Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D01331g6.27ON30830815180.0
KNAG0M012406.27ON3143119101e-122
Kwal_56.224546.27ON3152798971e-120
TBLA0E030606.27ON3193098831e-118
NCAS0H015106.27ON3132858791e-118
SAKL0E01474g6.27ON3113068751e-117
CAGL0E02519g6.27ON3152968701e-116
KLTH0C11044g6.27ON3152698691e-116
KAFR0G026506.27ON3212778681e-116
NDAI0F017406.27ON3133038541e-114
Ecym_30316.27ON3283008521e-113
TPHA0M002906.27ON3272788441e-112
Kpol_1032.96.27ON3182938391e-111
TDEL0G044206.27ON3223168341e-111
ZYRO0C07612g6.27ON3192908081e-107
YOL002C (IZH2)6.27ON3172998051e-106
Smik_15.1686.27ON3272998011e-106
Skud_15.1606.27ON3273097921e-104
ACL002C6.27ON3292427801e-102
Suva_15.1736.27ON3272997721e-101
TPHA0A006403.90ON3273086444e-82
SAKL0C09218g3.90ON3142766401e-81
YDR492W (IZH1)3.90ON3162806174e-78
KLTH0C09504g3.90ON3192676165e-78
Skud_4.7663.90ON3162806158e-78
CAGL0G04631g3.90ON3162786122e-77
Smik_4.7693.90ON3162836113e-77
Suva_2.6683.90ON3153086035e-76
Kwal_56.227043.90ON3202746036e-76
ZYRO0B06556g3.90ON3182485889e-74
AFR337W3.90ON3172755853e-73
Kpol_1053.263.90ON3242425811e-72
KLLA0C12441g3.90ON3152775792e-72
KAFR0A081303.90ON3192795774e-72
TDEL0D053403.90ON3162765757e-72
NCAS0I025703.90ON3143115522e-68
NDAI0A071603.90ON3302835507e-68
TBLA0B022903.90ON3262525472e-67
Ecym_35883.90ON3052575443e-67
KNAG0K021603.90ON3233184566e-54
TBLA0B082553.90ON2962663474e-38
NCAS0C049203.90ON3262832936e-30
NDAI0G043003.90ON3182972551e-24
CAGL0I07491g3.90ON3012482365e-22
KAFR0J006705.197ON5092701903e-15
Suva_15.643.90ON3122461831e-14
KLLA0F15510g5.197ON6222801842e-14
Kpol_2002.945.197ON5772341832e-14
TPHA0E031205.197ON5692441823e-14
Smik_15.563.90ON3122441776e-14
YOL101C (IZH4)3.90ON3122461742e-13
NCAS0D026005.197ON5432811726e-13
Ecym_71095.197ON5682731727e-13
Skud_15.533.90ON3122461697e-13
Kwal_33.151225.197ON5662431691e-12
NDAI0I023305.197ON5782381682e-12
KLTH0B03498g5.197ON5462561663e-12
KNAG0B051005.197ON5382371647e-12
Skud_12.915.197ON5422761583e-11
Smik_12.865.197ON5422321583e-11
ZYRO0B10538g5.197ON5312381541e-10
YLR023C (IZH3)5.197ON5432791522e-10
Suva_10.1045.197ON5412391513e-10
AAL153C5.197ON4192641469e-10
CAGL0D03322g5.197ON5452351424e-09
TDEL0E043205.197ON4502421406e-09
SAKL0G12980g5.197ON5632521381e-08
TBLA0C060505.197ON4372361371e-08
KNAG0K006703.90ON321126910.007
TPHA0A042003.223ON123667685.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D01331g
         (308 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D01331g Chr4 (117469..118395) [927 bp, 308 aa] {ON} similar...   589   0.0  
KNAG0M01240 Chr13 (226766..227710) [945 bp, 314 aa] {ON} Anc_6.2...   355   e-122
Kwal_56.22454 s56 (136175..137122) [948 bp, 315 aa] {ON} YOL002C...   350   e-120
TBLA0E03060 Chr5 (769031..769990) [960 bp, 319 aa] {ON} Anc_6.27...   344   e-118
NCAS0H01510 Chr8 complement(287981..288922) [942 bp, 313 aa] {ON...   343   e-118
SAKL0E01474g Chr5 (112382..113317) [936 bp, 311 aa] {ON} similar...   341   e-117
CAGL0E02519g Chr5 complement(242867..243814) [948 bp, 315 aa] {O...   339   e-116
KLTH0C11044g Chr3 complement(908604..909551) [948 bp, 315 aa] {O...   339   e-116
KAFR0G02650 Chr7 complement(547561..548526) [966 bp, 321 aa] {ON...   338   e-116
NDAI0F01740 Chr6 (429141..430082) [942 bp, 313 aa] {ON} Anc_6.27      333   e-114
Ecym_3031 Chr3 (61592..62578) [987 bp, 328 aa] {ON} similar to A...   332   e-113
TPHA0M00290 Chr13 (57784..58767) [984 bp, 327 aa] {ON} Anc_6.27 ...   329   e-112
Kpol_1032.9 s1032 (22700..23656) [957 bp, 318 aa] {ON} (22700..2...   327   e-111
TDEL0G04420 Chr7 complement(802412..803380) [969 bp, 322 aa] {ON...   325   e-111
ZYRO0C07612g Chr3 complement(578864..579823) [960 bp, 319 aa] {O...   315   e-107
YOL002C Chr15 complement(323411..324364) [954 bp, 317 aa] {ON}  ...   314   e-106
Smik_15.168 Chr15 complement(290724..291707) [984 bp, 327 aa] {O...   313   e-106
Skud_15.160 Chr15 complement(283003..283986) [984 bp, 327 aa] {O...   309   e-104
ACL002C Chr3 complement(353449..354438) [990 bp, 329 aa] {ON} Sy...   305   e-102
Suva_15.173 Chr15 complement(297915..298898) [984 bp, 327 aa] {O...   301   e-101
TPHA0A00640 Chr1 complement(115042..116025) [984 bp, 327 aa] {ON...   252   4e-82
SAKL0C09218g Chr3 (839747..840691) [945 bp, 314 aa] {ON} similar...   251   1e-81
YDR492W Chr4 (1434924..1435874) [951 bp, 316 aa] {ON}  IZH1Membr...   242   4e-78
KLTH0C09504g Chr3 complement(788442..789401) [960 bp, 319 aa] {O...   241   5e-78
Skud_4.766 Chr4 (1354630..1355580) [951 bp, 316 aa] {ON} YDR492W...   241   8e-78
CAGL0G04631g Chr7 (441149..442099) [951 bp, 316 aa] {ON} similar...   240   2e-77
Smik_4.769 Chr4 (1356263..1357213) [951 bp, 316 aa] {ON} YDR492W...   239   3e-77
Suva_2.668 Chr2 (1186763..1187710) [948 bp, 315 aa] {ON} YDR492W...   236   5e-76
Kwal_56.22704 s56 (244431..245393) [963 bp, 320 aa] {ON} YDR492W...   236   6e-76
ZYRO0B06556g Chr2 (526478..527434) [957 bp, 318 aa] {ON} similar...   231   9e-74
AFR337W Chr6 (1051645..1052598) [954 bp, 317 aa] {ON} Syntenic h...   229   3e-73
Kpol_1053.26 s1053 complement(40099..41073) [975 bp, 324 aa] {ON...   228   1e-72
KLLA0C12441g Chr3 complement(1057427..1058374) [948 bp, 315 aa] ...   227   2e-72
KAFR0A08130 Chr1 (1638153..1639112) [960 bp, 319 aa] {ON} Anc_3....   226   4e-72
TDEL0D05340 Chr4 (969608..970558) [951 bp, 316 aa] {ON} Anc_3.90...   226   7e-72
NCAS0I02570 Chr9 complement(480266..481210) [945 bp, 314 aa] {ON...   217   2e-68
NDAI0A07160 Chr1 complement(1630482..1631474) [993 bp, 330 aa] {...   216   7e-68
TBLA0B02290 Chr2 complement(534472..535452) [981 bp, 326 aa] {ON...   215   2e-67
Ecym_3588 Chr3 (1117646..1118563) [918 bp, 305 aa] {ON} similar ...   214   3e-67
KNAG0K02160 Chr11 (436744..437715) [972 bp, 323 aa] {ON} Anc_3.9...   180   6e-54
TBLA0B08255 Chr2 (1973757..1974647) [891 bp, 296 aa] {ON}             138   4e-38
NCAS0C04920 Chr3 complement(1003692..1004672) [981 bp, 326 aa] {...   117   6e-30
NDAI0G04300 Chr7 (1035664..1036620) [957 bp, 318 aa] {ON} Anc_3.90    102   1e-24
CAGL0I07491g Chr9 complement(719539..720444) [906 bp, 301 aa] {O...    96   5e-22
KAFR0J00670 Chr10 (120378..121907) [1530 bp, 509 aa] {ON} Anc_5....    78   3e-15
Suva_15.64 Chr15 complement(100035..100973) [939 bp, 312 aa] {ON...    75   1e-14
KLLA0F15510g Chr6 (1433494..1435362) [1869 bp, 622 aa] {ON} some...    75   2e-14
Kpol_2002.94 s2002 (229517..231250) [1734 bp, 577 aa] {ON} (2295...    75   2e-14
TPHA0E03120 Chr5 complement(654079..655788) [1710 bp, 569 aa] {O...    75   3e-14
Smik_15.56 Chr15 complement(90083..91021) [939 bp, 312 aa] {ON} ...    73   6e-14
YOL101C Chr15 complement(126982..127920) [939 bp, 312 aa] {ON}  ...    72   2e-13
NCAS0D02600 Chr4 (499689..501320) [1632 bp, 543 aa] {ON} Anc_5.1...    71   6e-13
Ecym_7109 Chr7 complement(210829..212535) [1707 bp, 568 aa] {ON}...    71   7e-13
Skud_15.53 Chr15 complement(86339..87277) [939 bp, 312 aa] {ON} ...    70   7e-13
Kwal_33.15122 s33 (968885..970585) [1701 bp, 566 aa] {ON} YLR023...    70   1e-12
NDAI0I02330 Chr9 (532412..534148) [1737 bp, 578 aa] {ON} Anc_5.197     69   2e-12
KLTH0B03498g Chr2 complement(281148..282788) [1641 bp, 546 aa] {...    69   3e-12
KNAG0B05100 Chr2 (976101..977717) [1617 bp, 538 aa] {ON} Anc_5.1...    68   7e-12
Skud_12.91 Chr12 complement(177334..178962) [1629 bp, 542 aa] {O...    65   3e-11
Smik_12.86 Chr12 complement(172288..173916) [1629 bp, 542 aa] {O...    65   3e-11
ZYRO0B10538g Chr2 complement(830311..831906) [1596 bp, 531 aa] {...    64   1e-10
YLR023C Chr12 complement(185498..187129) [1632 bp, 543 aa] {ON} ...    63   2e-10
Suva_10.104 Chr10 complement(191663..193288) [1626 bp, 541 aa] {...    63   3e-10
AAL153C Chr1 complement(75086..76345) [1260 bp, 419 aa] {ON} Syn...    61   9e-10
CAGL0D03322g Chr4 complement(340949..342586) [1638 bp, 545 aa] {...    59   4e-09
TDEL0E04320 Chr5 complement(804655..806007) [1353 bp, 450 aa] {O...    59   6e-09
SAKL0G12980g Chr7 complement(1108751..1110442) [1692 bp, 563 aa]...    58   1e-08
TBLA0C06050 Chr3 (1468152..1469465) [1314 bp, 437 aa] {ON} Anc_5...    57   1e-08
KNAG0K00670 Chr11 complement(119419..120384) [966 bp, 321 aa] {O...    40   0.007
TPHA0A04200 Chr1 (943575..947285) [3711 bp, 1236 aa] {ON} Anc_3....    31   5.1  

