Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D01408g8.847ON51851827590.0
SAKL0D01298g8.847ON5514304613e-50
Ecym_46188.847ON5274044411e-47
KLTH0C03718g8.847ON5514383973e-41
ZYRO0G14322g8.847ON5505093807e-39
TDEL0B005108.847ON5504053612e-36
Kwal_27.102248.847ON5464863507e-35
Kpol_1068.38.847ON5664523313e-32
Suva_13.4718.847ON5814123163e-30
Smik_13.4958.847ON5763913012e-28
TPHA0I002908.847ON5694452853e-26
Skud_13.4548.847ON5804152826e-26
ABL119C8.847ON5374002818e-26
YMR282C (AEP2)8.847ON5803682773e-25
TBLA0B033108.847ON6133652481e-21
KAFR0B039708.847ON4743892311e-19
KNAG0J002308.847ON4744142283e-19
NCAS0C003708.847ON4954072184e-18
CAGL0M03069g8.847ON5483891803e-13
NDAI0K003408.847ON6244821502e-09
Kwal_14.13144.165ON111173820.24
KLLA0C18700gna 1ON128888742.2
KLLA0D03927gsingletonON20247703.4
ZYRO0G05918g2.129ON47959714.2
Suva_5.2007.368ON57525705.8
NDAI0H019207.28ON83048697.6
Kpol_543.735.261ON1666101698.7
TBLA0I01170singletonON223977699.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D01408g
         (518 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D01408g Chr4 (120712..122268) [1557 bp, 518 aa] {ON} weakly...  1067   0.0  
SAKL0D01298g Chr4 (98188..99843) [1656 bp, 551 aa] {ON} weakly s...   182   3e-50
Ecym_4618 Chr4 complement(1210600..1212183) [1584 bp, 527 aa] {O...   174   1e-47
KLTH0C03718g Chr3 (321675..323330) [1656 bp, 551 aa] {ON} weakly...   157   3e-41
ZYRO0G14322g Chr7 complement(1146574..1148226) [1653 bp, 550 aa]...   150   7e-39
TDEL0B00510 Chr2 (92878..94530) [1653 bp, 550 aa] {ON} Anc_8.847...   143   2e-36
Kwal_27.10224 s27 (248037..249677) [1641 bp, 546 aa] {ON} YMR282...   139   7e-35
Kpol_1068.3 s1068 (4295..5995) [1701 bp, 566 aa] {ON} (4295..599...   132   3e-32
Suva_13.471 Chr13 complement(816054..817799) [1746 bp, 581 aa] {...   126   3e-30
Smik_13.495 Chr13 complement(816375..818105) [1731 bp, 576 aa] {...   120   2e-28
TPHA0I00290 Chr9 complement(55148..56857) [1710 bp, 569 aa] {ON}...   114   3e-26
Skud_13.454 Chr13 complement(806601..808343) [1743 bp, 580 aa] {...   113   6e-26
ABL119C Chr2 complement(175840..177453) [1614 bp, 537 aa] {ON} S...   112   8e-26
YMR282C Chr13 complement(833356..835098) [1743 bp, 580 aa] {ON} ...   111   3e-25
TBLA0B03310 Chr2 complement(772555..774396) [1842 bp, 613 aa] {O...   100   1e-21
KAFR0B03970 Chr2 complement(830202..831626) [1425 bp, 474 aa] {O...    94   1e-19
KNAG0J00230 Chr10 (30660..32084) [1425 bp, 474 aa] {ON} Anc_8.84...    92   3e-19
NCAS0C00370 Chr3 (54433..55920) [1488 bp, 495 aa] {ON} Anc_8.847...    89   4e-18
CAGL0M03069g Chr13 complement(347584..349230) [1647 bp, 548 aa] ...    74   3e-13
NDAI0K00340 Chr11 complement(64928..66802) [1875 bp, 624 aa] {ON...    62   2e-09
Kwal_14.1314 s14 complement(273836..277171) [3336 bp, 1111 aa] {...    36   0.24 
KLLA0C18700g Chr3 complement(1658267..1662133) [3867 bp, 1288 aa...    33   2.2  
KLLA0D03927g Chr4 (331864..332472) [609 bp, 202 aa] {ON} no simi...    32   3.4  
ZYRO0G05918g Chr7 complement(466947..468386) [1440 bp, 479 aa] {...    32   4.2  
Suva_5.200 Chr5 (305198..306925) [1728 bp, 575 aa] {ON} YER087W ...    32   5.8  
NDAI0H01920 Chr8 (470097..472589) [2493 bp, 830 aa] {ON} Anc_7.2...    31   7.6  
Kpol_543.73 s543 complement(172906..177906) [5001 bp, 1666 aa] {...    31   8.7  
TBLA0I01170 Chr9 (245439..252158) [6720 bp, 2239 aa] {ON}              31   9.9  

>KLLA0D01408g Chr4 (120712..122268) [1557 bp, 518 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 518

 Score = 1067 bits (2759), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/518 (100%), Positives = 518/518 (100%)

Query: 1   MLKKSRVLGKIPIPYLIKGSSCFYSTVVTSAPITLEDSLQSILSDIQDGSNIVTPNKPNT 60
           MLKKSRVLGKIPIPYLIKGSSCFYSTVVTSAPITLEDSLQSILSDIQDGSNIVTPNKPNT
Sbjct: 1   MLKKSRVLGKIPIPYLIKGSSCFYSTVVTSAPITLEDSLQSILSDIQDGSNIVTPNKPNT 60

Query: 61  NLLTSKQPIKALKHLQWKTNLRVKKTTRLLKYSNEKLTPEDYSVFVNQLMDVYSKDIELL 120
           NLLTSKQPIKALKHLQWKTNLRVKKTTRLLKYSNEKLTPEDYSVFVNQLMDVYSKDIELL
Sbjct: 61  NLLTSKQPIKALKHLQWKTNLRVKKTTRLLKYSNEKLTPEDYSVFVNQLMDVYSKDIELL 120

Query: 121 NKTEVWKSLYHIYRVFVVNAVDDGNAMVLYDLNQFVRMFINLNDLPLARNVFQLILKNSK 180
           NKTEVWKSLYHIYRVFVVNAVDDGNAMVLYDLNQFVRMFINLNDLPLARNVFQLILKNSK
Sbjct: 121 NKTEVWKSLYHIYRVFVVNAVDDGNAMVLYDLNQFVRMFINLNDLPLARNVFQLILKNSK 180

Query: 181 NGEIPKDVQTICMYLRLYCGALSELWTTQTSRNFYQDLIGSLSGSNASSIRIPSHIAYPT 240
           NGEIPKDVQTICMYLRLYCGALSELWTTQTSRNFYQDLIGSLSGSNASSIRIPSHIAYPT
Sbjct: 181 NGEIPKDVQTICMYLRLYCGALSELWTTQTSRNFYQDLIGSLSGSNASSIRIPSHIAYPT 240

Query: 241 IGVPQFQLLLRKLVEDPEYSKLRNTEMDSLIIQALGHYKEVPFLKQYISIFYGIDENVTI 300
           IGVPQFQLLLRKLVEDPEYSKLRNTEMDSLIIQALGHYKEVPFLKQYISIFYGIDENVTI
Sbjct: 241 IGVPQFQLLLRKLVEDPEYSKLRNTEMDSLIIQALGHYKEVPFLKQYISIFYGIDENVTI 300

Query: 301 TETHPGIKKLTPDSQLLKSVISAYGHNNNITSGMTVIGSFMEKYPEMNLDKSFWRTTIYW 360
           TETHPGIKKLTPDSQLLKSVISAYGHNNNITSGMTVIGSFMEKYPEMNLDKSFWRTTIYW
Sbjct: 301 TETHPGIKKLTPDSQLLKSVISAYGHNNNITSGMTVIGSFMEKYPEMNLDKSFWRTTIYW 360

Query: 361 SLREWNKYKDSKGSQPKKAWNLMLNWYATIGKAVPFDQKIMLYRLSFLKSRKDHNAAIRD 420
           SLREWNKYKDSKGSQPKKAWNLMLNWYATIGKAVPFDQKIMLYRLSFLKSRKDHNAAIRD
Sbjct: 361 SLREWNKYKDSKGSQPKKAWNLMLNWYATIGKAVPFDQKIMLYRLSFLKSRKDHNAAIRD 420

Query: 421 VQQVFKRIFIKTEKNTFIVERLVLYAYQRFIIKNLVNQNENAKCVDFINEWRIDFENGRY 480
           VQQVFKRIFIKTEKNTFIVERLVLYAYQRFIIKNLVNQNENAKCVDFINEWRIDFENGRY
Sbjct: 421 VQQVFKRIFIKTEKNTFIVERLVLYAYQRFIIKNLVNQNENAKCVDFINEWRIDFENGRY 480

Query: 481 LERYFKELTHPKNESDEQKKLNDEDDDYNFPLFGTNIL 518
           LERYFKELTHPKNESDEQKKLNDEDDDYNFPLFGTNIL
Sbjct: 481 LERYFKELTHPKNESDEQKKLNDEDDDYNFPLFGTNIL 518

>SAKL0D01298g Chr4 (98188..99843) [1656 bp, 551 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 551

 Score =  182 bits (461), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 127/430 (29%), Positives = 205/430 (47%), Gaps = 27/430 (6%)

Query: 92  YSNEKLTPEDYSVFVNQLMDVYSKDIELLN------KTEVWKSLYHIYRVFVVNAVDDGN 145
           +S + +T  +YSVFVN+L+   +   EL N       TEV   LY IYR  VV     GN
Sbjct: 124 FSEKLITKLEYSVFVNKLLSNTNLKSELTNLIPGTVHTEVLFKLYEIYRDSVV-----GN 178

