVSNLVQDESNVKA 183

Query: 181 -LHLRS-DQPIYVKYSAFIAGIFQLG--------ISTVYPDYGKPRCFI---STLPQYLL 227
            L+L S    I +KYSAF   I++L         + T   +  KP   I   S    Y+L
Sbjct: 184 ALYLDSYGDNIVLKYSAFFWEIWKLTRDWFLHRVLPTSSYNENKPATEITLMSDYSSYIL 243

Query: 228 AASAMSLAHTSQMVWFRVGWWLFSRFCFINEL 259
           + ++M  +H SQMVWFR GWW FSRF F+N+L
Sbjct: 244 SFASMLHSHKSQMVWFRYGWWTFSRFVFVNDL 275

>TPHA0I00280 Chr9 (54103..55008) [906 bp, 301 aa] {ON} Anc_8.846
           YMR281W
          Length = 301

 Score =  164 bits (416), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 104/287 (36%), Positives = 163/287 (56%), Gaps = 42/287 (14%)

Query: 14  YLVFLVIYGCLTKTIKEHNRWYFHELVSESMVSK-LTSVTLVVAHPDDEVMFFSPTLTQF 72
           Y +  ++Y  LT  I++ N   F+  V  ++  + L SV L++AHPDDEVMFF+PTL Q 
Sbjct: 11  YCILSILYIWLTPHIEDLNLKSFYSNVQLNISQQSLKSVNLIIAHPDDEVMFFTPTLLQL 70

Query: 73  NELLPISIPINVVCMTAG-DADG--LGHIRKQELVDSLRIMFHGRQFGCD------VLDF 123
           +++LP  +P NV+C++ G D DG  +G +R  E++DSL ++   R+ G +        ++
Sbjct: 71  DDILPTHVPFNVICLSKGVDVDGRAVGDLRSNEIMDSLTMLLGHRRAGLNREVKLHQFEY 130

Query: 124 EDGMDAVWD--QVLLEKQ----LRSSIPDSNPLVLTFDQFGVSGHINHISCGRLVEKLPY 177
           EDGMD  WD  +V+ + Q    + S++      +LTFD  GVS H NHI+C   +  L  
Sbjct: 131 EDGMDKQWDISKVVTDIQNTISMESNVDGLKHWLLTFDAQGVSEHPNHIACYDAMMTLKQ 190

Query: 178 SHK-------LHLRS-DQPIYVKYSAFIAGIFQLGIS-----------------TVYPDY 212
                     + L S    I +KYS+F+  +F+L I+                 +++ ++
Sbjct: 191 KSSNPGDYLLMTLNSYGSNIILKYSSFLPVVFKLLINIINDKFRIFELKQVPFLSMHKEH 250

Query: 213 GKPRCFISTLPQYLLAASAMSLAHTSQMVWFRVGWWLFSRFCFINEL 259
            + + FI+T P Y++A S+M  +HTSQMVWFR GWW FSRF F+N+L
Sbjct: 251 DQIQ-FINTFPHYIMALSSMLNSHTSQMVWFRYGWWSFSRFVFVNDL 296

>KAFR0B03960 Chr2 (829312..830148) [837 bp, 278 aa] {ON} Anc_8.846
           YMR281W
          Length = 278

 Score =  162 bits (410), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 101/260 (38%), Positives = 141/260 (54%), Gaps = 17/260 (6%)

Query: 15  LVFLVIYGCLTKTIKEHNRWYFHELVSESMVSKLT--SVTLVVAHPDDEVMFFSPTLTQF 72
           L+F  +Y  L+  I+  N    +  +   +  +    S+TLVVAHPDDEVMFFSPTL Q 
Sbjct: 16  LIFWCLYIVLSPKIQLSNDQILNTFIPSLIKDRSNDPSLTLVVAHPDDEVMFFSPTLLQL 75

Query: 73  NELLPISIPINVVCMTAGDADGLGHIRKQELVDSLRIMFHGRQFGCDVLDFEDGMDAVWD 132
           +  LP +   N++  + GDA+GLG +R  EL  S+ ++   R     + +  DGM+ VWD
Sbjct: 76  DSHLPPNCKFNIISYSDGDAEGLGSLRSNELAHSIDMLIPRRNKEIFIFNHTDGMNEVWD 135