>KLLA0D01331g Chr4 (117469..118395) [927 bp, 308 aa] {ON} similar to
           uniprot|Q12442 Saccharomyces cerevisiae YOL002C IZH2
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family direct target of the Zap1p
           transcription factor expression induced by zinc
           deficiency and fatty acids deletion increases
           sensitivity to elevated zinc
          Length = 308

 Score =  589 bits (1518), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/308 (93%), Positives = 287/308 (93%)

Query: 1   MSTRKRSVVTEETALIEETPGTKKTVRVYERRVYSWDEIPDWQKDNEHILHGYVRETQSW 60
           MSTRKRSVVTEETALIEETPGTKKTVRVYERRVYSWDEIPDWQKDNEHILHGYVRETQSW
Sbjct: 1   MSTRKRSVVTEETALIEETPGTKKTVRVYERRVYSWDEIPDWQKDNEHILHGYVRETQSW 60

Query: 61  KELFHSLFYLHNESVNIYTHLIPAVALFFIMLFATHHVINEYPTTSAIDYFMINLFFFGC 120
           KELFHSLFYLHNESVNIYTHLIPAVALFFIMLFATHHVINEYPTTSAIDYFMINLFFFGC
Sbjct: 61  KELFHSLFYLHNESVNIYTHLIPAVALFFIMLFATHHVINEYPTTSAIDYFMINLFFFGC 120

Query: 121 ATCLTMSSMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYPFAG 180
           ATCLTMSSMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYPFAG
Sbjct: 121 ATCLTMSSMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYPFAG 180

Query: 181 LTSLFGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKRVQL 240
           LTSLFGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKRVQL
Sbjct: 181 LTSLFGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKRVQL 240

Query: 241 TWVIWEGVLYIFGAFLYGVRFPERLAPGKFDIWGHSXXXXXXXXXXXXXXXXXXXXXSYG 300
           TWVIWEGVLYIFGAFLYGVRFPERLAPGKFDIWGHS                     SYG
Sbjct: 241 TWVIWEGVLYIFGAFLYGVRFPERLAPGKFDIWGHSHQLFHVLVVVAALCHLKALVVSYG 300

Query: 301 LVHQALSQ 308
           LVHQALSQ
Sbjct: 301 LVHQALSQ 308

>KNAG0M01240 Chr13 (226766..227710) [945 bp, 314 aa] {ON} Anc_6.27
           YOL002C
          Length = 314

 Score =  355 bits (910), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 173/311 (55%), Positives = 220/311 (70%), Gaps = 4/311 (1%)

Query: 1   MSTR--KRSVVTEETALIEETPGTKKTV-RVYERRVYSWDEIPDWQKDNEHILHGYVRET 57
           MS+R  +++V   E  + E+  G  KT  +   +R+Y+W+EIP+WQKDNEHI+ GYVRET
Sbjct: 1   MSSRVQRQTVTITEPVVYEDDGGEMKTATKKITKRIYTWNEIPEWQKDNEHIIDGYVRET 60

Query: 58  QSWKELFHSLFYLHNESVNIYTHLIPAVALFFIMLFATHHVINEYPTTSAIDYFMINLFF 117
            S+ +  HSLFYLHNESVN+Y+HLIPA+  FF +LF   + +  + TTS +DY  I+LFF
Sbjct: 61  NSFLKCVHSLFYLHNESVNVYSHLIPALC-FFSVLFLNKYCVKSFETTSLVDYLFIDLFF 119

Query: 118 FGCATCLTMSSMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYP 177
            G  TCL +SS FH  K HSL +ATFGNKLDYLGIVVLI TSMISIL+YGF+DSS++FY 
Sbjct: 120 LGAFTCLILSSTFHCFKSHSLKVATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVMFYF 179

Query: 178 FAGLTSLFGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKR 237
           F+ +T  FG  CG +SLKD FRSREWRPYRA +FV FGLSA+ PI++G   YG +E + R
Sbjct: 180 FSFVTLSFGTACGVVSLKDHFRSREWRPYRAGLFVAFGLSAILPILSGMFAYGIEEAFHR 239

Query: 238 VQLTWVIWEGVLYIFGAFLYGVRFPERLAPGKFDIWGHSXXXXXXXXXXXXXXXXXXXXX 297
           +Q+ W+I EGV YI GAFLYG+RFPE+ +PGK+DIWGHS                     
Sbjct: 240 IQIKWIILEGVFYILGAFLYGIRFPEKGSPGKYDIWGHSHQVFHILVVVAALCHLKGLMV 299

Query: 298 SYGLVHQALSQ 308
           SY LVH+ LS 
Sbjct: 300 SYELVHKGLSS 310

>Kwal_56.22454 s56 (136175..137122) [948 bp, 315 aa] {ON} YOL002C -
           Hypothetical ORF [contig 185] FULL
          Length = 315

 Score =  350 bits (897), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 170/279 (60%), Positives = 197/279 (70%), Gaps = 4/279 (1%)

Query: 1   MSTRKRSVVTEETALIEETPGTKKTVRVYER---RVYSWDEIPDWQKDNEHILHGYVRET 57
           ++ RK   +  E  + EET       R+ ER   R+Y WDEIP+WQKDNEHIL+GY+ ET
Sbjct: 6   LTKRKAVGIEPEGVMTEETTTLLNGSRIEERTRRRLYKWDEIPEWQKDNEHILNGYILET 65

Query: 58  QSWKELFHSLFYLHNESVNIYTHLIPAVALFFIMLFATHHVINEYPTTSAIDYFMINLFF 117
           +S      SL YLHNESVNIYTHLIP      + LF     I  Y TT  IDY MI+LFF
Sbjct: 66  KSVGACLKSLLYLHNESVNIYTHLIPGWCFLLMTLF-NQLAIERYETTRMIDYIMIDLFF 124

Query: 118 FGCATCLTMSSMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYP 177
            G  TCL MSS FH  KCHSLP+A  GNKLDYLGIV L+ TSM+SILFYGFHD++L FY 
Sbjct: 125 LGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYV 184

Query: 178 FAGLTSLFGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKR 237
           F+GLT +FGL C  +SL DKFRSR+WRPYRA +FV FGLSA+FP++AG   YG   TW R
Sbjct: 185 FSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTR 244

Query: 238 VQLTWVIWEGVLYIFGAFLYGVRFPERLAPGKFDIWGHS 276
           +QL WV  EGV YI GA LYGVRFPER+APG FDIWG S
Sbjct: 245 IQLKWVFLEGVFYILGALLYGVRFPERVAPGTFDIWGQS 283

>TBLA0E03060 Chr5 (769031..769990) [960 bp, 319 aa] {ON} Anc_6.27
           YOL002C
          Length = 319

 Score =  344 bits (883), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 174/309 (56%), Positives = 208/309 (67%), Gaps = 3/309 (0%)

Query: 1   MSTRKRSVVTEETA--LIEETPGTKKTVRVYERRVYSWDEIPDWQKDNEHILHGYVRETQ 58
           +  RK +  TEE    L  +      T     +R+Y+WDEIP WQ DNE+I  GYVRET 
Sbjct: 5   VQRRKLTSSTEEGVELLYGDNQQQLNTSGSSGKRLYTWDEIPVWQHDNEYIYTGYVRETN 64

Query: 59  SWKELFHSLFYLHNESVNIYTHLIPAVALFFIMLFATHHVINEYPTTSAIDYFMINLFFF 118
           S KE F SLFY+HNESVNIYTHLIPA     ++LF T+ V   +PTT+  DY  I+LFF 
Sbjct: 65  SMKESFLSLFYIHNESVNIYTHLIPAFCFLSMLLFNTYGV-KPHPTTTYGDYVAIDLFFI 123

Query: 119 GCATCLTMSSMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYPF 178
           G  TCL +SS FH  K HSL I+ FGNKLDYLGIV+LISTS+IS+L++G+HD   +FY F
Sbjct: 124 GAFTCLGLSSTFHCFKSHSLKISVFGNKLDYLGIVILISTSLISVLYFGYHDDPFIFYIF 183

Query: 179 AGLTSLFGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKRV 238
           +G+T  FG+ CG  SLKDKFR+REWRPYRA +FVLFGLS V PI+AG + YG  E ++RV
Sbjct: 184 SGITLCFGIACGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGIREVFERV 243

Query: 239 QLTWVIWEGVLYIFGAFLYGVRFPERLAPGKFDIWGHSXXXXXXXXXXXXXXXXXXXXXS 298
           QL W+IWEGVLYIFGAFLYG RFPE+  PGK DIWG S                     S
Sbjct: 244 QLKWIIWEGVLYIFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCHLRGLIGS 303

Query: 299 YGLVHQALS 307
           Y LVHQ L 
Sbjct: 304 YELVHQKLD 312

>NCAS0H01510 Chr8 complement(287981..288922) [942 bp, 313 aa] {ON}
           Anc_6.27
          Length = 313

 Score =  343 bits (879), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 169/285 (59%), Positives = 201/285 (70%), Gaps = 3/285 (1%)

Query: 22  TKKTVRVYERRVYSWDEIPDWQKDNEHILHGYVRETQSWKELFHSLFYLHNESVNIYTHL 81
           TKKT  +  R++Y+WDEIP+WQKDNEHI+ GYVRET S++  F SLFY+HNE+ N+Y+HL
Sbjct: 32  TKKTTTI--RKLYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHL 89

Query: 82  IPAVALFFIMLFATHHVINEYPTTSAIDYFMINLFFFGCATCLTMSSMFHTIKCHSLPIA 141
           +P V  F  MLF  + +++ + TT+  DY +INLFF G  TCL +SS FH  K HSL IA
Sbjct: 90  VPGVVFFLTMLFDKYAIVS-FETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIA 148

Query: 142 TFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYPFAGLTSLFGLICGYMSLKDKFRSR 201
           TFGNKLDYLGIVVLI TSMISILFYGF+D+   FY F+ LT  FG  C  +SLKDKFRSR
Sbjct: 149 TFGNKLDYLGIVVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSR 208

Query: 202 EWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKRVQLTWVIWEGVLYIFGAFLYGVRF 261
           EWRPYRA +FV FGLSAV PI+ G + YG  ETW R+QL WV+ EGV YIFGAFLYG+RF
Sbjct: 209 EWRPYRAGLFVAFGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRF 268

Query: 262 PERLAPGKFDIWGHSXXXXXXXXXXXXXXXXXXXXXSYGLVHQAL 306
           PE+   G FDIWGHS                     SY LVH  L
Sbjct: 269 PEKYVNGTFDIWGHSHQIFHLLVVVAAFCHLKALLGSYELVHMNL 313

>SAKL0E01474g Chr5 (112382..113317) [936 bp, 311 aa] {ON} similar to
           uniprot|Q12442 Saccharomyces cerevisiae YOL002C IZH2
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family direct target of the Zap1p
           transcription factor expression induced by zinc
           deficiency and fatty acids deletion increases
           sensitivity to elevated zinc
          Length = 311

 Score =  341 bits (875), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 168/306 (54%), Positives = 203/306 (66%), Gaps = 1/306 (0%)