Query: 146 AMV----LYDLNQFVRMFINLNDLPLARNVFQLILKNSKNGEIPKDVQTICMYLRLYCGA 201
           A +    LYDLNQF++ F     L  A+ V   +L+N   G IP+D QT+  YL L CGA
Sbjct: 179 ATLTPVQLYDLNQFIKRFTGDAQLAKAQQVLGFVLENY--GSIPRDPQTLINYLELKCGA 236

Query: 202 LSELWTTQTSRNFYQDLIGSLS-GSNASSIRIPSHIAYPTIGVPQFQLLLRKLVEDPEYS 260
           +   W+   SR      +GS S  SN +        +Y  +       L+ ++++D  + 
Sbjct: 237 MPRNWSIPLSRPELGKTLGSQSFMSNLAH-------SYKVLETEALLPLIDEMMKDRAWH 289

Query: 261 KLRNTEMDSLIIQALGHYKEVPFLKQYISIFYGIDENVTITETHPGIKKLTPDSQLLKSV 320
             RN ++++ +I +LG+  +   L++YI   +G+  +   +      K L P S LL S+
Sbjct: 290 YKRNCDLEAAVIYSLGYMGQFALLERYIKHTWGVSVSSNTSTEVEVPKNLYPTSNLLISI 349

Query: 321 ISAYGHNNNITSGMTVIGSFMEKYPEMNLDKSFWRTTIYWSLREWNKYKDSKGSQPKKAW 380
           +S Y    N+   + +I SF+ K+P++ L+  FWR    WS R WN+  D KG      W
Sbjct: 350 VSCYAMKGNLHQALQIIDSFLSKFPQIELEPLFWRRLFQWSTRLWNQKTDPKGELSNGCW 409

Query: 381 NLMLNWYATIGKAVPFDQKIMLYRLSFLKSRKDHNAAIRDVQQVFKRIFIKTEKNTFIVE 440
            +M  W+    +++P D  I+  R   LK   +   A+R   +    +++K  +N    E
Sbjct: 410 QVMKQWHNKQKRSLPIDLGILNERYYVLKRTNNFTEALRIHDEALAGLYMK--RNLIDPE 467

Query: 441 RLVLYAYQRFIIKNLVNQNENAKCVDFINEWRIDFENGRYLERYFKELTHPKNESDEQKK 500
             V+  +Q+ I+K +  +    K + +I+EW ++  N   +  YF           EQ+K
Sbjct: 468 VDVIKKFQKLILKKMAGRGYYHKPLKYISEWCLNKRNELEMREYFDRHRKAYITRIEQRK 527

Query: 501 LNDEDDDYNF 510
              E     F
Sbjct: 528 QKQETAQVTF 537

>Ecym_4618 Chr4 complement(1210600..1212183) [1584 bp, 527 aa] {ON}
           similar to Ashbya gossypii ABL119C
          Length = 527

 Score =  174 bits (441), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 106/404 (26%), Positives = 203/404 (50%), Gaps = 23/404 (5%)

Query: 95  EKLTPEDYSVFVNQLMDVYSKDIELLNK------TEVWKSLYHIYRVFVVNAVDDG-NAM 147
           ++++ E++S+F N+L+        L           +   LY  Y   +          M
Sbjct: 95  QEMSSEEFSIFFNRLLPTSGSSFSLKEAIPENMVVPLANKLYQFYMAILEREKKTRFTPM 154

Query: 148 VLYDLNQFVRMFINLNDLPLARNVFQLILKNSKNGEIPKDVQTICMYLRLYCGALSELWT 207
            L+DLN+F   F+N N L LAR V Q IL+ + + ++P+D QT+  Y +LY G+L+ LW 
Sbjct: 155 ELHDLNKFSNWFLNENKLKLARKVLQQILRQTGSEQLPRDHQTLVTYFQLYLGSLASLWP 214

Query: 208 TQTSRNFYQDLIGSLSGSNASSIRIPSHIAYPTIGVPQFQLLLRKLVEDPEYSKLRNTEM 267
           T   ++   D +  + GS     R P ++ Y ++       +L+KL+E+ ++  LR++E+
Sbjct: 215 TPKVQSACYDKL--VRGS-----RRPKYVVYNSLPEGIMYDVLQKLLENDDWKHLRSSEL 267

Query: 268 DSLIIQALGHYKEVPFLKQYISIFYGIDENVTITETHPGI---KKLTPDSQLLKSVISAY 324
           D+ I+ +L HY  +   + ++   +GI ++    E    +       P S++L ++++++
Sbjct: 268 DAKILYSLCHYNRMDLFEGFMERAWGIVDHPKKVEKEVPVDISSGTYPGSEVLIAIVTSF 327

Query: 325 GHNNNITSGMTVIGSFMEKYPEMNLDKSFWRTTIYWSLREWNKYKDSKGSQPKKAWNLML 384
            + N++   + ++ +F+ KYP+M+L   FW     W+   +++  D  GS  K  W  ML
Sbjct: 328 SYRNDLEKAVRLVDAFLNKYPQMDLRTEFWEKLFLWTRVMFDRKLDPLGSLQKACWLRML 387

Query: 385 NWYATIGKAVPFDQKIMLYRLSFLKSRKDHNAAIRDVQQVFKRIFIKT--EKNTFIVERL 442
           +WY + G++VP+   +   R   LK   ++  A+         ++ K+   K+   V R 
Sbjct: 388 SWYKSRGESVPYSSYLASCRYEILKQTSNYKDAMAMFPDYMSAVYAKSAAAKHNLTVVR- 446

Query: 443 VLYAYQRFIIKNLVNQNENAKCVDFINEWRIDFENGRYLERYFK 486
               YQ+F+I+ L  + +   C  FI +WR + EN + L+  F+
Sbjct: 447 ---KYQKFVIRELSARGKRDACTQFIEQWRFNEENEKELQDTFQ 487

>KLTH0C03718g Chr3 (321675..323330) [1656 bp, 551 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 551

 Score =  157 bits (397), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 119/438 (27%), Positives = 209/438 (47%), Gaps = 40/438 (9%)

Query: 92  YSNEKLTPEDYSVF------VNQLMDVYSKDIELLNKTEVWKSLYHIYRVFVVNAVDDG- 144
           + N  L+  ++S F      VN L+   S  +  ++ TE+  SLY +Y    +  V  G 
Sbjct: 124 FQNNDLSIAEFSAFIEGLLSVNNLLHKLSATLPNVSGTEMVFSLYQLY----LKTVTPGP 179

Query: 145 -NAMVLYDLNQFVRMFINLNDLPLARNVFQLILKNSKNGEIPKDVQTICMYLRLYCGALS 203
            + + L+D N+F+R FI    L  A+ V   ILK S N ++P D  T   YL+L CGAL 
Sbjct: 180 LSPLQLHDFNKFIRFFIRSAQLRKAQTVLDCILK-SNNNQLPCDSATATHYLQLRCGALP 238

Query: 204 ELWTTQTSRNFYQDLIGSLS-GSNASSIRIPSHIAYPTIGVPQFQLLLRKLVEDPE--YS 260
             W         ++L  S   G+  +  ++ SH +Y  +      L    L+ DP+  + 
Sbjct: 239 RNWKV-----LDENLGRSTRLGARKNRYQLVSH-SYKALDHKSV-LTFMSLLSDPKSVWF 291

Query: 261 KLRNTEMDSLIIQALGHYKEVPFLKQYISIFYGID--ENVTITETHPGIKKLTPDSQLLK 318
             ++  ++S ++ +LG   ++  L++++   +GI   E+  +T+        +P S++L 
Sbjct: 292 HRKSAALESAVVYSLGFMGQLKLLEEHVWRNWGISLQEHNQVTDA----SFTSPSSEVLV 347

Query: 319 SVISAYGHNNNITSGMTVIGSFMEKYPEMNLDKSFWRTTIYWSLREWNKYKDSKGSQPKK 378
           +V+++Y  N NI+S + +I  FM KYP + LD  FWR    WS R W++  D +G   + 
Sbjct: 348 AVLTSYASNKNISSALHLIDGFMAKYPTLELDHVFWRRLFQWSTRVWSEKTDPRGELSRG 407

Query: 379 AWNLMLNWYATIGKAVPFDQKIMLYRLSFLKSRKDHNAAIRDVQQVFKRIFIKTEKNTFI 438
            W +M  W+A   + +P D  ++  R   L    ++  AI  V+Q +   F K   N   
Sbjct: 408 CWRVMREWHAARNRQLPADAVLLNERFVVLSRTNNYRDAIEVVEQCYSSFFQKA--NLSR 465

Query: 439 VERLVLYAYQRFIIKNLVNQNENAKCVDFINEWR----IDFENGRYLERYFKELTHPKNE 494
            E ++   + + I+KN+ +     K + FI EW     ++     Y E++    +  K  
Sbjct: 466 HEAVLFQKFAKLILKNMAHLGYYHKPLKFIKEWSPNKLLEHTLRAYFEKHRNAYSARKQR 525

Query: 495 SDE-----QKKLNDEDDD 507
             E     QK+ +DE++D
Sbjct: 526 RTEAAQKAQKRFDDEEED 543

>ZYRO0G14322g Chr7 complement(1146574..1148226) [1653 bp, 550 aa]
           {ON} weakly similar to uniprot|P22136 Saccharomyces
           cerevisiae YMR282C AEP2 Mitochondrial protein likely
           involved in translation of the mitochondrial OLI1 mRNA
           exhibits genetic interaction with the OLI1 mRNA 5'-
           untranslated leader
          Length = 550