Query: 133 QVLLEKQLRSSIPDSNP-LVLTFDQFGVSGHINHISCGRLVEKLPYSH-----KLHLRS- 185
             L+  QL S + DS   ++LTFDQFGVS HINH +C ++V     SH      L L S 
Sbjct: 136 NKLMLHQLESILSDSQTNILLTFDQFGVSNHINHKACHQVVTSYIQSHAKNNFALLLDSY 195

Query: 186 DQPIYVKYSAFIAGIFQLGISTVYPDYGK--PR----CFISTLPQYLLAASAMSLAHTSQ 239
              +  KY+ F   +  L  +  Y  +GK  P        +    Y+ A + M  AH SQ
Sbjct: 196 SSNLLKKYTGFAWQLVFLAKN--YWIHGKTLPNLDHLALFNPYSDYITAYATMLKAHKSQ 253

Query: 240 MVWFRVGWWLFSRFCFINEL 259
           MVWFR GWW FSRF ++N+L
Sbjct: 254 MVWFRYGWWFFSRFVYVNDL 273

>CAGL0M03047g Chr13 (346435..347349) [915 bp, 304 aa] {ON} weakly
           similar to uniprot|P23797 Saccharomyces cerevisiae
           YMR281w GPI12 N-acetylglucosaminyl phosphatidylinositol
           deacetylase
          Length = 304

 Score =  155 bits (391), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 100/275 (36%), Positives = 147/275 (53%), Gaps = 35/275 (12%)

Query: 15  LVFLVIYGCLTKTIKEHNRWYFHELVSESMVSKLTSVTLVVAHPDDEVMFFSPTLTQFNE 74
           ++F V+Y   T  +++ N+    +L+          + LV+AHPDDE+MFFSPT+ Q   
Sbjct: 30  IIFQVLYIYFTPKVEDLNKENLTKLLPTH--DNFGVLNLVIAHPDDEIMFFSPTILQ--- 84

Query: 75  LLPISIPINVVCMTAGDADGLGHIRKQELVDS---LRIMFHGRQFGCDVLDFEDGMDAVW 131
           L+     +NVVC++ GDADGLG +R +EL D+   L +  + R    ++LD+ DG + VW
Sbjct: 85  LIDHVQELNVVCLSNGDADGLGELRAKELKDAIGYLTVNRNLRNVSLNILDYTDGQNEVW 144

Query: 132 DQVL--LEKQLRSSIP--DSNPLVLTFDQFGVSGHINHISCGRLVEKLPYSHK------L 181
             V   L+K + +S P      ++LTFD+ G+SGH NHI+C   V     + K      L
Sbjct: 145 SGVATDLKKYILTSEPGVKQKDIILTFDREGISGHRNHIACNEGVISYLKTIKSNSFVFL 204

Query: 182 HLRSDQP--IYVKYSAFIAGIFQL------GISTVYPDYGKPR---------CFISTLPQ 224
            L+S     I  KYS  +  + ++        +  +  Y   R         CFIST  Q
Sbjct: 205 ELKSLSTWQIISKYSGVVPKLLEIIYNKIRASNKTFVSYLPNRDSIATDSNVCFISTFDQ 264

Query: 225 YLLAASAMSLAHTSQMVWFRVGWWLFSRFCFINEL 259
           Y L+ +AM  AH SQMVWFR  WW FSR+ F+N+L
Sbjct: 265 YALSFAAMCYAHKSQMVWFRYLWWSFSRYVFVNDL 299

>TBLA0B03300 Chr2 (771332..772291) [960 bp, 319 aa] {ON} Anc_8.846
           YMR281W
          Length = 319

 Score =  154 bits (389), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 107/302 (35%), Positives = 153/302 (50%), Gaps = 58/302 (19%)

Query: 15  LVFLVIYGCLTKTIKEHNRWYFH------ELVSESMVSKLTSVTLVVAHPDDEVMFFSPT 68
           L+F +IY   + +IK  N   F+      +L+S     K+ S++L++AHPDDE+MFFSPT
Sbjct: 15  LIFWLIYIFNSNSIKLLNDQSFNYFNKHIQLMSNKQHVKINSLSLIIAHPDDEIMFFSPT 74

Query: 69  LTQFNELLPISIPINVVCMTAGDADGLGHI----RKQELVDSLRIMF-------HGRQFG 117
           L Q N  L   I  NVVC++ G  D  G      R  EL DSL ++F       H R F 
Sbjct: 75  LLQLNNYLEKDIMFNVVCLSQG-LDSTGSFKDPQRVHELNDSLNLLFNRGSNNEHNRNFK 133