Query: 3   TRKRSVVTEETALIEETPGTKKTVRVYERRVYSWDEIPDWQKDNEHILHGYVRETQSWKE 62
            R+R  +     + EET  T    +   RR+YSW+EIPDWQKDNEHI HGYVRET S+  
Sbjct: 6   NRRRLQIKRANIVKEETMSTGTINKKRVRRLYSWEEIPDWQKDNEHIRHGYVRETNSFLG 65

Query: 63  LFHSLFYLHNESVNIYTHLIPAVALFFIMLFATHHVINEYPTTSAIDYFMINLFFFGCAT 122
            F SLFY+HNESVNIYTHL+P +  FF++LF     I  + TT+ +DY M++LFF G  T
Sbjct: 66  CFDSLFYMHNESVNIYTHLLPGLCFFFVVLF-DKVAIKVFDTTTFLDYIMVDLFFLGAFT 124

Query: 123 CLTMSSMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYPFAGLT 182
           CL +SS FH +K HSL IA  GNKLDYLGIV LI +SMISI++YGF DS   FY F+ LT
Sbjct: 125 CLILSSTFHCLKTHSLRIAILGNKLDYLGIVALIVSSMISIMYYGFFDSGKFFYGFSTLT 184

Query: 183 SLFGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKRVQLTW 242
            +FG+ C   SL D FRSREWRPYRA +FV FGLSAV PI +G  VYG  ETW +VQ+ W
Sbjct: 185 LVFGIACAIASLSDTFRSREWRPYRAALFVAFGLSAVLPIFSGVAVYGFKETWVKVQVKW 244

Query: 243 VIWEGVLYIFGAFLYGVRFPERLAPGKFDIWGHSXXXXXXXXXXXXXXXXXXXXXSYGLV 302
           V+  GV YI GA LY +R PER++PGKFDIWGHS                     SY LV
Sbjct: 245 VLLGGVFYIIGALLYALRLPERISPGKFDIWGHSHQIFHILVVIAALCHLKAVLNSYELV 304

Query: 303 HQALSQ 308
           H+ L+ 
Sbjct: 305 HKKLAS 310

>CAGL0E02519g Chr5 complement(242867..243814) [948 bp, 315 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002c
          Length = 315

 Score =  339 bits (870), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 167/296 (56%), Positives = 202/296 (68%), Gaps = 1/296 (0%)

Query: 8   VVTEETALIEETPGTKKTVRVYERRVYSWDEIPDWQKDNEHILHGYVRETQSWKELFHSL 67
           V TEE  LI      K   +   R++Y+W+EIP+WQKDNEHI  GYVRET S  E   SL
Sbjct: 13  VTTEEQPLIGTDGQIKLRKKTVVRKLYTWEEIPEWQKDNEHIHTGYVRETSSVMECIRSL 72

Query: 68  FYLHNESVNIYTHLIPAVALFFIMLFATHHVINEYPTTSAIDYFMINLFFFGCATCLTMS 127
           FYLHNE+VNIY+HLIPA+A FF  +F   +V+  Y TT+ IDY +I++FF G  +CL +S
Sbjct: 73  FYLHNETVNIYSHLIPAIA-FFSTIFFNKYVVPTYSTTTLIDYLIIDIFFLGAFSCLILS 131

Query: 128 SMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYPFAGLTSLFGL 187
           S FH +K HSL +A FGNKLDYLGIV LI  SM+SIL+YGFH +   F  F+ +T  FG 
Sbjct: 132 STFHCLKSHSLRVAVFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFFGIFSLITMTFGA 191

Query: 188 ICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKRVQLTWVIWEG 247
            C  +SLKD FRSREWRPYRA +FV+FGLSAV PI+AG   YG  ETW R+QL WVI EG
Sbjct: 192 ACAVVSLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLFKYGPTETWTRIQLKWVILEG 251

Query: 248 VLYIFGAFLYGVRFPERLAPGKFDIWGHSXXXXXXXXXXXXXXXXXXXXXSYGLVH 303
           V YIFGAFLYG+RFPE+++PG FD+WGHS                     SY LVH
Sbjct: 252 VFYIFGAFLYGIRFPEKMSPGSFDLWGHSHQIFHILVVVAALCHLKALLGSYSLVH 307

>KLTH0C11044g Chr3 complement(908604..909551) [948 bp, 315 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002C IZH2 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family direct
           target of the Zap1p transcription factor expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 315

 Score =  339 bits (869), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 160/269 (59%), Positives = 202/269 (75%), Gaps = 5/269 (1%)

Query: 8   VVTEETALIEETPGTKKTVRVYERRVYSWDEIPDWQKDNEHILHGYVRETQSWKELFHSL 67
           +V E ++L++++   ++T    +RR+Y+WDEIP+WQ+DNEHI+ GY+ ET+S  E   SL
Sbjct: 20  MVEENSSLLKDSNLKQRT----KRRLYTWDEIPEWQRDNEHIVGGYILETKSTWECLKSL 75

Query: 68  FYLHNESVNIYTHLIPAVALFFIMLFATHHVINEYPTTSAIDYFMINLFFFGCATCLTMS 127
            YLHNESVNIYTHL+P      + +F    VI ++ TT  IDY MI+LFF G  TCL MS
Sbjct: 76  LYLHNESVNIYTHLLPGWCFLLVAVF-NQVVIEKFETTRLIDYVMIDLFFLGGFTCLMMS 134

Query: 128 SMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYPFAGLTSLFGL 187
           S+FH  KCHSLP+A  GNKLDYLGIV L+ TS++SILFYGFHD  L F+ F+GLT  FGL
Sbjct: 135 SVFHCFKCHSLPVAILGNKLDYLGIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGL 194

Query: 188 ICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKRVQLTWVIWEG 247
            C  +SL +KFRSREWRPYRA++FV FGLSA+ P++AG + YG  ETW R+QL WV+  G
Sbjct: 195 ACATVSLSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKETWTRIQLEWVLLGG 254

Query: 248 VLYIFGAFLYGVRFPERLAPGKFDIWGHS 276
           V YI GA LYG+RFPER+APG FDIWGHS
Sbjct: 255 VFYILGAVLYGIRFPERMAPGCFDIWGHS 283

>KAFR0G02650 Chr7 complement(547561..548526) [966 bp, 321 aa] {ON}
           Anc_6.27 YOL002C
          Length = 321

 Score =  338 bits (868), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 166/277 (59%), Positives = 206/277 (74%), Gaps = 5/277 (1%)

Query: 2   STRKRSVVTEETALIEETPGTKKTVRVYER--RVYSWDEIPDWQKDNEHILHGYVRETQS 59
           STRK ++ T    ++E+  G  +T+R  E+  ++Y+W+EIPDWQKDNEHI+ GYV+ET S
Sbjct: 9   STRKVTIDTAFQDVVEQNKG--ETIRSLEKIIQLYNWNEIPDWQKDNEHIISGYVKETNS 66

Query: 60  WKELFHSLFYLHNESVNIYTHLIPAVALFFIMLFATHHVINEYPTTSAIDYFMINLFFFG 119
           +     SLFYLHNESVN+Y+HLIPAV  F +       ++ ++ TT+ +DY  I+LFF G
Sbjct: 67  FFSCIESLFYLHNESVNVYSHLIPAVC-FLMTSLLNKTIVPKFRTTTVLDYLYIDLFFLG 125

Query: 120 CATCLTMSSMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYPFA 179
             TCL +SS FH  K HSL IATFGNKLDYLGIVVLISTSMIS+L+YGF+D+  LFY FA
Sbjct: 126 AFTCLILSSTFHCFKSHSLRIATFGNKLDYLGIVVLISTSMISLLYYGFYDTPSLFYVFA 185

Query: 180 GLTSLFGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKRVQ 239
            +T  FGL C  +SLKDKFRSRE R YRAT+FV FGLSAV P++ G   YG   TW R+Q
Sbjct: 186 FITLSFGLACATVSLKDKFRSRECRAYRATLFVCFGLSAVLPVICGLYHYGFYNTWHRIQ 245

Query: 240 LTWVIWEGVLYIFGAFLYGVRFPERLAPGKFDIWGHS 276
           L WV+ EGV YIFGAFLYG+RFPE+  PGK+DIWGHS
Sbjct: 246 LKWVLLEGVFYIFGAFLYGIRFPEKYTPGKYDIWGHS 282

>NDAI0F01740 Chr6 (429141..430082) [942 bp, 313 aa] {ON} Anc_6.27
          Length = 313

 Score =  333 bits (854), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 167/303 (55%), Positives = 202/303 (66%), Gaps = 4/303 (1%)

Query: 7   SVVTEETALIEETPGTKKTVRVYER---RVYSWDEIPDWQKDNEHILHGYVRETQSWKEL 63
           S  T    +I  T       +V  +   ++Y WDEIP+WQKDNEHI+ GYVRET S+K  
Sbjct: 12  STTTVVEGIINNTDNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISGYVRETNSFKGC 71

Query: 64  FHSLFYLHNESVNIYTHLIPAVALFFIMLFATHHVINEYPTTSAIDYFMINLFFFGCATC 123
            HSLFY+HNES N+Y+HL+P V  FF M+   +  I  Y TTS +DY MI+LFFFG   C
Sbjct: 72  LHSLFYVHNESGNVYSHLLPGVFFFFTMVLNKYG-ITIYSTTSIVDYLMIDLFFFGAFCC 130

Query: 124 LTMSSMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYPFAGLTS 183
           L +SS+FH  K HSL +AT GNKLDYLGIV+LI TSMISI+++GF D+ L FY F+ LT 
Sbjct: 131 LILSSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPLFFYFFSSLTF 190

Query: 184 LFGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKRVQLTWV 243
           LFG  C  +SLKD FRSREWRPYRA +FV FGLSA+ PI+AG   YG +ET+ R+QL W+
Sbjct: 191 LFGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIEETFIRIQLKWI 250

Query: 244 IWEGVLYIFGAFLYGVRFPERLAPGKFDIWGHSXXXXXXXXXXXXXXXXXXXXXSYGLVH 303
           I EG  YIFGAFLYGVRFPE+  PG FDIWGHS                     SY +VH
Sbjct: 251 ILEGFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHLRGLLSSYEIVH 310

Query: 304 QAL 306
             L
Sbjct: 311 SRL 313

>Ecym_3031 Chr3 (61592..62578) [987 bp, 328 aa] {ON} similar to
           Ashbya gossypii ACL002C
          Length = 328

 Score =  332 bits (852), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 161/300 (53%), Positives = 209/300 (69%), Gaps = 2/300 (0%)

Query: 10  TEETALIEETPGTKKTVRVY-ERRVYSWDEIPDWQKDNEHILHGYVRETQSWKELFHSLF 68
           T ET++I E      T+ +    +++SW EIP+WQ+DNEHIL GYV+ET S+KE  HSL 
Sbjct: 24  TLETSVIFEDLNQATTIPLKPASKLFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLL 83

Query: 69  YLHNESVNIYTHLIPAVALFFIMLFATHHVINEYPTTSAIDYFMINLFFFGCATCLTMSS 128
           YLHNESVNIYTHLIP V  FF +LF   +VI+ + TT+  DY +I+ FF G   CL MS 
Sbjct: 84  YLHNESVNIYTHLIPGVC-FFCVLFLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSG 142

Query: 129 MFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYPFAGLTSLFGLI 188
            +H +K HS P++  GN+LDY+GIV+LISTSM S+L+YGF++SS +FY F+G+T L G I
Sbjct: 143 TYHCLKSHSYPVSIVGNQLDYIGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTI 202