 Score =  150 bits (380), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 133/509 (26%), Positives = 231/509 (45%), Gaps = 40/509 (7%)

Query: 25  STVVTSAPI-TLEDSLQSI-------LSDIQDGSNIVT-PNKPNTNLLTSKQPIKALKHL 75
           ST+ +  P+ TL D L +        L++  + S+  T PN      L + Q  K L  L
Sbjct: 48  STLKSELPLRTLNDELHNAERKYIKPLTNAPEWSSTRTGPNSKIREYLKNGQYTKLLIRL 107

Query: 76  QWKTNLRVKKTTRLLKYSNEKLTPEDYSVFVNQLMDVYSKDIELLN---KTEVWKSLYHI 132
               +L  +  + L  ++   LT  +YS+F+N+L+     D++L N    T   + +Y +
Sbjct: 108 SVDNHLNNEYISGL--FTTGGLTKSEYSLFINKLLSEEELDVKLSNVIPDTPHTELIYKL 165

Query: 133 YRVFVVNAVDDGN--AMVLYDLNQFVRMFINLNDLPLARNVFQLILKNSKNGEI--PKDV 188
           Y  +  + VD  N   + LYDLN F++ FI    L  A NV   IL      ++    DV
Sbjct: 166 YEFYCDHIVDQHNLTPLQLYDLNLFLKTFIAEAQLSKAHNVLDFILLRRPLNDLLANTDV 225

Query: 189 QTICMYLRLYCGALSELWTTQTSRNFYQDLIGSLSGSNASSIRIPSHIAYPTIGVPQFQL 248
           + +  +LRL CGALS+ W  Q +    ++      G  AS   +     +    V     
Sbjct: 226 EILIQFLRLKCGALSKFWKIQPASQ--RNSTAITLGEKASDCHLAKSYKFQNEKV--LLQ 281

Query: 249 LLRKLVEDPEYSKLRNTEMDSLIIQALGHYKEVPFLKQYISIFYGIDENVTITETHPGIK 308
           ++  ++ +  +   R+ ++D+ II +LG+  +   +++Y+        N T + +     
Sbjct: 282 IINSVLGEHNWKNRRSPKLDAAIIYSLGYLGQTDLIEKYV--------NRTWSPSKDEGV 333

Query: 309 KLTPDSQLLKSVISAYG-HNNNITSGMTVIGSFMEKYPEMNLDKSFWRTTIYWSLREWNK 367
           K  P+S LL +V+++Y     N+  G+ V+  F+  YPE+ LD  FWR  +  S   W+K
Sbjct: 334 KTNPNSDLLVAVLTSYCVKEGNMRKGLEVLDRFIRDYPEVELDPLFWRRLLQLSSLLWDK 393

Query: 368 YKDSKGSQPKKAWNLMLNWYATIGKAVPFDQKIMLYRLSFLKSRKDHNAAIRDVQQVFKR 427
            +D K +     W +M  W+A   + +P+D  IM          K+ N A+  + + F  
Sbjct: 394 KRDRKATLSHGCWTIMKQWHAQRQRKIPYDYGIMKELYPIFVRTKNKNGALEVITKSFFG 453

Query: 428 IFIKTEKNTFIVERLVLYAYQRFIIKNLVNQNENAKCVDFINEWRIDFENGRYLERYF-- 485
            FI+ E      E  +L  YQRFI+K +  +    K  +F  EW     N   L+ YF  
Sbjct: 454 AFIQPEFTIRPNELSLLCKYQRFILKMIALKGNYHKGFEFCQEWSFSSTNKFELQSYFMK 513

Query: 486 -------KELTHPKNESDEQKKLNDEDDD 507
                  +  +  K ++  Q+K ++ ++D
Sbjct: 514 WRGIHEQRRTSQSKQKAALQEKYDEMEED 542

>TDEL0B00510 Chr2 (92878..94530) [1653 bp, 550 aa] {ON} Anc_8.847
           YMR282C
          Length = 550

 Score =  143 bits (361), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 102/405 (25%), Positives = 192/405 (47%), Gaps = 25/405 (6%)

Query: 92  YSNEKLTPEDYSVFVNQLMDVYSKDIELLN------KTEVWKSLYHIYRVFVVNAVDDG- 144
           +  ++L+  ++S F+N+L+     D++L N       TE+  +LY IY  +V+    +G 
Sbjct: 121 FETKELSTSEFSTFINRLLLEKDLDLKLSNIIPDTVHTEIIFNLYQIYCTYVIKDSQNGL 180

Query: 145 NAMVLYDLNQFVRMFINLNDLPLARNVFQLILKNSKNGEIPK--DVQTICMYLRLYCGAL 202
             + ++D+N+F++ FI+   L  A+   Q ++       I +  DV+TI  +L+L CGAL
Sbjct: 181 TPLQVHDINRFIKRFIDEAQLKKAQECLQFLIDKQGLHNILQSGDVETITQFLQLRCGAL 240

Query: 203 SELWTTQTSRNFYQDLIGSLSGSNASSIRIPSHIAYPTIGVPQFQLLLRKLVEDPEYSKL 262
            + W   ++          + G ++   + P   +Y  +    F  ++  L++D  +   
Sbjct: 241 QKFWRVDSNST-------KVLGEDSKHFKSPK--SYNLLKEQPFLEIVNFLLKDKSWRLR 291

Query: 263 RNTEMDSLIIQALGHYKEVPFLKQYISIFYGIDENVTITETHPGIK-KLTPDSQLLKSVI 321
            +  +DS I+ +L +  +   + QYI + +GI E     + H  +K +  P  ++L +++
Sbjct: 292 SSPIIDSAIVYSLSNLGQTKLIDQYIQLKWGISE-----DGHVAVKNEAVPGHEVLINIV 346

Query: 322 SAYGHNNNITS-GMTVIGSFMEKYPEMNLDKSFWRTTIYWSLREWNKYKDSKGSQPKKAW 380
           SAY   N  T  G+ ++  FM+KYP+  L+K FWR  +  S   W+K KD K       W
Sbjct: 347 SAYCLKNGDTGKGLRILDQFMKKYPQTELEKLFWRRLLQLSFHNWDKQKDKKALVCHGCW 406

Query: 381 NLMLNWYATIGKAVPFDQKIMLYRLSFLKSRKDHNAAIRDVQQVFKRIFIKTEKNTFIVE 440
           N+M  W+   G ++ +D   +       K  ++   A   V+  F  ++ K        E
Sbjct: 407 NIMKQWHEQKGVSITYDSGTLRLLYQLFKFTRNGRGAAEVVRTCFSSVYAKQPYQISKDE 466

Query: 441 RLVLYAYQRFIIKNLVNQNENAKCVDFINEWRIDFENGRYLERYF 485
             +L  +Q+  +K +  +    + +  I EW +D  N  YL  YF
Sbjct: 467 MDLLLMFQKLALKTMALKGRYNEPLQLIKEWNVDKINQHYLLDYF 511

>Kwal_27.10224 s27 (248037..249677) [1641 bp, 546 aa] {ON} YMR282C
           (AEP2) - basic, hydrophilic 67.5 kDa protein [contig 39]
           FULL
          Length = 546

 Score =  139 bits (350), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 117/486 (24%), Positives = 228/486 (46%), Gaps = 29/486 (5%)

Query: 34  TLEDSLQSILSDIQDGSNIVTPNKPNTN----------LLTSKQPIKALKHLQWKTNLRV 83
           T+ D+ Q     +   +NI     P+++          LL +K  IK +  L  ++ L  
Sbjct: 53  TMADAFQDKTKGLICATNIHQAESPSSDTTQGMNRLRSLLNTKDYIKFMIELTIQSKLNS 112

Query: 84  KKTTRLLKYSNEKLTPEDYSVFVNQLM---DVYSKDIELLNKTEVWKSLYHIYRVFVVN- 139
             + ++  + +  LTP ++S  +N L+   ++ +K   +L   +  + ++ +Y+ +++  
Sbjct: 113 NFSHKI--FEDNLLTPNEFSTLLNGLLTERNLSTKLETVLPSVQSTEMIFGLYQTYLMTI 170

Query: 140 AVDDGNAMVLYDLNQFVRMFINLNDLPLARNVFQLILKNSKNGEIPKDVQTICMYLRLYC 199
                N + L+DLN FV+ FI    L  A+ V   IL  S N ++P D  T   YL+L C
Sbjct: 171 PAGSLNPLQLHDLNSFVQYFIETAQLGKAQIVLDRILA-SNNDQLPCDTTTGIHYLQLRC 229

Query: 200 GALSELWTTQTSRNFYQDLIGSLSGSNASSIRIPSHIAYPTIGVPQFQLLLRKLVEDPEY 259
           GAL   W    SR  +   +GS    N S     ++ A     V +F  +L    E+ E+
Sbjct: 230 GALPRNWKVFDSRVGHSCRLGS--HRNKSQPVSHTYKALDQSSVLEFVNVLND--ENSEW 285

Query: 260 SKLRNTEMDSLIIQALGHYKEVPFLKQYISIFYGIDENVTITETHPGIKKLTPDSQLLKS 319
              ++  +++ +I +LG   ++  LK++I++ +GI E      T   + ++ P  ++L +
Sbjct: 286 FHKKSPTLEAAVIYSLGFMGQLTLLKEHIAVRWGITELGASLATE--VNEVPPSPEVLIA 343

Query: 320 VISAYGHNNNITSGMTVIGSFMEKYPEMNLDKSFWRTTIYWSLREWNKYKDSKGSQPKKA 379
           + +++  +  +T G+ ++ +F+ KY E+NLD  FWR    W+   W+   D +G   +  
Sbjct: 344 IFTSFASHQEVTLGLRLMDAFITKYSEINLDIVFWRRLFQWTNLVWDVKTDPRGDLSRGC 403