Query: 118 CDVLDFEDGMDAVWDQVLLEKQLRSSIPDSN---PLVLTFDQFGVSGHINHISCGRLVEK 174
              LD+ DGM  +W+  L+   L  ++  ++    L+LTFD+ GVS H NH++C   V K
Sbjct: 134 LIQLDYTDGMKEIWNMDLIVDDLLQNLNFTDNGINLLLTFDKSGVSNHKNHLACNEAVTK 193

Query: 175 -LPYSH------KLHLRS-DQPIYVKYSAFIAGIFQL-------GISTVY------PDYG 213
            L YS+       + L S  +  ++KYS F++ +F +        IS  Y       D+ 
Sbjct: 194 LLKYSNPDSNLIGIFLNSHSKNFFLKYSFFVSKLFTIIKLKFFRSISLFYSFCFPNSDFL 253

Query: 214 KPR----------------CFISTLPQYLLAASAMSLAHTSQMVWFRVGWWLFSRFCFIN 257
           +                   F +   +Y+L+ S M  AH SQMVWFR  WW+FSRF FIN
Sbjct: 254 QSYQIISHYDLNTKTNLSFTFFNPFAKYMLSYSTMLNAHESQMVWFRYLWWIFSRFAFIN 313

Query: 258 EL 259
           +L
Sbjct: 314 DL 315

>Kpol_1068.4 s1068 complement(6124..6999) [876 bp, 291 aa] {ON}
           complement(6124..6999) [876 nt, 292 aa]
          Length = 291

 Score =  146 bits (369), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 92/240 (38%), Positives = 131/240 (54%), Gaps = 26/240 (10%)

Query: 46  SKLTSVTLVVAHPDDEVMFFSPTLTQFNELLPISIPINVVCMTAG-DADG--LGHIRKQE 102
           S  +SV LV+AHPDDEVMFFSPTL Q +  LP  + INV+C + G + DG   G  R +E
Sbjct: 43  SGSSSVNLVIAHPDDEVMFFSPTLMQLDNWLPNDVAINVICFSKGVNVDGSIAGESRARE 102

Query: 103 LVDSLRIMF-HGRQFGCDVLDFEDGMDAVWDQVLLEKQLRSSIPDS-----NPLVLTFDQ 156
           L  S+ ++  H R      LD++DG D +WD   +   L++ I  S       L++TFD+
Sbjct: 103 LKKSVSMLIEHDRPVTVHQLDYKDGKDQIWDLDSMVWDLKTLINPSKDYKRKDLLITFDE 162

Query: 157 FGVSGHINHISC----GRLVEKLPYSHKLHLRSDQP-IYVKYSAFIAGIFQL-------- 203
            GVS H NHI+C     RL+E+ P      L S    + +KYS F   I +         
Sbjct: 163 HGVSDHPNHIACHNAVHRLIEEEPLFMAYQLESHSTNVILKYSFFAREIVKYFYNYCHQR 222

Query: 204 --GISTVYPDYGKPRCFI--STLPQYLLAASAMSLAHTSQMVWFRVGWWLFSRFCFINEL 259
             G +++  +   P  ++  +T  +Y++A + M  AH SQ+VWFR GWW FSR  + NEL
Sbjct: 223 IKGQTSLNKNMDVPYEYVLFNTHSEYIMAYATMLNAHESQVVWFRYGWWFFSRLTYANEL 282

>TPHA0G01890 Chr7 (392062..394737) [2676 bp, 891 aa] {ON} Anc_8.626
           YPL126W
          Length = 891

 Score = 33.5 bits (75), Expect = 0.63,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 135 LLEKQLRSSIPDSNPLVLTFDQFGVSGHINHISCGRLVEKLPYSHKLHLRSDQPIY 190
           LL+ Q  +SI +SN ++  F   G    +N+   G+++EK P + KL L  D+ +Y
Sbjct: 94  LLKNQTENSIDESNKIITIFSNHGYIFAVNYK--GKMIEK-PENIKLSLEEDEEVY 146

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.328    0.142    0.450 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 27,658,007
Number of extensions: 1128561
Number of successful extensions: 3261
Number of sequences better than 10.0: 23
Number of HSP's gapped: 3280
Number of HSP's successfully gapped: 24
Length of query: 263
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 156
Effective length of database: 41,212,137
Effective search space: 6429093372
Effective search space used: 6429093372
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 64 (29.3 bits)