Query: 189 CGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKRVQLTWVIWEGV 248
           C  ++L  +FRSR WRPYRA++FV FGLS++ PI+A  + YG +ETW  VQL W+I EGV
Sbjct: 203 CTVVTLDSRFRSRLWRPYRASIFVAFGLSSILPILASILYYGSEETWNSVQLGWIILEGV 262

Query: 249 LYIFGAFLYGVRFPERLAPGKFDIWGHSXXXXXXXXXXXXXXXXXXXXXSYGLVHQALSQ 308
           LYIFGAF+YG+RFPE +APG FDIWGHS                     SY LVH  L++
Sbjct: 263 LYIFGAFIYGIRFPESMAPGSFDIWGHSHQLFHVLVVIAALCHFKAVTQSYELVHFRLNE 322

>TPHA0M00290 Chr13 (57784..58767) [984 bp, 327 aa] {ON} Anc_6.27
           YOL002C
          Length = 327

 Score =  329 bits (844), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 156/278 (56%), Positives = 206/278 (74%), Gaps = 9/278 (3%)

Query: 7   SVVTEETALI--EETPGTKKTVRVYER------RVYSWDEIPDWQKDNEHILHGYVRETQ 58
           S VTEE   I  +     KK V++  R       +  WD++PDWQKDNEHI  GYV+ET 
Sbjct: 19  SAVTEEEYTIANDGVKSNKKLVKIIGRFTRQLITITHWDDLPDWQKDNEHIHEGYVKETN 78

Query: 59  SWKELFHSLFYLHNESVNIYTHLIPAVALFFIMLFATHHVINEYPTTSAIDYFMINLFFF 118
           S+   F SLF+LHNESVNIY+H++P +   F++L   + +I ++PTT+ +DYFMI+LF  
Sbjct: 79  SFINCFESLFFLHNESVNIYSHMVPGLCALFMLLIDIN-IIKKFPTTTFVDYFMIDLFLA 137

Query: 119 GCATCLTMSSMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYPF 178
           G  +CL +SS FHT+K HSL +A +GNKLDYLGIV+LI TSMISIL+YGF+D+   F+ F
Sbjct: 138 GAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILIVTSMISILYYGFYDTPYFFHLF 197

Query: 179 AGLTSLFGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKRV 238
           + +T LFG+ CG +SL +KFRSREWRPYRAT+FV FGLSAVFP++ G   YG ++T+KR+
Sbjct: 198 STITILFGIACGTVSLANKFRSREWRPYRATLFVCFGLSAVFPVLTGIWYYGLEDTFKRI 257

Query: 239 QLTWVIWEGVLYIFGAFLYGVRFPERLAPGKFDIWGHS 276
           QL W++ EG  YIFGAFLY +R+PER+ PG FD+WGHS
Sbjct: 258 QLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHS 295

>Kpol_1032.9 s1032 (22700..23656) [957 bp, 318 aa] {ON}
           (22700..23656) [957 nt, 319 aa]
          Length = 318

 Score =  327 bits (839), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 160/293 (54%), Positives = 200/293 (68%), Gaps = 3/293 (1%)

Query: 18  ETPGTKKTVRVYER--RVYSWDEIPDWQKDNEHILHGYVRETQSWKELFHSLFYLHNESV 75
           E  G K +    +R  ++ +W+ +PDWQKDNEHIL GYV+ET S K   HSL ++HNESV
Sbjct: 24  EKDGAKSSYSYIKRGVQLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESV 83

Query: 76  NIYTHLIPAVALFFIMLFATHHVINEYPTTSAIDYFMINLFFFGCATCLTMSSMFHTIKC 135
           NI++HL+PA      ++F   +V+  YPTT+  DY M++LF FG  TCL MSS FH +K 
Sbjct: 84  NIFSHLVPAFCFMTTIIF-DKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKA 142

Query: 136 HSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYPFAGLTSLFGLICGYMSLK 195
           HS  +++FGNKLDYLGIVVLI +SM SIL+YGF+D+S L++ F+ +T  FGL C  +SL 
Sbjct: 143 HSPYVSSFGNKLDYLGIVVLIVSSMSSILYYGFYDNSFLYFTFSAITFTFGLSCAVVSLG 202

Query: 196 DKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKRVQLTWVIWEGVLYIFGAF 255
           ++FR+REWRPYRA MFV FGLSA+ PI AGF+ YG  ET  RVQL WV+ EGV YIFGA 
Sbjct: 203 ERFRAREWRPYRAAMFVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGAL 262

Query: 256 LYGVRFPERLAPGKFDIWGHSXXXXXXXXXXXXXXXXXXXXXSYGLVHQALSQ 308
           LYGVRFPERL PG FDIWGHS                     SY +VH  LS 
Sbjct: 263 LYGVRFPERLKPGMFDIWGHSHQLFHILVVVAALCHLRGLLGSYTIVHTRLSS 315

>TDEL0G04420 Chr7 complement(802412..803380) [969 bp, 322 aa] {ON}
           Anc_6.27 YOL002C
          Length = 322

 Score =  325 bits (834), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 165/316 (52%), Positives = 212/316 (67%), Gaps = 11/316 (3%)

Query: 2   STRKRS---VVTEETALI--EETPGTKKTVRV-----YERRVYSWDEIPDWQKDNEHILH 51
           S +KRS   + T++T+ +  EET G  K  +       +R++Y+WDEIP WQ+DNEHIL 
Sbjct: 4   SLKKRSQCSLTTDQTSTVTKEETSGPVKGQKTDKMSKKKRKLYTWDEIPHWQRDNEHILS 63

Query: 52  GYVRETQSWKELFHSLFYLHNESVNIYTHLIPAVALFFIMLFATHHVINEYPTTSAIDYF 111
           GYV ET+S  + F SLFYLHNESVNIYTHL+P +A  F++ F     + ++ TT+ IDY 
Sbjct: 64  GYVGETRSMFQCFLSLFYLHNESVNIYTHLLPGIAFLFVLCF-DKFAVTQFETTTLIDYV 122

Query: 112 MINLFFFGCATCLTMSSMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDS 171
           MI+LF     TCLT+SS+FH +K HS  +ATFGNKLDYLGIVVL+ TSM+SI++YGF ++
Sbjct: 123 MIDLFSLVSFTCLTLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFFET 182

Query: 172 SLLFYPFAGLTSLFGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGK 231
             LFY F+ +T  FG  C  +SLK+ FR+REWRPYRA MFV FGLSAV PIV G   YG 
Sbjct: 183 PALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYYGF 242

Query: 232 DETWKRVQLTWVIWEGVLYIFGAFLYGVRFPERLAPGKFDIWGHSXXXXXXXXXXXXXXX 291
            E + R+Q+ WV+  G+ YI GA LYGVRFPE+ APGK+DIWGHS               
Sbjct: 243 SEIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHVLVVVAALCH 302

Query: 292 XXXXXXSYGLVHQALS 307
                 SY LVH  ++
Sbjct: 303 LYGLIKSYNLVHLKMA 318

>ZYRO0C07612g Chr3 complement(578864..579823) [960 bp, 319 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002C IZH2 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family direct
           target of the Zap1p transcription factor expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 319

 Score =  315 bits (808), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 155/290 (53%), Positives = 187/290 (64%), Gaps = 1/290 (0%)

Query: 17  EETPGTKKTVRVYERRVYSWDEIPDWQKDNEHILHGYVRETQSWKELFHSLFYLHNESVN 76
           E+T    + V   ++ +Y+W+EIPDWQKDNEHI+ GYVRET S +E   SL YLHNES+N
Sbjct: 26  EQTTIKIEPVNTQKKLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHNESIN 85

Query: 77  IYTHLIPAVALFFIMLFATHHVINEYPTTSAIDYFMINLFFFGCATCLTMSSMFHTIKCH 136
           IYTH +P +      +F     I  + TT+ IDY  I+ FFFG  +CL +SS FH  K H
Sbjct: 86  IYTHFLPGLCFLATCIF-DKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKSH 144

Query: 137 SLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYPFAGLTSLFGLICGYMSLKD 196
           S  ++ FGNKLDYLGIV+LI  SMISIL+Y FHDS+ LFY F  +   FG+ C   S  D
Sbjct: 145 SSRVSVFGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFDD 204

Query: 197 KFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKRVQLTWVIWEGVLYIFGAFL 256
            FRSREWRPYRA +FV FGLSA+ PI+ G I YG  ETW R+Q+ WVI EG+ YIFGAFL
Sbjct: 205 TFRSREWRPYRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIFGAFL 264

Query: 257 YGVRFPERLAPGKFDIWGHSXXXXXXXXXXXXXXXXXXXXXSYGLVHQAL 306
           Y +RFPERLAPG FD  GHS                     SY LVH  L
Sbjct: 265 YSIRFPERLAPGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYELVHTNL 314

>YOL002C Chr15 complement(323411..324364) [954 bp, 317 aa] {ON}
           IZH2Plasma membrane protein involved in zinc homeostasis
           and osmotin-induced apoptosis; transcription regulated
           by Zap1p, zinc and fatty acid levels; similar to
           mammalian adiponectins; deletion increases sensitivity
           to elevated zinc
          Length = 317

 Score =  314 bits (805), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 158/299 (52%), Positives = 198/299 (66%), Gaps = 5/299 (1%)

Query: 5   KRSVVTEETALIEETPGTKKTVRVYERRVYSWDEIPDWQKDNEHILHGYVRETQSWKELF 64
           K+    + +A   E    KK +R    R+YSWDEIP+WQ+DN+ ILHGYV+ET S+ E F
Sbjct: 15  KKRAAGKTSANPAEVAKAKKVLR----RLYSWDEIPEWQRDNDFILHGYVKETSSFIETF 70

Query: 65  HSLFYLHNESVNIYTHLIPAVALFFIMLFATHHVINEYPTTSAIDYFMINLFFFGCATCL 124
            SLFYLHNESVNIY+HLIPA+  FF +L      I  + TT+ +D+ +I+LF+ G   CL
Sbjct: 71  KSLFYLHNESVNIYSHLIPALG-FFTVLLLDKSTIKVFATTTWLDHMVIDLFYSGAFACL 129

Query: 125 TMSSMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYPFAGLTSL 184
            +SS FH +K HSL IAT GNKLDYLGI +LI TSM+SIL+YG+ +   LF  FA +T  
Sbjct: 130 ILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFSLFCLFALITVS 189

Query: 185 FGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKRVQLTWVI 244
           FG+ C  +SLKDKFR REWRPYRA +FV FGLS++ PI +G   Y   E W ++QL WV+
Sbjct: 190 FGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIWTQIQLFWVL 249

Query: 245 WEGVLYIFGAFLYGVRFPERLAPGKFDIWGHSXXXXXXXXXXXXXXXXXXXXXSYGLVH 303
             GVLYI GA LYG+RFPE++ PGKFDIWGHS                     SY LVH
Sbjct: 250 LGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRGLLNSYELVH 308

>Smik_15.168 Chr15 complement(290724..291707) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  313 bits (801), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 158/299 (52%), Positives = 198/299 (66%), Gaps = 5/299 (1%)

Query: 5   KRSVVTEETALIEETPGTKKTVRVYERRVYSWDEIPDWQKDNEHILHGYVRETQSWKELF 64
           K+    + +A   E    KK ++    R+YSWDEIP+WQ+DN+ ILHGYVRET S+ E F
Sbjct: 25  KKRAAGKTSANPAEVAEAKKVLK----RLYSWDEIPEWQRDNDFILHGYVRETSSFIETF 80