Query: 380 WNLMLNWYATIGKAVPFDQKIMLYRLSFLKSRKDHNAAIRDVQQVFKRIFIKTEKNTFIV 439
           W +M  W+    K +  D  ++  R   L    ++  A+  + Q F +++   EK T   
Sbjct: 404 WRVMTEWHEKGSKKLQPDTTLLNERYFVLAQTNNYKEALTVISQSFPQLY---EKPTLSS 460

Query: 440 -ERLVLYAYQRFIIKNLVNQNENAKCVDFINEWRIDFENGRYLERYFKELTHPKNESDEQ 498
            E  ++  Y + ++K++       K + FI EW  +      L  YFK+  H    +  +
Sbjct: 461 KEMAIVQKYSKLVLKSMAELGYYHKPLTFITEWSPNKAVEDSLRVYFKK--HRDGFTKRK 518

Query: 499 KKLNDE 504
           ++L +E
Sbjct: 519 ERLREE 524

>Kpol_1068.3 s1068 (4295..5995) [1701 bp, 566 aa] {ON} (4295..5995)
           [1701 nt, 567 aa]
          Length = 566

 Score =  132 bits (331), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 126/452 (27%), Positives = 206/452 (45%), Gaps = 58/452 (12%)

Query: 97  LTPEDYSVFVNQLMDVYSKDIEL-------LNKTEVWKSLYHIYRVFV--VNAVDDGNAM 147
           LT  + S+F+N++      DI+        L+ TE+   ++ +Y   +   + +   NA+
Sbjct: 120 LTYNELSIFINRIYKSNGHDIKRVIQNHHSLSYTELIYEIFELYTSTIPKESGIIKLNAL 179

Query: 148 VLYDLNQFVRMFINLNDLPLARNVFQLILKNSKNGEIPKDVQTICMYLRLYCGALSELW- 206
            L DLN F+ +FI    L  A+NV Q I+    + E   D  T+  +LRL CG L + W 
Sbjct: 180 HLKDLNLFITIFIKEAQLSKAQNVLQYIIDAEGSIEKITDHDTMVNFLRLRCGGLPKFWL 239

Query: 207 --------TTQTSRNFYQDLIGSLSGSNASSIRIPSHIAYPTIGVPQFQ---LLLRKLVE 255
                   T QT +N       S   SN+ + R PS           F+   ++L K V 
Sbjct: 240 VPQASYAVTKQTKKN-------SRLSSNSPNTRFPSSYKSTVPNTVLFEVINMILNKKVW 292

Query: 256 DPEYSKLRNTEMDSLIIQALGHYKEVPFLKQYISIFYGIDENVTITETHPGIKKLT--PD 313
             ++S +    +DS I+ +L H  +   +  +I   +GI  +    +     KK+   P 
Sbjct: 293 KSKHSGI----LDSTIVYSLAHTFQKQMMDGFIKEHWGISSHGDPLDLFIKKKKVASAPS 348

Query: 314 SQLLKSVISAYGH-NNNITSGMTVIGSFMEKYPEMNLDKSFWRTTIYWSLREWNKYKDSK 372
           +++L +++S+Y + + NI   M ++  F+  YP+++LD  FWR  I W  R W+   D +
Sbjct: 349 NEILIAIMSSYIYKDRNIDGAMKILDKFIRMYPDISLDNMFWRRLIQWCNRLWDPKIDRQ 408

Query: 373 GSQPKKAWNLMLNW-YATIGKAV--PFDQKIM--LYRLSFLKSRKDHNAAIRDVQQVFKR 427
           G+     WN+M NW  A  GK V  P+D +I    YRL     ++ +N  I    ++   
Sbjct: 409 GTFGYGCWNMMKNWNGAGTGKDVVLPYDFQIYEEFYRL----FKRTNNGKI--AAEIVSN 462

Query: 428 IFIK--TEKNTFI--VERLVLYAYQRFIIKNLVNQNENAKCVDFINEWRIDFENGRYLER 483
           + I   +EKN  +   E  +L  YQ   +  L+ + +  K   FI EW ID  N   L  
Sbjct: 463 VLIPHLSEKNVAVKKAELNLLNKYQTLAMNWLIERRQFKKAAFFIEEWSIDRNNRIQLRE 522

Query: 484 YFK--------ELTHPKNESDEQKKLNDEDDD 507
            FK        +L+    +S  QKK  D  D+
Sbjct: 523 AFKKRKQLMLRKLSTRDKKSQSQKKRQDRYDE 554

>Suva_13.471 Chr13 complement(816054..817799) [1746 bp, 581 aa] {ON}
           YMR282C (REAL)
          Length = 581

 Score =  126 bits (316), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 118/412 (28%), Positives = 200/412 (48%), Gaps = 47/412 (11%)

Query: 93  SNEKLTPEDYSVFVNQLMDVYSKDIEL--------LNKTEVWKSLYHIYRVFV---VNAV 141
           + E L+ ED S  +N L   YS+  E+        +  +E W  L+ +Y   V    N +
Sbjct: 133 ARETLSLEDLSFLLNNL---YSQRFEIKKICKDINVRYSEFWFKLFSLYAEKVDVKRNQI 189

Query: 142 DDGNAMV----LYDLNQFVRMFINLNDLPLARNVFQLILKNSKNGEI---PK--DVQTIC 192
           +  N  +    ++D+N  ++ FI L  L  A+ V   IL   +N +I   PK  D+ TI 
Sbjct: 190 NLRNTALDSSEIFDMNLIIKNFIELGQLGKAQKVLSFIL--DRNSDILLSPKNADIGTII 247

Query: 193 MYLRLYCGALSELWTT-QTSRNFYQDLIGSLSGSNASSIRIPSHIAYPTIGVPQFQLLLR 251
            +L+L CGAL+  W     S   Y   +  L G+  +SIRI S  +Y  +   Q  L + 
Sbjct: 248 HFLQLRCGALAAYWKMPDNSEQKYSRKMVRL-GAKNTSIRITS--SYKAMD-HQTLLKIA 303

Query: 252 KLVEDPEYSKLRNTE-MDSLIIQALGHYKEVPFLKQYISIFYGID--ENVTITETHPGIK 308
            LV   E  +L N+E + S +IQ+ GH  +   L++ I   + I   E  +     P  +
Sbjct: 304 DLVLQKE--RLLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQISLQEFPSHATIKPKTR 361

Query: 309 KLTPDSQLLKSVISAYGHNNN-ITSGMTVIGSFMEKYPEMNLDKSFWRTTIYWSLREWNK 367
              P S++L S++ ++  N+N +  G++++ SF++ YPE+ +D+ FWR     S   W  
Sbjct: 362 GCCPSSKILISILVSFHLNDNDLHRGLSILDSFIKHYPEVKVDELFWRRLFQLSHFAWTP 421

Query: 368 YKDSKGSQPKKAWNLMLNWYATIGKAVPFDQKIMLYRLSFLKSRKDHNAAIRDVQQVFK- 426
             D + +   + W+LM  W+ + G ++  D + +       K   +++  I DV Q FK 
Sbjct: 422 THDKRATSIVRCWHLMKQWHESKGFSLSVDYETLRQLYDLTKKTGNYSLGI-DVLQNFKP 480

Query: 427 ----RIFIKTEKNTFIVERLVLYAYQRFIIKNLVNQNENAKCVDFINEWRID 474
                  +KTEK   IV +     +Q++IIK LVN+ + +   +FIN++  D
Sbjct: 481 GITRTSAMKTEKINGIVIK-----HQKYIIKQLVNRGKTSAAREFINDFSFD 527

>Smik_13.495 Chr13 complement(816375..818105) [1731 bp, 576 aa] {ON}
           YMR282C (REAL)
          Length = 576

 Score =  120 bits (301), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 104/391 (26%), Positives = 185/391 (47%), Gaps = 42/391 (10%)

Query: 145 NAMVLYDLNQFVRMFINLNDLPLARNVFQLILKNSKNGEI-----PKDVQTICMYLRLYC 199
           +A  ++D+N  +R FI L  L  A+ +   I+   +N +I       D+ T+  +L+L C
Sbjct: 192 DACEIFDINLLIRNFIELGQLGKAQKILTFII--DRNPDILLSPNNADIGTMVHFLKLRC 249

Query: 200 GALSELWTTQTSRNFYQDLIGSLS--GSNASSIRIPSHIAYPTIGVPQFQLLLRKLVED- 256
           GAL+  W    +    Q  +  +   G+  +SIR+ S     T  V   Q LL+  + D 
Sbjct: 250 GALAAYWKIPDNSGQDQKQLRKIVRLGAKNTSIRLSS-----TYKVMDHQTLLK--IADL 302

Query: 257 --PEYSKLRNTEMDSLIIQALGHYKEVPFLKQYISIFYGIDENVTITE--THPGIK--KL 310
              E   L + ++ S +IQ+ GH  +   L++ I   +    ++T  E  +H  IK    
Sbjct: 303 VLHEKRFLNSEDLLSTLIQSFGHLGQTQILERCIEHIW----HITTQEFPSHVAIKPRGC 358

Query: 311 TPDSQLLKSVISAYGHNNN-ITSGMTVIGSFMEKYPEMNLDKSFWRTTIYWSLREWNKYK 369
            P S++L S++ ++ +N+N +  G++++ SF++ YPE+ LD  FWR     S   W   K
Sbjct: 359 YPSSKILISILVSFHYNDNDLHRGLSILDSFIKHYPEVKLDALFWRRLFQLSNFAWTPAK 418