Query: 65  HSLFYLHNESVNIYTHLIPAVALFFIMLFATHHVINEYPTTSAIDYFMINLFFFGCATCL 124
            SLFYLHNESVNIY+HL+PA+  FF +L      I  + TT+  D+ +I+LF+ G   CL
Sbjct: 81  KSLFYLHNESVNIYSHLVPALG-FFTVLLLDKSTIKVFETTTWKDHVVIDLFYSGAFACL 139

Query: 125 TMSSMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYPFAGLTSL 184
            +SS FH +K HSL IAT GNKLDYLGI +LI TSM+SILFYG+++   LF  FA +T  
Sbjct: 140 ILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILFYGYYEKFSLFCLFALITVS 199

Query: 185 FGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKRVQLTWVI 244
           FG+ C  +SLKDKFR REWRPYRA +FV FGLS++ PI +G   Y   E W ++QL WV+
Sbjct: 200 FGVACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYSFSEIWTQIQLFWVL 259

Query: 245 WEGVLYIFGAFLYGVRFPERLAPGKFDIWGHSXXXXXXXXXXXXXXXXXXXXXSYGLVH 303
             GVLYI GA LYG+RFPE++ PGKFDIWGHS                     SY LVH
Sbjct: 260 LGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASLCHLRGLLNSYELVH 318

>Skud_15.160 Chr15 complement(283003..283986) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  309 bits (792), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 160/309 (51%), Positives = 202/309 (65%), Gaps = 7/309 (2%)

Query: 1   MST---RKRSVVTEETALIEETPGTKKTV---RVYERRVYSWDEIPDWQKDNEHILHGYV 54
           MST   R +SV   +     +TP     V   +   +R+YSWDEIP+WQ+DN++ILHGYV
Sbjct: 11  MSTLLERTKSVQELKKRAAGKTPANPAEVAEAKKVLKRLYSWDEIPEWQRDNDYILHGYV 70

Query: 55  RETQSWKELFHSLFYLHNESVNIYTHLIPAVALFFIMLFATHHVINEYPTTSAIDYFMIN 114
           RET S+ E F SLFY+HNESVNIY+HLIPA+  FF +L      I  + TT+  D+ +I+
Sbjct: 71  RETCSFVETFKSLFYMHNESVNIYSHLIPALG-FFTVLLLDKSTIKVFETTTWKDHMIID 129

Query: 115 LFFFGCATCLTMSSMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLL 174
           LF+ G   CL +SS FH +K HSL IAT GNKLDYLGI +LI TSM SIL+YG+++   L
Sbjct: 130 LFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILYYGYYEKFSL 189

Query: 175 FYPFAGLTSLFGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDET 234
           F  FA +T  FG+ C  ++LKDKFR REWRPYRA +FV FGLS++ PI +G   Y   E 
Sbjct: 190 FCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYTFSEI 249

Query: 235 WKRVQLTWVIWEGVLYIFGAFLYGVRFPERLAPGKFDIWGHSXXXXXXXXXXXXXXXXXX 294
           W ++QL WV+  GVLYI GA LYG+RFPE++ PGKFDIWGHS                  
Sbjct: 250 WTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASFCHLRG 309

Query: 295 XXXSYGLVH 303
              SY LVH
Sbjct: 310 LLNSYELVH 318

>ACL002C Chr3 complement(353449..354438) [990 bp, 329 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL002C
          Length = 329

 Score =  305 bits (780), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 140/242 (57%), Positives = 176/242 (72%), Gaps = 1/242 (0%)

Query: 35  SWDEIPDWQKDNEHILHGYVRETQSWKELFHSLFYLHNESVNIYTHLIPAVALFFIMLFA 94
           SWD++PDWQKDNEHIL GYVRET S+++ F SLFYLHNESVNIY+HLIP +   FI LF 
Sbjct: 54  SWDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFIALF- 112

Query: 95  THHVINEYPTTSAIDYFMINLFFFGCATCLTMSSMFHTIKCHSLPIATFGNKLDYLGIVV 154
             +V+ +Y TT+  DY MI++F  G   CLT+S ++H +K HSL ++ FGNKLDY+GIV 
Sbjct: 113 NKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIGIVA 172

Query: 155 LISTSMISILFYGFHDSSLLFYPFAGLTSLFGLICGYMSLKDKFRSREWRPYRATMFVLF 214
           LIS SMIS ++YGF+DS+ +F  F+ +T    L C  +SL   FRSREWR YRA +F  F
Sbjct: 173 LISCSMISQMYYGFYDSTAMFSLFSTVTLSLALACAVVSLSPHFRSREWRKYRAAIFTAF 232

Query: 215 GLSAVFPIVAGFIVYGKDETWKRVQLTWVIWEGVLYIFGAFLYGVRFPERLAPGKFDIWG 274
           GLS + P++     YG  E + R+QL W+  EGVLYI GA LYGVRFPE+L PG FDIWG
Sbjct: 233 GLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFDIWG 292

Query: 275 HS 276
           HS
Sbjct: 293 HS 294

>Suva_15.173 Chr15 complement(297915..298898) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  301 bits (772), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 156/299 (52%), Positives = 194/299 (64%), Gaps = 5/299 (1%)

Query: 5   KRSVVTEETALIEETPGTKKTVRVYERRVYSWDEIPDWQKDNEHILHGYVRETQSWKELF 64
           K+       A   E    KK ++    RVYSWDEIP+WQ+DN++ILHGYV+ET S+ + F
Sbjct: 25  KKRAAGNTAANPAEVAKAKKVLK----RVYSWDEIPEWQRDNDYILHGYVKETSSFVDTF 80

Query: 65  HSLFYLHNESVNIYTHLIPAVALFFIMLFATHHVINEYPTTSAIDYFMINLFFFGCATCL 124
            SLFY+HNESVNIY+HLIPAV  F  +L      I  + TT+ +D+ MI+LFF G   CL
Sbjct: 81  KSLFYMHNESVNIYSHLIPAVG-FLTVLLLDKTTITVFETTTWLDHMMIDLFFTGAFACL 139

Query: 125 TMSSMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYPFAGLTSL 184
            +SS FH  K HSL IAT GNKLDYLGI +LI TSM+SIL+YG++D    F  FA +T  
Sbjct: 140 ILSSSFHCFKSHSLKIATLGNKLDYLGICILIVTSMVSILYYGYYDKFPAFCLFALITVS 199

Query: 185 FGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKRVQLTWVI 244
           FG+ C  +SLKDKFR REWRPYRA +FV FGLS++ PI +G   Y   E W ++QL WV+
Sbjct: 200 FGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYYYSFSEIWNQIQLFWVL 259

Query: 245 WEGVLYIFGAFLYGVRFPERLAPGKFDIWGHSXXXXXXXXXXXXXXXXXXXXXSYGLVH 303
             G LYI GA LYG+RFPE++ PG+FDIWGHS                     SY LVH
Sbjct: 260 LGGALYIIGAVLYGMRFPEKVYPGRFDIWGHSHQLFHFLVVIASLCHMRGVLNSYELVH 318

>TPHA0A00640 Chr1 complement(115042..116025) [984 bp, 327 aa] {ON}
           Anc_3.90 YOL101C
          Length = 327

 Score =  252 bits (644), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 130/308 (42%), Positives = 183/308 (59%), Gaps = 5/308 (1%)

Query: 1   MSTRKRSVVTEETALIEETPGTKKTVRVYERRVYSWDEIPDWQKDNEHILHGYVRETQSW 60
           +S R+ SV    T L+E T    + V  Y +++YS+ E+P+WQKDNE I+ GYVRET SW
Sbjct: 17  LSRRRFSVSKNGTVLLEST----EIVETYSKKLYSFHELPEWQKDNELIIQGYVRETNSW 72

Query: 61  KELFHSLFYLHNESVNIYTHLIPAVALFFIMLFATHH-VINEYPTTSAIDYFMINLFFFG 119
            + FHSL Y HNES+NIYTHLIP +  F ++LF T   V+  +P+T+ +DY +I+ +  G
Sbjct: 73  FKCFHSLSYFHNESINIYTHLIPGLVYFIMLLFYTDLLVVPSFPSTTIMDYIVIDFYLLG 132

Query: 120 CATCLTMSSMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYPFA 179
              CL  SS FH +K HS   + F +K+DY+GI+ LIS S+IS+L+YG+ D  + F  F 
Sbjct: 133 AFICLVGSSCFHCLKQHSEDQSNFWSKIDYVGIICLISCSLISLLYYGYFDHFIYFKVFT 192

Query: 180 GLTSLFGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKRVQ 239
            +T +   IC    L ++F ++ +RP RA  FV+F  SAV PI  G I +   E   R+Q
Sbjct: 193 LITLILATICTVCVLDERFNAKNFRPIRAGFFVVFATSAVIPICTGLIKFDYVEVINRIQ 252

Query: 240 LTWVIWEGVLYIFGAFLYGVRFPERLAPGKFDIWGHSXXXXXXXXXXXXXXXXXXXXXSY 299
           L +V WE   Y+ GA LYG R PE  APG+FD+ G S                     SY
Sbjct: 253 LRFVGWETFFYVVGALLYGYRIPEIFAPGRFDLVGSSHQIFHVMVVIGSLFHLKAVIGSY 312

Query: 300 GLVHQALS 307
             +H++L+
Sbjct: 313 EFMHKSLN 320

>SAKL0C09218g Chr3 (839747..840691) [945 bp, 314 aa] {ON} similar to
           uniprot|Q6Q557 Saccharomyces cerevisiae YDR492W IZH1
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family transcription is regulated
           directly by Zap1p expression induced by zinc deficiency
           and fatty acids deletion increases sensitivity to
           elevated zinc
          Length = 314

 Score =  251 bits (640), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 126/276 (45%), Positives = 173/276 (62%), Gaps = 7/276 (2%)

Query: 2   STRKRSVVTEETALIEETPGTKKTVRVYERRVYSWDEIPDWQKDNEHILHGYVRETQSWK 61
           + R+R   T++ +   E+  T K      +R+ +++E+PDWQKDNE IL GYVRET+S  
Sbjct: 6   TVRQRRKTTQKAS--AESIATAKG----RKRLCTFEELPDWQKDNELILDGYVRETRSVS 59

Query: 62  ELFHSLFYLHNESVNIYTHLIPAVALFFIMLFATHHV-INEYPTTSAIDYFMINLFFFGC 120
           E F SL Y HNE+VNIYTHL+P V    +++F T  + I ++P+++  DY +IN F  G 
Sbjct: 60  ECFKSLLYFHNETVNIYTHLVPGVTYLLMLMFLTDFILIPKFPSSTMTDYIIINFFLLGA 119

Query: 121 ATCLTMSSMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYPFAG 180
             CL  SS FH +K HS   +   +K+DY+GI+VLIS SM+SIL+YGFHD    F  F  
Sbjct: 120 FVCLMCSSCFHCLKQHSEEHSDIWSKVDYMGIIVLISCSMVSILYYGFHDHLFHFKIFTV 179

Query: 181 LTSLFGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKRVQL 240
           +T + G  C    L D+F S+ +R +RA+ FV FG S + PI+ G + +G  E+  RVQL
Sbjct: 180 VTVILGSCCAAFVLNDRFNSKNFRVFRASFFVSFGFSGLVPIIFGLVKFGISESVHRVQL 239