Query: 370 DSKGSQPKKAWNLMLNWYATIGKAVPFDQKIMLYRLSFLKSRKDHNAAIRDVQQVFKRIF 429
           D K +   + W+LM  W+ + G ++  D + +      +K   +    I DV + FK   
Sbjct: 419 DKKATSVIRCWHLMKQWHVSKGLSLSVDYETLRQLYDIMKKTGNFPLGI-DVLKSFKSGI 477

Query: 430 IKTEKNTFIVERLVLYAYQRFIIKNLVNQNENAKCVDFINEWRID---------FENGRY 480
            +  +       +VL  YQ++IIK LV++   +   +FIN++  D         F   R 
Sbjct: 478 ERLRETNSDKLNIVLIKYQKYIIKQLVDRGRISAVREFINDFGFDRTITKNLNIFCTNRL 537

Query: 481 LERYFKELTHPKNESDEQK----KLNDEDDD 507
           L R  K  +  +N+ +  K      +D++DD
Sbjct: 538 LLRSKKNKSKIENKKERNKLEPSGFDDDEDD 568

>TPHA0I00290 Chr9 complement(55148..56857) [1710 bp, 569 aa] {ON}
           Anc_8.847 YMR282C
          Length = 569

 Score =  114 bits (285), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 101/445 (22%), Positives = 212/445 (47%), Gaps = 35/445 (7%)

Query: 94  NEKLTPEDYSVFVNQLMDV--YSKDIELLNKTEVWKSLYHIYRVFVV--NAV--DDGNAM 147
           +++LT  ++S+F+N+L+D   +  D  +L +    K    ++++F +  NA+  D  + +
Sbjct: 120 SKQLTFNEFSIFLNRLIDRKGFIYDSIVLKEFPNGKHSEMVFKLFQLYGNAIGSDKLSLL 179

Query: 148 VLYDLNQFVRMFINLNDLPLARNVFQLILKNSKNGEIPKDVQTICMYLRLYCGALSELWT 207
            L D+N F+  FIN   L  A  V   +L  +++     DV T+  YL+L CGAL   W 
Sbjct: 180 SLRDMNLFIEFFINEGHLGRAEIVLTFVLNKTRSILDLYDVDTVTHYLQLRCGALPRYWM 239

Query: 208 TQ--TSRNFYQDLIGS--------LSGSNASSIRIPSHIAYPTIGVPQFQLLLRKLVEDP 257
            Q  ++   Y+D  G+        L   N +      +     +GV +   +  K++ D 
Sbjct: 240 FQNKSAELAYKDKFGNRLSKYKTRLGRKNFAVKLTNRYKILDPLGVLK---IANKIITDD 296

Query: 258 EYSKLRNTEMDSLIIQALGHYKEVPFLKQYISIFYGIDENVTITETHPGIK------KLT 311
           ++    + ++D+ ++ +L +  ++  +  YI+  + +D +++   +  G +      K  
Sbjct: 297 KWKSNHSAKLDATVVYSLCYSGQLSNIPSYINSRWNVDISMSDGNSDVGTQISNEASKPL 356

Query: 312 PDSQLLKSVISAYGHNN-NITSGMTVIGSFMEKYPEMNLDKSFWRTTIYWSLREWNKYKD 370
           P S+++++++S+Y +++ +I   + +I   M  YP + L++ FWR  + WS+  W+   D
Sbjct: 357 P-SEVMEAILSSYSYDDKSIERAINIIDKIMNSYPNLELNQQFWRRLMQWSVLCWDHKLD 415

Query: 371 SKGSQPKKAWNLMLNWYATIGKAVPFDQKIMLYRLSFLKSRKDHNAAIRDVQQVFKRIFI 430
            KGS     +  +  ++      + FD+ ++    + +   K+   A   V +   + F 
Sbjct: 416 RKGSLVYGCFKTLKKYHEMRSIRINFDEGLLQELYTLVYYTKNSRIAAEVVSEFMPQFFY 475

Query: 431 KTEKNTFIVERLVLYAYQRFIIKNLVNQNENAKCVDFINEWRIDFENGRYLERYFKE--- 487
           K        ER +L+ +Q+  I  ++ + +     +FI +W +D +N   L +Y+K+   
Sbjct: 476 KRSDEITFGERKLLFYFQKRSIDGMLGKKDYFTASNFIEKWSMDNQNKEELFKYYKDSIA 535

Query: 488 --LTHPKNESDEQK---KLNDEDDD 507
             L   +  S +QK   KL D  D+
Sbjct: 536 KKLQKVRRNSLQQKIKEKLEDHSDE 560

>Skud_13.454 Chr13 complement(806601..808343) [1743 bp, 580 aa] {ON}
           YMR282C (REAL)
          Length = 580

 Score =  113 bits (282), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 104/415 (25%), Positives = 189/415 (45%), Gaps = 40/415 (9%)

Query: 123 TEVWKSLYHIYRVFVVNAVDDGN-------AMVLYDLNQFVRMFINLNDLPLARNVFQLI 175
           +E W  L+ +Y   V    D  N       +  ++DLN  ++ FI L  L  A+ +   I
Sbjct: 167 SEFWFKLFSLYAEKVDTRRDQVNLRNTALDSCEIFDLNLLIKNFIELGQLSKAQKILSFI 226

Query: 176 LKNSKNGEI---PK--DVQTICMYLRLYCGALSELWTTQTSRNFYQDLIGSLS--GSNAS 228
           L   +N +I   P+  D+ TI  +L+L CGAL+  W    +    Q+ +  +   G+  +
Sbjct: 227 L--DRNPDILLSPRNADIGTIVHFLQLRCGALTAYWKIPDNSGRKQNQLRRMVRLGAKNT 284

Query: 229 SIRIPSHIAYPTIGVPQFQLLLRKLVEDPEYSKLRNTEMDSLIIQALGHYKEVPFLKQYI 288
           SIR+ S   Y  +       +   +++D  +  L + ++ S +IQ+ GH  +   L++ I
Sbjct: 285 SIRLSS--TYKAMDHQTLLKIADLVLQDKRF--LNSEDLLSTLIQSFGHLGQTQILERCI 340

Query: 289 SIFYGIDENVTITETHPGIKKLTPDSQLLKSVISAYGHNN-NITSGMTVIGSFMEKYPEM 347
              + I      +      +   P S++L S++ ++  N+ ++  G++++ SF++ YPE+
Sbjct: 341 EHIWQISSQEFPSHVAIKPRGCYPSSKILISILVSFHLNDKDLHRGLSILDSFIKHYPEV 400

Query: 348 NLDKSFWRTTIYWSLREWNKYKDSKGSQPKKAWNLMLNWYAT--IGKAVPFDQKIMLYRL 405
            LD  FWR  +  S   W    D + +   K W+LM +WY +  +  +V ++    LY +
Sbjct: 401 KLDALFWRRLLQLSHFAWTPVNDKRAASIVKCWHLMKHWYESKELSPSVDYETLRQLYEV 460

Query: 406 SFLKSRKDHNAAIRDVQQVFKRIFIKTEKNTFIVERLVLYAYQRFIIKNLVNQNENAKCV 465
             +K   + +  I DV + FK    K           +L  YQ+ IIK LVN+ + +   
Sbjct: 461 --MKKTGNFSLGI-DVLKSFKSGIEKMRTANPEKLEAILIKYQKCIIKQLVNRGKISAAR 517

Query: 466 DFINEWRIDFENGRYL-----ERYFKELTHPKNESDEQKKL---------NDEDD 506
            FI ++  +    + L      R F      KN+ + +KK          +DEDD
Sbjct: 518 KFIGDFGFNRRAAKDLNIFCSNRIFSRSKKIKNDIENKKKRDGLAPGNYDDDEDD 572

>ABL119C Chr2 complement(175840..177453) [1614 bp, 537 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR282C
           (AEP2)
          Length = 537

 Score =  112 bits (281), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 98/400 (24%), Positives = 177/400 (44%), Gaps = 42/400 (10%)

Query: 100 EDYSVFVNQLMDVY--SKDIELL----NKTEVWKSLYHIYR-VFVVNAVDDGNAMVLYDL 152
           E +SVF+++L+  Y  S D++ L        + + LY  YR  F    +   +   L+D 
Sbjct: 131 EGFSVFIHRLLPTYTPSSDLKHLVSKDGTIALLQKLYGFYREQFADAPIGRPSPGRLHDA 190

Query: 153 NQFVRMFINLNDLPLARNVFQLILKNSKN-GEIPKDVQTICMYLRLYCGALSELWTTQTS 211
           N F R F+  + L LAR VF  ++ N     ++P+D +TI   L+L+ GA    W    +
Sbjct: 191 NSFARWFMAESKLRLARTVFAELVGNPTELAKLPRDTETIITLLQLHLGAKHIFWRDPGN 250

Query: 212 RNFYQDLIGSLSGSNASSIRIPSHIA----YPTIGVPQFQLLLRKLVEDPEYSKLRNTEM 267
                      S      +  P+H+A    Y ++G      LLR L  DP++  + + ++
Sbjct: 251 -----------SVGRGGQLFTPAHMAVVTAYNSLGEETLLRLLRLLQSDPQWKSVCSPDL 299

Query: 268 DSLIIQALGHYKEVPFLKQYISIFYGIDENVTITETHPGIKKLTPDSQLLKSVISAYGHN 327
           D  II AL  +  +  +    + +Y          + P    L PD  L+ +V++A+   
Sbjct: 300 DRNIILALAFHNRLDLVHAQAARYYAPAAPGHGLPSTP----LLPDGALVGAVVTAFAFK 355

Query: 328 NNITSGMTVIGSFMEKYPEMNLDKSFWRTTIYWSLREWNKYKDSKGSQPK----KAWNLM 383
           + +  G+ +   F++++  +  +   W+    W  R     +   GSQ      +AW+ M
Sbjct: 356 HQLAQGLAIAYQFLDRFTHLPNEHELWKIIFTWLAR-----RHPTGSQGAALYDEAWSKM 410

Query: 384 LNWYATIGKAVPFDQKIMLYRLSFLKSRKDHNAAIRDVQQVFKRIFIKTEKNTFIV--ER 441
              YA  G+  P+D  I   R S+   R+D  +++R V+ +         +   +   +R
Sbjct: 411 RTRYAEHGQPTPYDYSIA--RASYRIVRRD--SSLRRVRALLNDYMSPLYQQPAVAPRDR 466

Query: 442 LVLYAYQRFIIKNLVNQNENAKCVDFINEWRIDFENGRYL 481
           L+L   Q  I+  LV    N+   DF+++W +D E   +L
Sbjct: 467 LLLLKCQAHIVGRLVRARRNSAAADFVDQWALDSEARSHL 506

>YMR282C Chr13 complement(833356..835098) [1743 bp, 580 aa] {ON}
           AEP2Mitochondrial protein, likely involved in
           translation of the mitochondrial OLI1 mRNA; exhibits
           genetic interaction with the OLI1 mRNA 5'-untranslated
           leader
          Length = 580

 Score =  111 bits (277), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 99/368 (26%), Positives = 168/368 (45%), Gaps = 24/368 (6%)

Query: 123 TEVWKSLYHIYRVFV---VNAVDDGN----AMVLYDLNQFVRMFINLNDLPLARNVFQLI 175
           +E W  L+ +Y   V    N V+  N    A  ++D N  ++ FI L  L  A+ +   I
Sbjct: 167 SEFWFKLFSLYAEKVDAKRNQVNLRNTKLDACEIFDANLMIKNFIELGQLGKAQKILSFI 226

Query: 176 LKNSKNGEI---PK--DVQTICMYLRLYCGALSELWTTQTSRNFYQDLIGSLS--GSNAS 228
           L   +N +I   PK  D+ TI  +L+L CGAL+  W    +    Q  +  +   G+  +
Sbjct: 227 L--DRNPDILLSPKNADISTIVHFLQLRCGALAPYWKIPDNSEQKQGFLRKMVRLGAKNT 284

Query: 229 SIRIPSHIAYPTIGVPQFQLLLRKLVEDPEYSKLRNTE-MDSLIIQALGHYKEVPFLKQY 287
           SIR+ S     T      Q LL+      +  KL N+E + S +IQ+ GH  +   L++ 
Sbjct: 285 SIRLSS-----TYKAMDHQTLLKIADLALQEKKLLNSEDLLSTLIQSFGHLGQTQILERC 339

Query: 288 ISIFYGIDENVTITETHPGIKKLTPDSQLLKSV-ISAYGHNNNITSGMTVIGSFMEKYPE 346
           I   + I      +      +   P S++L S+ +S Y +++++  G++++ SF++ YP+
Sbjct: 340 IEHIWQISPQEFPSHVVIKHRGCYPSSKILVSILVSFYFNDHDLHRGLSILDSFIKHYPD 399

Query: 347 MNLDKSFWRTTIYWSLREWNKYKDSKGSQPKKAWNLMLNWYATIGKAVPFDQKIMLYRLS 406
           + LD  FWR     S   W    D K +   + W+LM  WYA+       D + +     
Sbjct: 400 VKLDALFWRRLFQLSHFAWTPANDKKATSVVRCWHLMKQWYASKRLRPSVDYETLRQLYD 459

Query: 407 FLKSRKDHNAAIRDVQQVFKRIFIKTEKNTFIVERLVLYAYQRFIIKNLVNQNENAKCVD 466
            +K   +    I DV + FK    +T          ++  YQ+ IIK LVN+   +   +
Sbjct: 460 IMKKTGNFPLGI-DVLRSFKPGIERTRAENAGKVNNIIIKYQKCIIKELVNRGRFSAVRE 518

Query: 467 FINEWRID 474
           FI+ +  D
Sbjct: 519 FIDSYGFD 526

>TBLA0B03310 Chr2 complement(772555..774396) [1842 bp, 613 aa] {ON}
           Anc_8.847 YMR282C
          Length = 613

 Score =  100 bits (248), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 94/365 (25%), Positives = 164/365 (44%), Gaps = 38/365 (10%)

Query: 145 NAMVLYDLNQFVRMFINLNDLPLARNVFQLILK--NSKNGEIPKDVQTICMYLRLYCGAL 202
           N + LYDLN+ +  FI    L  A      ILK  N++  +IP D +TI  +L+LYCG L
Sbjct: 222 NPIQLYDLNKVITWFIKAGQLKKATTALMYILKRYNAEIFQIP-DSKTIINFLKLYCGGL 280

Query: 203 SELWTTQTSRNFYQDLIGSLS---GSNASSIRIPSHIAYPTIGVP-QFQLLLRKLVEDPE 258
              W  +   + +    G  S   G+N+S  R+PS        VP Q    ++K   D +
Sbjct: 281 PTNWRIEPINHRFIKNQGKRSFKLGNNSSYYRLPSSYKAVYEKVPIQIVEHIKKNTNDMK 340

Query: 259 YSK-----LRNTEMDSLIIQALGHYKEVPFLKQYISIFYGID--ENVTITETHPGIKKLT 311
            S      +R  E DS +I +L         +QY    +  D  ++V +T          
Sbjct: 341 LSGKLFHFIRTGEFDSTLIYSLTSLGRFDLAEQYFKDNWLSDSCDDVELT---------- 390

Query: 312 PDSQLLKSVISAYGHNN--NITSGMTVIGSFMEKYPEMNLDKSFWRTTIYWSLREWNKYK 369
             S ++ ++ S+Y +NN  NI     +I   +++YP+++L+ S W   I W+++ W+   
Sbjct: 391 --SDIVIAIFSSYVYNNSNNIEKANKLIQEIIKRYPDLHLNISTWCRIIRWNIQMWDTTT 448

Query: 370 DSKGSQPKKAWNLMLNWYATIGK--------AVPFDQKIMLYRLSFLKSRKDHNAAIRDV 421
           D  G  P  ++  ML +Y+             +P+++ ++        ++   N  +  +
Sbjct: 449 DFNGEIPYDSFYTMLTYYSNYCSRNSTFKSCHIPYNKMLLGDLYHLFNTKISLNKCLFIM 508

Query: 422 QQVFKRIFIKTEKNTFIVERLVLYAYQRFIIKNLVNQNE--NAKCVDFINEWRIDFENGR 479
              FK+   KT       +  +L  YQ+ I+K L+N  +  + K +DFI ++ +D  N  
Sbjct: 509 DNCFKKSLFKTPSKVTTKDYQILLKYQKMILKYLINDRKLTSNKPLDFIEKYSLDTNNKE 568

Query: 480 YLERY 484
            L  Y
Sbjct: 569 QLLEY 573

>KAFR0B03970 Chr2 complement(830202..831626) [1425 bp, 474 aa] {ON}
           Anc_8.847 YMR282C
          Length = 474

 Score = 93.6 bits (231), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 92/389 (23%), Positives = 168/389 (43%), Gaps = 50/389 (12%)

Query: 122 KTEVWKSLYHIYRVFVVNAVDDGNAMVLYDLNQFVRMFINLNDLPLARNVFQ-LILKNSK 180
           + E+   L+  Y V ++++ ++   + + D+N+F+  F+    L  A+ V + LILK+ +
Sbjct: 112 RPEIIFQLFETY-VKLISSHEELTILQVEDMNKFINYFVEFKQLKKAQLVMKYLILKSPR 170

Query: 181 NGEIPKDVQTICMYLRLYCGALSELWTTQTSRNFYQDLIGSLSGSNASSIRIPSHIAYPT 240
             E   DV T   YL+L CGA  ELW T                +N +  ++  +     
Sbjct: 171 VLE-KYDVSTTRNYLKLNCGACHELWYTNYK---------IFDFNNTTLDKLVKYSLDNK 220

Query: 241 IGVPQFQLLLRKLVEDPEYSKLRNTEMDSLIIQALGHYKEVPFLKQYISIFYGID--ENV 298
           IG                         D  II +LG+   +  L+ YI   +GI   +  
Sbjct: 221 IGY-----------------------WDVEIIHSLGYSGRIRSLEDYILKKWGISLCDRA 257

Query: 299 TITETHPGIKKLTPDSQLLKSVISAYGHNN-NITSGMTVIGSFMEKYPEMNLDKSFWRTT 357
            +  T+       P+S++L+++I+ + + +  +   + ++  F+  YP++NL  +FW+T 
Sbjct: 258 QVNTTNEA-----PESEVLEAIINGFFYRDKRMFRAIKILNEFVNVYPDLNLKITFWKTF 312

Query: 358 IYWSLREWNKYKDSKGSQPKKAWNLMLNWYATIGKAVPFDQKIMLYRLSFLKSRKDHNAA 417
           +   ++EW++  D KG    + W  M  WY    + +PF+   +    +  K   +   A
Sbjct: 313 MNNCIKEWDEKVDQKGVVIVEYWETMKRWYTVHNRRIPFNINFLKVMRTCFKKNNNLVLA 372

Query: 418 IRDVQQVFKRI-FIKTEKNTFIVERLVLYAYQRFIIKNLVNQNENAKCVDFINEWRIDFE 476
               Q  F    F  T  N    E  V+  YQ FI+  L+ +   +  + FIN+     E
Sbjct: 373 TDIFQNCFHNFYFCATRMND--SELNVIKEYQNFILSRLIEKKGFSNALTFINDHCFSLE 430