Query: 241 TWVIWEGVLYIFGAFLYGVRFPERLAPGKFDIWGHS 276
            +V  E V YI GA  YG R PE   PGKFD+ GHS
Sbjct: 240 KYVGLEAVFYIGGAVFYGFRIPENFGPGKFDLVGHS 275

>YDR492W Chr4 (1434924..1435874) [951 bp, 316 aa] {ON}  IZH1Membrane
           protein involved in zinc ion homeostasis, member of the
           four-protein IZH family; transcription is regulated
           directly by Zap1p, expression induced by zinc deficiency
           and fatty acids; deletion increases sensitivity to
           elevated zinc
          Length = 316

 Score =  242 bits (617), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 125/280 (44%), Positives = 179/280 (63%), Gaps = 5/280 (1%)

Query: 2   STRKR---SVVTEET-ALIEETPGTKKTVRVYERRVYSWDEIPDWQKDNEHILHGYVRET 57
           +TR+R   SV  + T A I+    + +TV   ++ ++++DE+P+WQKDN+ IL GYVRET
Sbjct: 5   TTRRRNQDSVCCKATRASIKVEAVSGQTVFEKQKLLHNFDELPEWQKDNDKILTGYVRET 64

Query: 58  QSWKELFHSLFYLHNESVNIYTHLIPAVALF-FIMLFATHHVINEYPTTSAIDYFMINLF 116
            SWK+  +SLFY +NE+VNIYTHL+PA+  F F +    + +I  +P+TS  DY +IN+F
Sbjct: 65  LSWKKCLYSLFYWNNETVNIYTHLVPAIVYFVFAITLTNYFLIPVFPSTSWSDYTVINIF 124

Query: 117 FFGCATCLTMSSMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFY 176
             G  +CL  SS FH +K HS   + F +KLDYLGI+ LIS SMI I+++G+ D    F 
Sbjct: 125 LMGAFSCLMCSSCFHCMKQHSEKQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHISYFS 184

Query: 177 PFAGLTSLFGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWK 236
            F  +T +    C    L DKF +  +RP+RA  F+LFG S + P+  GF  +G      
Sbjct: 185 LFTIVTLVLATFCTVCVLHDKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGVLN 244

Query: 237 RVQLTWVIWEGVLYIFGAFLYGVRFPERLAPGKFDIWGHS 276
           R+++++V WE + YI GA +YG R PE LAPGKFD +G S
Sbjct: 245 RIKVSFVFWEALFYISGAVIYGFRIPETLAPGKFDFFGSS 284

>KLTH0C09504g Chr3 complement(788442..789401) [960 bp, 319 aa] {ON}
           similar to uniprot|Q6Q557 Saccharomyces cerevisiae
           YDR492W IZH1 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family
           transcription is regulated directly by Zap1p expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 319

 Score =  241 bits (616), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 121/267 (45%), Positives = 162/267 (60%), Gaps = 1/267 (0%)

Query: 11  EETALIEETPGTKKTVRVYERRVYSWDEIPDWQKDNEHILHGYVRETQSWKELFHSLFYL 70
           ++ A  +   GT       +  +  ++E+PDWQ+DN+ IL GYVRET S K+ F SL Y 
Sbjct: 12  QQCAPNKGKAGTSGATAPGKNGLCCFEELPDWQRDNDKILAGYVRETNSMKKCFESLTYF 71

Query: 71  HNESVNIYTHLIPA-VALFFIMLFATHHVINEYPTTSAIDYFMINLFFFGCATCLTMSSM 129
           HNE+VNIYTHLIP+   L  +M F    +I ++PTT+  DY MIN F  G   CL  S+ 
Sbjct: 72  HNETVNIYTHLIPSGTYLVMLMFFTDLFLIPQFPTTTMSDYIMINFFLLGAFLCLMCSTC 131

Query: 130 FHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYPFAGLTSLFGLIC 189
           FH +K HS   +   +K+DY+GI+VLIS S +S+L+YGF+D    F  F     + G  C
Sbjct: 132 FHCLKQHSEAQSNIWSKVDYMGIIVLISCSTVSLLYYGFYDYLFHFKMFTIAVVVLGSCC 191

Query: 190 GYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKRVQLTWVIWEGVL 249
               L D+F ++ WR  RA  FV FG S + PIV G + +G  E+ KRVQL +V+ E + 
Sbjct: 192 AAFVLNDRFNAKNWRACRAGFFVTFGFSGIVPIVVGLVKFGIAESSKRVQLRFVLLEALF 251

Query: 250 YIFGAFLYGVRFPERLAPGKFDIWGHS 276
           YI GA +YG R PE L PGKFD  GHS
Sbjct: 252 YISGAVIYGFRIPETLLPGKFDFVGHS 278

>Skud_4.766 Chr4 (1354630..1355580) [951 bp, 316 aa] {ON} YDR492W
           (REAL)
          Length = 316

 Score =  241 bits (615), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 122/280 (43%), Positives = 173/280 (61%), Gaps = 5/280 (1%)

Query: 2   STRKRS----VVTEETALIEETPGTKKTVRVYERRVYSWDEIPDWQKDNEHILHGYVRET 57
           +TR+R+         TA I+      KT    E+ ++++DE+P+WQKDN+ IL GYVRET
Sbjct: 5   TTRRRNQESVCCKATTASIKVEAVQSKTASEKEKLLHNFDELPEWQKDNDKILTGYVRET 64

Query: 58  QSWKELFHSLFYLHNESVNIYTHLIPAVALF-FIMLFATHHVINEYPTTSAIDYFMINLF 116
            SWK+   SLFY +NE+VNIYTHL+PA+  F F +    + +I  +P+TS  DY +IN+F
Sbjct: 65  LSWKKCLRSLFYWNNETVNIYTHLVPAIIYFLFAITLTNYFLIPVFPSTSWSDYTVINIF 124

Query: 117 FFGCATCLTMSSMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFY 176
             G  +CL  SS FH +K HS   + F +KLDYLGI+ LIS SMI I+++G+ D    F 
Sbjct: 125 LMGAFSCLMCSSCFHCLKQHSEEQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHVSYFS 184

Query: 177 PFAGLTSLFGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWK 236
            F  +T +    C    L +KF +  +RP+RA  F+LFG S + P+  GF  +G      
Sbjct: 185 LFTTVTLVLATFCTVCVLHEKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGVLN 244

Query: 237 RVQLTWVIWEGVLYIFGAFLYGVRFPERLAPGKFDIWGHS 276
           R+++++V WE + YI GA +YG R PE +APGKFD  G S
Sbjct: 245 RIKVSFVFWEALFYISGAVIYGFRIPETIAPGKFDFLGSS 284

>CAGL0G04631g Chr7 (441149..442099) [951 bp, 316 aa] {ON} similar to
           uniprot|Q03419 Saccharomyces cerevisiae YDR492w
          Length = 316

 Score =  240 bits (612), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 125/278 (44%), Positives = 169/278 (60%), Gaps = 5/278 (1%)

Query: 30  ERRVYSWDEIPDWQKDNEHILHGYVRETQSWKELFHSLFYLHNESVNIYTHLIPAVALFF 89
           E+ ++ ++E+P+WQKDN+ IL GYVRET S+K    SL YL+NESVNIYTHLIPAV  F+
Sbjct: 35  EKLLWHFNELPEWQKDNDKILRGYVRETNSFKRCLQSLLYLNNESVNIYTHLIPAV--FY 92

Query: 90  IML---FATHHVINEYPTTSAIDYFMINLFFFGCATCLTMSSMFHTIKCHSLPIATFGNK 146
           I L    A   +I  YP+TS++DY +IN+FF G   CL  SS FH +K HS       +K
Sbjct: 93  ISLSLYLANVFLIPVYPSTSSVDYVIINVFFLGAFFCLLCSSCFHCMKQHSESQCNVWSK 152

Query: 147 LDYLGIVVLISTSMISILFYGFHDSSLLFYPFAGLTSLFGLICGYMSLKDKFRSREWRPY 206
           LDYLGI+ LIS S + +++YG+ D    F  F G+T L  + C    L DKF + E+RP 
Sbjct: 153 LDYLGIICLISCSTVPMIYYGYFDHISEFTIFTGITLLLAIGCSVFVLTDKFNTTEYRPI 212

Query: 207 RATMFVLFGLSAVFPIVAGFIVYGKDETWKRVQLTWVIWEGVLYIFGAFLYGVRFPERLA 266
           RA+ F LFG S + P+ AGF+ +G +   +R+ L ++  E + YI GA +YG RFPE +A
Sbjct: 213 RASFFTLFGFSGIIPLGAGFLKFGAEGVLQRISLPFIGLEALFYISGAIIYGFRFPETIA 272

Query: 267 PGKFDIWGHSXXXXXXXXXXXXXXXXXXXXXSYGLVHQ 304
           PGKFD +G S                     SY L+H 
Sbjct: 273 PGKFDFFGSSHQIFHIMVVLGSICHLFAMVESYHLIHS 310

>Smik_4.769 Chr4 (1356263..1357213) [951 bp, 316 aa] {ON} YDR492W
           (REAL)
          Length = 316

 Score =  239 bits (611), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 124/283 (43%), Positives = 177/283 (62%), Gaps = 11/283 (3%)

Query: 2   STRKRSVVTEETALIEETPGTKK-------TVRVYERRVYSWDEIPDWQKDNEHILHGYV 54
           +TR+R+   +E+     T G+ K       TV   ++ ++++DE+P+WQKDN+ IL GYV
Sbjct: 5   TTRRRN---QESVCCSVTTGSIKVEAVSSTTVSEKKKLLHNFDELPEWQKDNDKILTGYV 61

Query: 55  RETQSWKELFHSLFYLHNESVNIYTHLIPAVALF-FIMLFATHHVINEYPTTSAIDYFMI 113
           RET SWK+  +SLFY +NE+VNIYTHL+PAV  F F +    + +I  +P+TS  DY +I
Sbjct: 62  RETLSWKKCLYSLFYWNNETVNIYTHLVPAVIYFVFAITLTNYFLIPVFPSTSWSDYTVI 121

Query: 114 NLFFFGCATCLTMSSMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSL 173
           N+F  G  +CL  SS FH +K HS   + F +KLDYLGI+ LIS SMI I+++G+ D   
Sbjct: 122 NIFLMGAFSCLMCSSCFHCMKQHSEKQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHIS 181

Query: 174 LFYPFAGLTSLFGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDE 233
            F  F  +T +    C    L +KF +  +RP+RA  F+LFG S + P+  GF  +G   
Sbjct: 182 YFSLFTIVTLVLATFCTVCVLHEKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQG 241

Query: 234 TWKRVQLTWVIWEGVLYIFGAFLYGVRFPERLAPGKFDIWGHS 276
              R+++++V WE + YI GA +YG R PE LAPGKFD  G S
Sbjct: 242 VLNRIKVSFVFWEALFYISGAVIYGFRIPETLAPGKFDFLGSS 284

>Suva_2.668 Chr2 (1186763..1187710) [948 bp, 315 aa] {ON} YDR492W
           (REAL)
          Length = 315

 Score =  236 bits (603), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 125/308 (40%), Positives = 180/308 (58%), Gaps = 6/308 (1%)

Query: 2   STRKRS----VVTEETALIEETPGTKKTVRVYERRVYSWDEIPDWQKDNEHILHGYVRET 57
           +TR+R+         T++  E   +K T+R  E+ ++ + E+PDWQ+DN+ IL GYVRET
Sbjct: 5   ATRRRNQENVCCKTSTSIKVEALKSKVTLR-KEKLLHDFHELPDWQRDNDKILTGYVRET 63