Query: 477 NGRYLERYFKELTHPKNESDEQKKLNDED 505
           N R L  Y+    H + E   +K   +E+
Sbjct: 431 NKRQLMNYY----HGRKEHKLKKMTRNEN 455

>KNAG0J00230 Chr10 (30660..32084) [1425 bp, 474 aa] {ON} Anc_8.847
           YMR282C
          Length = 474

 Score = 92.4 bits (228), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 92/414 (22%), Positives = 178/414 (42%), Gaps = 53/414 (12%)

Query: 98  TPEDYSVFVNQLMDVYSKDIELLNKTEVWKSLYHIYRVFVVNAVDDGNAMV---LYDLNQ 154
           T   +SV +N+++   S++   L+  E  +  + I+  +        N +    L+D N 
Sbjct: 86  TAMQFSVLLNRVLA--SQNYRHLDSKENVEKFFAIFMRYKGAIALQSNKLTQIQLHDFNL 143

Query: 155 FVRMFINLNDLPLARNVFQLILKNSKNGEIPKDVQTICMYLRLYCGALSELWTTQTSRNF 214
               FI  N L  A+ +   +L+     ++  DV  I  Y +L CG+             
Sbjct: 144 MCDYFIACNQLKKAQLIMDFLLQQ----DVKFDVFMIKNYTKLRCGSS------------ 187

Query: 215 YQDLIGSLSGSNASSIRIPSHIAYPTIGVPQFQLLLRKLVEDPEYSKLRNTEMDSLIIQA 274
                G  + +N +      +  +  IG         K+  D +++   N      I+ +
Sbjct: 188 ----FGKQTLNNKAYKVFDQNTVFQLIG---------KVEADRKFAFWNNE-----IVSS 229

Query: 275 LGHYKEVPFLKQYI------SIFYGIDENVTITETHPGIKKLTPDSQLLKSVISAYG-HN 327
           LG+   +  ++ YI      SI     EN+ I     G   + P S++L +++S+Y  H+
Sbjct: 230 LGYTNNITLMEIYIWDLWRISIHDHSTENIKIDHLQQG-DAMYPSSKVLATIVSSYARHD 288

Query: 328 NNITSGMTVIGSFMEKYPEMNLDKSFWRTTIYWSLREWNKYKDSKG-SQPKKAWNLMLNW 386
             +   + ++  F + YP++ L+  FW T +  ++    K   SK  SQ    WNLM  W
Sbjct: 289 QTMKRAVDIVERFAKSYPKLLLNVHFWSTLLNCAI----KCGGSKDPSQFLACWNLMKKW 344

Query: 387 YATIGKAVPFDQKIMLYRLSFLKSRKDHNAAIRDVQQVFKRIFIKTEKNTFIVERLVLYA 446
           +    K +PF   +++  L +++   + +  +  +Q     +++K   N    ER VL  
Sbjct: 345 HTQRSKLMPFQSALLVTILRYMRQTSNLHGTVDILQYWLGPLYLK-RGNIPEFERDVLIK 403

Query: 447 YQRFIIKNLVNQNENAKCVDFINEWRIDFENGRYLERYFKELTHPKNESDEQKK 500
           YQ+ I++ LV++ +   C  FI++W ID  N   LE +++     +     ++K
Sbjct: 404 YQKQILRKLVDKRKYNWCTAFIDQWSIDASNKEDLEAFYESRVDVRESKTRREK 457

>NCAS0C00370 Chr3 (54433..55920) [1488 bp, 495 aa] {ON} Anc_8.847
           YMR282C
          Length = 495

 Score = 88.6 bits (218), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 101/407 (24%), Positives = 187/407 (45%), Gaps = 61/407 (14%)

Query: 94  NEKLTPEDYSVFVNQLMDVYSKDIELLNKTEVWKSLYHIYRVFVVNAVDDG--NAMVLYD 151
           +E  T E+YS+F+ +++ +   D+ +         ++ ++ ++      +G  NA+ +YD
Sbjct: 97  HEHFTLEEYSLFLGKVLSMKDSDVNV-------NVVFQLFEIYARMYCGEGSLNALQIYD 149

Query: 152 LNQFVRMFINLNDLPLARNVFQLILKNSKNGEIP-----KDVQTICMYLRLYCGALSELW 206
           LN+ ++ FI  + L   + V   I+   K G I      +D+ ++  +L+L  G+L + W
Sbjct: 150 LNKLIKYFIKRDQLKQGQIVLDFII--MKYGGIENMIAHRDLISLNNHLKLKNGSLVKDW 207

Query: 207 TTQTSR-NFYQDLIGSLSGSNASSIRIPSHIAYPTIGVPQFQLLLRKLVEDPEYSKLRNT 265
             +     + Q   G L+              Y  +       +   ++ DP   K +N 
Sbjct: 208 KFEGKNLRYLQSRQGRLN--------------YKFLDGWSLLKIADLVLNDP--MKCQNV 251

Query: 266 EMDSLIIQALGHYKEVPFLKQYISIFYGIDENVTITETHPGIKKLTPDSQLLKSVISAYG 325
             +S II +LGH ++V  L  +I       + + + ET P    L PD+  + ++I++Y 
Sbjct: 252 LTNS-IIYSLGHLRQVELLDHFI-------DQMWMQETRPRNGLLYPDTNNIIAIITSYC 303

Query: 326 HN-NNITSGMTVIGSFMEKYPEMNLDKSFWRTTIYWS-LREWNKYKDSKGSQPKKAWNLM 383
           +N  N+     V+   +EKY  +  DK FWR    W  L E N    +KG    + W+LM
Sbjct: 304 YNYGNMDKSFDVLDRILEKYSGLKFDKFFWRRLFQWCILTEPNA---NKGFILGQCWSLM 360

Query: 384 LNWYATIGKAVPFDQKIM-LYRLSFLKSRKDHNAAIRDVQQVFKRIFIKTEKNTFI--VE 440
                   + V FD  ++ L R   +K R D   A+R    V K I I+ +K  FI  ++
Sbjct: 361 -----EKQEKVEFDGVLLELLREKIVKVR-DVPLALR----VLKMIVIELKKVNFINELD 410

Query: 441 RLVLYAYQRFIIKNLVNQNENAKCVDFI--NEWRIDFENGRYLERYF 485
             +L  YQ+F+   L   N+  K ++ +  +++ I+ EN  ++  Y+
Sbjct: 411 MELLLKYQKFVFSKLGEINKTVKAMELLSCDDYTINKENKAFMRAYY 457

>CAGL0M03069g Chr13 complement(347584..349230) [1647 bp, 548 aa]
           {ON} weakly similar to uniprot|P22136 Saccharomyces
           cerevisiae YMR282c AEP2 required for the expression of
           subunit-9 of atp synthase
          Length = 548

 Score = 73.9 bits (180), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 93/389 (23%), Positives = 166/389 (42%), Gaps = 57/389 (14%)

Query: 151 DLNQFVRMFINLNDLPLARNVFQLILKNSKN-GEIP----KDVQTICMYLRLYCGALSEL 205
           D+N+F++ FI  + L  A+   Q +L   K  GE       D QTI  +L L  GAL +L
Sbjct: 169 DMNKFIKRFIEGSQLKRAQTALQFLLDGYKERGEDLLGPYGDKQTIAHFLMLRSGALQDL 228

Query: 206 WTTQTS------RNFYQDLIGSLSGSNASSIRIPSHIAYPTI-GVPQFQLLLRKLVEDPE 258
           W    S      + FY+         N S   + S   Y  +  V  F+++   L  + +
Sbjct: 229 WKIDVSNGNNKKQAFYK--------INGSHRNVKS--TYNVLDSVKLFEIVRYILRYNDK 278

Query: 259 YSKLRNTEMDSLIIQ----ALGHYKEVPFLKQYISIFYGIDENVTITETHPGIKKLTPDS 314
            +  +    D  I++     LG+  +   ++  I+  + +D +V++    P    +T  S
Sbjct: 279 DNHSQPVYFDEGILKNVILCLGYVGQTTLIEDIINKIWELD-SVSV----PPKYNITVTS 333

Query: 315 QLLKSVISAYGH-NNNITSGMTVIGSFMEKYPEMNLDKSFWRTTIYWSLREWNKYKDSKG 373
            LL +++SAY     +I  G+ +   F  K P + +   FW     W++   NK++ S  
Sbjct: 334 DLLTAIVSAYSKCGKSIQPGLVIADKFFGKIPNIIVKDDFWINLQKWNIILPNKWR-STI 392

Query: 374 SQPKKAWNLMLNWYATIGKAVPFDQKIMLYRLSFLKSRKDHNAAIRDVQQVFKRIFIKT- 432
              K+ W LM +W  +          +    L +     D+   ++D++ ++  IF  + 
Sbjct: 393 DLSKRTWELMKSWRNSTNNGGFITANVEFLNLVYKVLSSDY-IKLKDLEWIYD-IFQHSL 450

Query: 433 ----EKNTFIVERL-VLYAYQRFIIKNLVNQNENAKCVDFINEWRIDFENGRYLERYF-- 485
                KN+  V+ + +L  +Q F IK +V     +KC+ FI EW  D  N + L   F  
Sbjct: 451 VTLYSKNSLTVDEIKLLKKFQIFTIKKMVYFGHYSKCLQFIKEWSYDAANKQQLTNLFVV 510

Query: 486 --------------KELTHPKNESDEQKK 500
                         KE+T  + + DE+++
Sbjct: 511 LRNRYLQKRGYNQEKEMTKVQKKYDEEEQ 539