Query: 58  QSWKELFHSLFYLHNESVNIYTHLIPAVALF-FIMLFATHHVINEYPTTSAIDYFMINLF 116
            SWK+  +SLFY +NE+VNIYTHL+PA+  F F +    + +I  +P+T+  DY +IN+F
Sbjct: 64  LSWKKCLYSLFYWNNETVNIYTHLVPAIVYFVFGVTLTNYFLIPVFPSTTWSDYTVINIF 123

Query: 117 FFGCATCLTMSSMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFY 176
             G   CL  SS FH +K HS   + F +KLDYLGI+ LIS SMI I+++G+ D +  F 
Sbjct: 124 LMGAFLCLMCSSCFHCMKQHSEKQSDFWSKLDYLGIISLISCSMIPIIYFGYFDHASYFS 183

Query: 177 PFAGLTSLFGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWK 236
            F  +T +    C    L DKF +  +RP+RA  F+LFG S + P+  G   +G      
Sbjct: 184 LFTIVTLVLATFCTICVLHDKFNTSTFRPFRAMFFILFGFSGLLPLTTGLFKFGLQGVLN 243

Query: 237 RVQLTWVIWEGVLYIFGAFLYGVRFPERLAPGKFDIWGHSXXXXXXXXXXXXXXXXXXXX 296
           R+++++V WE + YI GA +YG R PE LAPGKFD +G S                    
Sbjct: 244 RIRVSFVFWEALFYISGALIYGFRIPETLAPGKFDFFGSSHQIFHIMVVLGSVCHLKAII 303

Query: 297 XSYGLVHQ 304
            SY L+H 
Sbjct: 304 DSYKLMHS 311

>Kwal_56.22704 s56 (244431..245393) [963 bp, 320 aa] {ON} YDR492W -
           Hypothetical ORF [contig 184] FULL
          Length = 320

 Score =  236 bits (603), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 117/274 (42%), Positives = 164/274 (59%), Gaps = 4/274 (1%)

Query: 4   RKRSVVTEETALIEETPGTKKTVRVYERRVYSWDEIPDWQKDNEHILHGYVRETQSWKEL 63
           ++RS    E   ++    +K   +  +  +  ++E+P+WQ+DNE IL GYVRET+S ++ 
Sbjct: 9   QRRSACKNE---LKNGKNSKSAEQTKKSALCRFEELPEWQRDNEKILAGYVRETRSMRKC 65

Query: 64  FHSLFYLHNESVNIYTHLIPA-VALFFIMLFATHHVINEYPTTSAIDYFMINLFFFGCAT 122
             SL Y HNE++NIYTHLIP+   L  +M F    +I  +P+T+  DY MIN +  G   
Sbjct: 66  LESLTYFHNETLNIYTHLIPSGTYLVLLMFFTDVFLIPHFPSTTMSDYIMINFYLLGAFL 125

Query: 123 CLTMSSMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYPFAGLT 182
           CL  S+ FH +K HS   +   +K+DY+GI+VLIS S +S+L+YGFHD    F  F    
Sbjct: 126 CLLCSTCFHCLKQHSEAQSNIWSKVDYMGIIVLISCSTVSLLYYGFHDYLFHFKIFTIAV 185

Query: 183 SLFGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKRVQLTW 242
            + G  C    L D+F ++ WR  RA  FV FG S + PI+ G + +G  E+ KRVQL +
Sbjct: 186 VVLGSCCAAFVLNDRFNAKNWRACRAGFFVTFGFSGIVPIIMGLVKFGVAESSKRVQLRF 245

Query: 243 VIWEGVLYIFGAFLYGVRFPERLAPGKFDIWGHS 276
           V+ E   YI GA +YG R PE L PGKFD  GHS
Sbjct: 246 VLLEAFFYIGGAIIYGFRIPETLIPGKFDFVGHS 279

>ZYRO0B06556g Chr2 (526478..527434) [957 bp, 318 aa] {ON} similar to
           uniprot|Q6Q557 Saccharomyces cerevisiae YDR492W IZH1
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family transcription is regulated
           directly by Zap1p expression induced by zinc deficiency
           and fatty acids deletion increases sensitivity to
           elevated zinc
          Length = 318

 Score =  231 bits (588), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 116/248 (46%), Positives = 159/248 (64%), Gaps = 1/248 (0%)

Query: 30  ERRVYSWDEIPDWQKDNEHILHGYVRETQSWKELFHSLFYLHNESVNIYTHLIPAVALFF 89
           E+ +Y + E+P+WQ+DN+ IL GY+RET+S  +   SLF  +NE+VNIYTHL+ AV+ F 
Sbjct: 29  EKTLYDFHELPEWQQDNDKILTGYIRETKSVLKCVRSLFIWNNETVNIYTHLVSAVSYFL 88

Query: 90  IMLFATHHV-INEYPTTSAIDYFMINLFFFGCATCLTMSSMFHTIKCHSLPIATFGNKLD 148
           +ML  T  V +  +PT++  DY +IN +  G   CL  SS FHT K HS P +   +K+D
Sbjct: 89  LMLGITDLVMVPHFPTSTFTDYSVINFYLLGAFGCLMCSSCFHTFKQHSGPHSDAWSKVD 148

Query: 149 YLGIVVLISTSMISILFYGFHDSSLLFYPFAGLTSLFGLICGYMSLKDKFRSREWRPYRA 208
           Y+GI+VLI+ SMIS+++YGF D    F  F  LT      C    L DKF  +++RP RA
Sbjct: 149 YMGIIVLITCSMISLIYYGFFDHMEYFRLFTVLTLTLATACTVCVLSDKFNHKDFRPLRA 208

Query: 209 TMFVLFGLSAVFPIVAGFIVYGKDETWKRVQLTWVIWEGVLYIFGAFLYGVRFPERLAPG 268
             F+ FGLS VFP+ AG I +G     +RVQL ++  E + YI GA +YG R PE + PG
Sbjct: 209 GFFIAFGLSGVFPVAAGIIKFGIQGGVQRVQLKYLGLEAIFYIAGALIYGFRIPETMFPG 268

Query: 269 KFDIWGHS 276
           +FD WGHS
Sbjct: 269 RFDFWGHS 276

>AFR337W Chr6 (1051645..1052598) [954 bp, 317 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR492W (IZH1) and
           YOL101C (IZH4)
          Length = 317

 Score =  229 bits (585), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 122/275 (44%), Positives = 166/275 (60%), Gaps = 7/275 (2%)

Query: 5   KRSVVTEETALIEET--PGTKKTVRVYERRVYSWDEIPDWQKDNEHILHGYVRETQSWKE 62
           K   ++E    +  T   G KK +R    ++Y++DE+P WQKDNE IL GYVRET S KE
Sbjct: 8   KEQTISEMAQEMAHTTSEGLKKRIR----KLYTFDELPAWQKDNELILSGYVRETNSVKE 63

Query: 63  LFHSLFYLHNESVNIYTHLIPAVA-LFFIMLFATHHVINEYPTTSAIDYFMINLFFFGCA 121
              ++ Y +NES+NIYTHLIP VA L   ++FA   +    P   A ++ M+  +  G  
Sbjct: 64  CLRAMTYFNNESINIYTHLIPGVAYLVLFLIFADLVLAQLLPGLDAGEHRMLRFYLLGAF 123

Query: 122 TCLTMSSMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYPFAGL 181
           TCL  SS FH +K HS P +   +K+DYLGI+  I+ S IS+L+YG+H     F  F+ L
Sbjct: 124 TCLACSSCFHCLKQHSEPHSRLWSKVDYLGILAQITCSTISLLYYGYHSYPSHFVFFSTL 183

Query: 182 TSLFGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKRVQLT 241
           T      C  + L D F +  +RP RA +F+ FGLS V P++AG   +G  E   R+QL 
Sbjct: 184 TVALCSACAVLVLNDSFNTVAFRPLRAFLFMAFGLSGVIPVLAGSYQFGFAEWAARIQLK 243

Query: 242 WVIWEGVLYIFGAFLYGVRFPERLAPGKFDIWGHS 276
           +V++E V YI GA +YG R PER APGKFD+ GHS
Sbjct: 244 YVLYEAVFYITGALVYGFRIPERFAPGKFDMVGHS 278

>Kpol_1053.26 s1053 complement(40099..41073) [975 bp, 324 aa] {ON}
           complement(40099..41073) [975 nt, 325 aa]
          Length = 324

 Score =  228 bits (581), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 114/242 (47%), Positives = 158/242 (65%), Gaps = 1/242 (0%)

Query: 36  WDEIPDWQKDNEHILHGYVRETQSWKELFHSLFYLHNESVNIYTHLIPAVALFFIMLFAT 95
           + E+PDWQKDNE IL GYVRET S K+   SL   +NES+NIY+HLI A++ F ++LF T
Sbjct: 44  FHELPDWQKDNEFILTGYVRETNSIKKCLRSLGCFNNESINIYSHLIAAISYFVVLLFYT 103

Query: 96  HHV-INEYPTTSAIDYFMINLFFFGCATCLTMSSMFHTIKCHSLPIATFGNKLDYLGIVV 154
             + I  +P+T+ +DY +I+L+  G  TCL  SS+FH +K HS   +   +K+DY+GI+ 
Sbjct: 104 DILCIPSFPSTTFVDYMVIDLYLLGAFTCLIGSSLFHCMKQHSESHSDMWSKVDYIGIIC 163

Query: 155 LISTSMISILFYGFHDSSLLFYPFAGLTSLFGLICGYMSLKDKFRSREWRPYRATMFVLF 214
           LI+ S+IS+L+YG+ D  + F  F  +T +   IC    L  +F S+ +RP RA  F+LF
Sbjct: 164 LITCSLISLLYYGYMDHFIYFKVFTVITLVLATICTICVLDQRFNSKNFRPIRAGFFILF 223

Query: 215 GLSAVFPIVAGFIVYGKDETWKRVQLTWVIWEGVLYIFGAFLYGVRFPERLAPGKFDIWG 274
            +SAV PI AGF  +G  E  +R+QL +V WE   Y+ GA LYG R PE L PG FD+ G
Sbjct: 224 SMSAVIPIGAGFSKFGFTEVLQRIQLRFVAWETFFYVVGALLYGFRIPETLYPGNFDLVG 283

Query: 275 HS 276
            S
Sbjct: 284 SS 285

>KLLA0C12441g Chr3 complement(1057427..1058374) [948 bp, 315 aa]
           {ON} similar to uniprot|Q6Q557 Saccharomyces cerevisiae
           YDR492W IZH1 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family
           transcription is regulated directly by Zap1p expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 315

 Score =  227 bits (579), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 120/277 (43%), Positives = 175/277 (63%), Gaps = 8/277 (2%)

Query: 2   STRKRSVVTEETALIEETP-GTKKTVRVYERRVYSWDEIPDWQKDNEHILHGYVRETQSW 60
           + R R  ++E+  L + TP     T++    R+Y + E+P+WQ+DN+ I+ GY+RET+S 
Sbjct: 6   TIRHRRSISEK--LEQLTPVAISSTIK----RLYRYSELPEWQQDNDKIITGYIRETKSV 59

Query: 61  KELFHSLFYLHNESVNIYTHLIPAVALFFIML-FATHHVINEYPTTSAIDYFMINLFFFG 119
           KE   SLF  HNES+NIY+HL+P +    +++  A   ++ ++P ++ +   MI+ F  G
Sbjct: 60  KECVKSLFLFHNESINIYSHLVPTITYLVLLVGLADMFLVPQFPNSTMMQSVMIHFFLLG 119