>NDAI0K00340 Chr11 complement(64928..66802) [1875 bp, 624 aa] {ON}
           Anc_8.847 YMR282C
          Length = 624

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 104/482 (21%), Positives = 206/482 (42%), Gaps = 80/482 (16%)

Query: 51  NIVTPNKPNTNLLTSKQPIKALKHLQWKTNLRVKKTTRLLKYSNEKLTP----EDYSVFV 106
           +++   K N  +LT+      L H  +  N +   TTR L   N  LT     E+ S+F+
Sbjct: 111 HLLLAQKDNGKVLTT-----ILDHCLYSPNEQA--TTRQLVKENNHLTTLLSHEEMSIFI 163

Query: 107 NQLMD-----VYSKDIELLN--------KTEVWKSLYHIYRVFVVNAVDDGNAMVLYDLN 153
            +++      +  K  E+L         K EV  SL++I +    N  +  N +++YDLN
Sbjct: 164 CRVLKNFPTIISEKKYEILTNEGRYELYKPEVIFSLFNICKDEYCNNTNQLNPLMVYDLN 223

Query: 154 QFVRMFINLNDLPLARNVFQLILKNSKNGEI-----PKDVQTICMYLRLYCGALSELW-- 206
           QF++ F+    L  A+ V   I+   + G I      KD+ T+  +L+L  GA+ + W  
Sbjct: 224 QFIKYFLREGQLKKAQLVLDYII--DRFGGIEQLIKSKDLTTLDNHLKLKNGAIYKNWKP 281

Query: 207 -TTQTSRNFYQDLIGSLSGSNASSIRIPSHIAYPTIGVPQFQLL----LRKLVEDPEYSK 261
            T   S  F Q  +         S+   SH      G   ++ L    L K+++     K
Sbjct: 282 LTDSESNTFLQYRL---------SLEDKSH---NFKGFKNYKFLDGWSLLKIIDMVLTDK 329

Query: 262 LRNTE-MDSLIIQALGHYKEVPFLKQYISIFYGIDENVTITETHPGIKK--LTPDSQLLK 318
                 ++  I+ +LG  +++ F++ +I   + +  +  + E +  + K  L PD+  L 
Sbjct: 330 THCLNILNESILYSLGTLRQIEFMEHFIKQIWDVHPDDAVEERNHQLDKYNLPPDTNELI 389

Query: 319 SVISAYGHN-NNITSGMTVIGSFMEKYPE-----MNLDKSFWRTTIYWSLREWNKYKDS- 371
           +++++Y     ++     ++   ++KYPE     +N D  FW   + W ++  +K  ++ 
Sbjct: 390 AILTSYCQTYKSMDRAFLLLDKLIQKYPEPMKSRLN-DNKFWIKMLQWGIKIADKNGNNV 448

Query: 372 KGSQPKKAWNLMLNWYATIGKAVPFDQ--------KIMLYRL-SFLKSRKDHNAAIRDVQ 422
            G+       +M  W+    K    +          I++  L + +K RK+ +  ++ ++
Sbjct: 449 NGTTIDNCLEIMEEWFLKGKKKTALEHWKIDDDYGSILINLLHNIMKERKNVDIGLKAIE 508

Query: 423 QVFKRIFIKTEKNTFIVERL--VLYAYQRFIIKNLVNQNENAKCVDFINEWRIDFENGRY 480
              +++ + +  N +    L  VLY  Q+ I + +       K +  I       +NG Y
Sbjct: 509 NFVQKLKLGS-VNKYYERNLTHVLYGLQKCIFRKIAESGSYNKGLALI-------DNGAY 560

Query: 481 LE 482
            +
Sbjct: 561 TQ 562

>Kwal_14.1314 s14 complement(273836..277171) [3336 bp, 1111 aa] {ON}
           YLR336C (SGD1) - may be involved in high osmolarity
           signaling pathway [contig 243] FULL
          Length = 1111

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 41/73 (56%)

Query: 29  TSAPITLEDSLQSILSDIQDGSNIVTPNKPNTNLLTSKQPIKALKHLQWKTNLRVKKTTR 88
           TS  +  ED L S  S+I+D  +I    + +   +T+ + + ALK ++ + + + KK  R
Sbjct: 237 TSKSLKDEDELLSSASEIEDTDSISMEYESDAEPMTAAETMAALKKMKAEKDRKAKKKER 296

Query: 89  LLKYSNEKLTPED 101
           L + S+E+ + E+
Sbjct: 297 LSEGSDEEWSSEN 309

>KLLA0C18700g Chr3 complement(1658267..1662133) [3867 bp, 1288 aa]
           {ON} similar to uniprot|P28273 YKL215C Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 1288

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 43/88 (48%), Gaps = 6/88 (6%)

Query: 43  LSDIQDGSNIVTP----NKPNTNLLTSKQPIKALK-HLQWKTNLRVKKTTRLLKYSNEKL 97
           L D++ G+ I  P    +   TNLLT       LK HL  K   +  KT++ L  ++E +
Sbjct: 682 LDDLEIGTKIQGPAIIADGTQTNLLTPNSTATILKSHLFIKIE-KNTKTSKALSEASETI 740

Query: 98  TPEDYSVFVNQLMDVYSKDIELLNKTEV 125
            P   S+F ++ MD+  +    L KT V
Sbjct: 741 DPVLLSIFGHRFMDIAEQMGNQLRKTSV 768

>KLLA0D03927g Chr4 (331864..332472) [609 bp, 202 aa] {ON} no
           similarity
          Length = 202

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 23/47 (48%)

Query: 272 IQALGHYKEVPFLKQYISIFYGIDENVTITETHPGIKKLTPDSQLLK 318
           I +  H   VP  +Q+  + YG  E V+I+   P +K  +P    LK
Sbjct: 3   IDSFSHKSSVPQFEQHFGVKYGTKEAVSISRNKPWLKGRSPKPCSLK 49

>ZYRO0G05918g Chr7 complement(466947..468386) [1440 bp, 479 aa] {ON}
           similar to uniprot|P27929 Saccharomyces cerevisiae
           YNL137C NAM9 Mitochondrial ribosomal component of the
           small subunit
          Length = 479

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 10/59 (16%)

Query: 365 WNKYKDSKGSQPKKAWNLMLNWYATIGKAVPFDQKIMLYRLSFLKSRKDHNAAIRDVQQ 423
           WNKY     S P+  WN  LN Y  +  + P  Q+       FL+  KD+N   +D++Q
Sbjct: 182 WNKYVKEAKSNPRAVWNKKLNKYREMDNSNPQKQQ-------FLEQVKDYN---KDLEQ 230

>Suva_5.200 Chr5 (305198..306925) [1728 bp, 575 aa] {ON} YER087W
           (REAL)
          Length = 575

 Score = 31.6 bits (70), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%)

Query: 351 KSFWRTTIYWSLREWNKYKDSKGSQ 375
           KS W+TT  W+  E  K+KDSKG Q
Sbjct: 85  KSLWQTTGRWTNSELFKFKDSKGKQ 109

>NDAI0H01920 Chr8 (470097..472589) [2493 bp, 830 aa] {ON} Anc_7.28
           YAL043C
          Length = 830

 Score = 31.2 bits (69), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 31/48 (64%)

Query: 76  QWKTNLRVKKTTRLLKYSNEKLTPEDYSVFVNQLMDVYSKDIELLNKT 123
           Q+KT  + K++  L++ ++E L+  D + F+N L  V S+  +L+NKT
Sbjct: 474 QFKTEQKGKESEILIQLASEALSSVDTNRFINALSIVASRYTDLMNKT 521

>Kpol_543.73 s543 complement(172906..177906) [5001 bp, 1666 aa] {ON}
           complement(172906..177906) [5001 nt, 1667 aa]
          Length = 1666

 Score = 31.2 bits (69), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 47/101 (46%), Gaps = 11/101 (10%)

Query: 66  KQPIKALKHLQWKTNLRVKKTTRLLKYSNEKLTPEDYSVFVNQLMDVYSKDIELLNKTEV 125
           KQ I   + L    N+  K     +K+  + L  E Y +    L    SK   LL K  +
Sbjct: 174 KQSISKAQILDNSENVVFKHN---IKFKRDFLLKE-YDILSQILFGTISKKF-LLTKDFI 228

Query: 126 WKSLYHIYRVFVVNAVDDGNAMVLYDLNQFVRMFINLNDLP 166
            K L H      V++++  +  ++Y L+ F  +FINLN+LP
Sbjct: 229 LKLLSH------VSSLESNDFFIVYYLSSFFNIFINLNELP 263

>TBLA0I01170 Chr9 (245439..252158) [6720 bp, 2239 aa] {ON} 
          Length = 2239

 Score = 31.2 bits (69), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 37/77 (48%), Gaps = 5/77 (6%)

Query: 65   SKQPIKALKHLQWKTNLRVKKTTRLLKYSNEKLTPEDYSVFVNQLMDVYSKDIELLNKTE 124
            +K P+KALKH     N  +K +     Y    +  +DY +  + + DV + DI   N  E
Sbjct: 1790 TKAPVKALKHPTTPINETIKNSA----YPTAPVI-DDYDMNESDIQDVITADIAEANSDE 1844

Query: 125  VWKSLYHIYRVFVVNAV 141
               S+++   + ++N V
Sbjct: 1845 YGTSMFNTSDLNLINKV 1861

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,540,744
Number of extensions: 2880204
Number of successful extensions: 11167
Number of sequences better than 10.0: 54
Number of HSP's gapped: 11458
Number of HSP's successfully gapped: 55
Length of query: 518
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 404
Effective length of database: 40,409,475
Effective search space: 16325427900
Effective search space used: 16325427900
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)