Query: 120 CATCLTMSSMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYPFA 179
              CL  SS FH +K HS       +K+DY+GI+++I+ S+IS+L+YGFHD    F  F 
Sbjct: 120 SVLCLGCSSFFHCLKQHSESHCHIWSKVDYMGIIIMITCSIISLLYYGFHDHIFHFKCFT 179

Query: 180 GLTSLFGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKRVQ 239
             T + G IC   +L DKF S+ +RP+RA  +V FGLS + PIV GF  +G  E  +RVQ
Sbjct: 180 VFTVILGTICTVFALHDKFNSKTFRPFRAMFYVTFGLSGIVPIVTGFWKFGAYEAIRRVQ 239

Query: 240 LTWVIWEGVLYIFGAFLYGVRFPERLAPGKFDIWGHS 276
           L +V+ E + YI GA +YG RFPE LAPGKFD  GHS
Sbjct: 240 LKYVLLEAMFYIAGAVIYGFRFPEVLAPGKFDFVGHS 276

>KAFR0A08130 Chr1 (1638153..1639112) [960 bp, 319 aa] {ON} Anc_3.90
           YOL101C
          Length = 319

 Score =  226 bits (577), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 113/279 (40%), Positives = 167/279 (59%), Gaps = 5/279 (1%)

Query: 3   TRKRSVVTEETALIEETPGTKKTVRVYERRVYSWDEIPDWQKDNEHILHGYVRETQSWKE 62
           TRKRS              +  ++++ +R +Y + E+P WQ+DN+ IL GYVRET S+ +
Sbjct: 9   TRKRSKSFRSAKSTITRTRSDSSIKIEKRILYHFHELPTWQQDNDKILGGYVRETNSFTK 68

Query: 63  LFHSLFYLHNESVNIYTHLIPA-----VALFFIMLFATHHVINEYPTTSAIDYFMINLFF 117
              SLFYL+NES+NIY+HLIP+     +A+  ++       I  YPTT+  D+  IN+F 
Sbjct: 69  CIESLFYLNNESINIYSHLIPSLIYLTIAVMLLIEIDQFLNIPIYPTTTKYDFIFINIFL 128

Query: 118 FGCATCLTMSSMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYP 177
            G   CL  S  FH +K HS     F +++DY+GI+VLIS SM+ +L+YGF D  +LFY 
Sbjct: 129 VGAFLCLLGSGCFHLLKQHSELQCNFWSRIDYMGIIVLISCSMMPVLYYGFFDHIVLFYC 188

Query: 178 FAGLTSLFGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKR 237
           F  LT  F  +C  + + + F   ++R  RA +F  FG S + P++ GF  +G    ++R
Sbjct: 189 FITLTLAFASVCSIIVMSETFNLSKYRLLRACVFAAFGFSGLIPMIVGFSKFGLSGVFQR 248

Query: 238 VQLTWVIWEGVLYIFGAFLYGVRFPERLAPGKFDIWGHS 276
           + L ++ WE V Y+ GA LYG R PE + PGKFD++G S
Sbjct: 249 ISLKFIFWESVFYLVGATLYGFRIPESILPGKFDLFGSS 287

>TDEL0D05340 Chr4 (969608..970558) [951 bp, 316 aa] {ON} Anc_3.90
           YOL101C
          Length = 316

 Score =  226 bits (575), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 116/276 (42%), Positives = 166/276 (60%), Gaps = 6/276 (2%)

Query: 2   STRKRSVVTEETALIEETPGTKKTVRVYERRVYSWDEIPDWQKDNEHILHGYVRETQSWK 61
           + R+R    +ET    ++        +  +++Y ++E+P+WQ+DN+ IL GYVRET+S  
Sbjct: 6   TIRQRKTTVQETQKARDSKDG-----IMGKKLYHFNELPEWQQDNDKILTGYVRETKSVL 60

Query: 62  ELFHSLFYLHNESVNIYTHLIPAVALFFIMLFATH-HVINEYPTTSAIDYFMINLFFFGC 120
               SL Y +NESVNIYTHL+ AVA F ++LF T   +I  +P+T+  DY +IN +  G 
Sbjct: 61  RCLDSLSYWNNESVNIYTHLLSAVAYFVLLLFFTDILLIPSFPSTTMTDYIIINFYLLGA 120

Query: 121 ATCLTMSSMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYPFAG 180
             CL  SS FH  K HS   +   +K+DY+GI+ LIS S+IS+L+YG+ D    F  F+ 
Sbjct: 121 FVCLMCSSCFHCFKQHSNSQSDAWSKVDYMGIIGLISCSVISLLYYGYFDHVFYFKLFSV 180

Query: 181 LTSLFGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKRVQL 240
           +T +  + C    L D+F + + RP RA+ F+ F  S+V PI  G   +G  E + RVQL
Sbjct: 181 ITVVLAMACSVCVLSDRFNTSDMRPLRASFFITFAFSSVIPIATGMFKFGWTEVFHRVQL 240

Query: 241 TWVIWEGVLYIFGAFLYGVRFPERLAPGKFDIWGHS 276
            +V WE   Y+ GA LYG R PE +APGKFD  G S
Sbjct: 241 RFVGWEAFFYLSGALLYGYRIPETIAPGKFDFIGSS 276

>NCAS0I02570 Chr9 complement(480266..481210) [945 bp, 314 aa] {ON}
           Anc_3.90 YDR492W
          Length = 314

 Score =  217 bits (552), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 123/311 (39%), Positives = 184/311 (59%), Gaps = 7/311 (2%)

Query: 2   STRKRSVVTEETAL--IEETPGTKKTVRVYERRVYSWDEIPDWQKDNEHILHGYVRETQS 59
           +TR++    +  A+    +     KT R ++RR+++++E+P+WQ+DN+ IL GYVRET+S
Sbjct: 6   TTRRKPTKVQAVAVGSSNKHADGDKTKRNWKRRLFNFNELPEWQRDNDKILTGYVRETKS 65

Query: 60  WKELFHSLFYLHNESVNIYTHLIPAVALFFIMLFAT---HHVINEYPTTSAIDYFMINLF 116
           +K+   SL Y +NE++NIYTHLIPA  LF++ +  T   + V+  +PTTS +DYF+IN+F
Sbjct: 66  FKQCLQSLLYWNNETINIYTHLIPA--LFYLTISVTLINYVVVPHFPTTSIMDYFVINVF 123

Query: 117 FFGCATCLTMSSMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFY 176
             G   CL +SS FH +K HS    T  +KLDY+GI++LIS S+I ++++G+ D      
Sbjct: 124 LMGAFVCLILSSCFHCLKQHSSRQCTLWSKLDYMGIIILISCSLIPMIYFGYFDHLYYVN 183

Query: 177 PFAGLTSLFGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWK 236
            F  LT  F  +C    L +KF    +RP+RA +F+LF  S   PI+ GF ++G    ++
Sbjct: 184 FFIILTFSFATLCSICVLNEKFNVPHYRPFRAIVFMLFSFSGFIPILTGFYLFGFHGVFE 243

Query: 237 RVQLTWVIWEGVLYIFGAFLYGVRFPERLAPGKFDIWGHSXXXXXXXXXXXXXXXXXXXX 296
           RV L +V WE + YI GA LYG R PE   PG FD  G S                    
Sbjct: 244 RVALKFVAWEALFYITGATLYGFRIPECFKPGDFDFLGSSHQIFHILVVLGSICHFRAVI 303

Query: 297 XSYGLVHQALS 307
            SY L+H +++
Sbjct: 304 KSYILMHSSMN 314

>NDAI0A07160 Chr1 complement(1630482..1631474) [993 bp, 330 aa] {ON}
           Anc_3.90
          Length = 330

 Score =  216 bits (550), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 119/283 (42%), Positives = 172/283 (60%), Gaps = 7/283 (2%)

Query: 1   MSTRKRSV--VTEETALIEETPGTKKTVRVYERRVY--SWDEIPDWQKDNEHILHGYVRE 56
           + +R  SV  + E   L +     K      +R+++   +DE+P+WQKDN+ IL GYVRE
Sbjct: 17  LRSRSNSVGGIFETNHLEDNDTSQKPKTNRRKRKIHLSKFDELPEWQKDNDKILTGYVRE 76

Query: 57  TQSWKELFHSLFYLHNESVNIYTHLIPAVALFFIML---FATHHVINEYPTTSAIDYFMI 113
           T S+   F SLFYL+NE++NIYTHLIP++    + L   F     I ++PTTS IDY +I
Sbjct: 77  TNSFIHCFQSLFYLNNETINIYTHLIPSIIYLIVSLTFIFINFIAIPKFPTTSVIDYIVI 136

Query: 114 NLFFFGCATCLTMSSMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSL 173
           N+F  G  TCL +SS FH +K HS    T  +KLDY+GI++LIS S+I IL++G+ D   
Sbjct: 137 NIFILGAFTCLLLSSCFHCLKQHSFKQCTLWSKLDYIGIIILISCSIIPILYFGYFDRLS 196

Query: 174 LFYPFAGLTSLFGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDE 233
            F  F  LT  F ++C  + L +KF    +RP RA +F+LF  + + P++ GF ++G   
Sbjct: 197 YFKFFTILTFSFAIVCSIIVLNEKFDLPSYRPLRAGLFMLFSFTGLIPMITGFYIFGYKG 256

Query: 234 TWKRVQLTWVIWEGVLYIFGAFLYGVRFPERLAPGKFDIWGHS 276
             +R+ L +V+ E + YI G  LYG R PE   PG FD++G S
Sbjct: 257 VMERISLNFVLLEAIFYIIGTLLYGFRIPETFKPGNFDMFGSS 299

>TBLA0B02290 Chr2 complement(534472..535452) [981 bp, 326 aa] {ON}
           Anc_3.90 YOL101C
          Length = 326

 Score =  215 bits (547), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 103/252 (40%), Positives = 158/252 (62%), Gaps = 2/252 (0%)

Query: 27  RVYERRVYSWDEIPDWQKDNEHILHGYVRETQSWKELFHSLFYLHNESVNIYTHLIPAVA 86
           ++ +  +Y+++E+P WQ+DNE IL GY+RET SWK    SL + HNE++NIY+H I A  
Sbjct: 37  KITDTLLYTYEELPSWQQDNEMILTGYIRETNSWKLCLRSLTFFHNETINIYSHGISAAI 96

Query: 87  LFFIMLFATHHVI--NEYPTTSAIDYFMINLFFFGCATCLTMSSMFHTIKCHSLPIATFG 144
              +++F   ++I    +PTT+  DY +++++  G ATCLT+SS FH +K HS   +   
Sbjct: 97  YLLLLVFFFTNLIYLPSFPTTTLHDYLVLDIYLLGAATCLTLSSCFHCLKQHSQSQSDIW 156

Query: 145 NKLDYLGIVVLISTSMISILFYGFHDSSLLFYPFAGLTSLFGLICGYMSLKDKFRSREWR 204
           +K+DY+GI+ LI+ S IS+L++G+ D    F  FA  T +  + C      +KF +R+W+
Sbjct: 157 SKMDYIGIICLITCSTISLLYFGYRDHFNYFKFFAISTFILAITCTVFVTMEKFNTRDWK 216

Query: 205 PYRATMFVLFGLSAVFPIVAGFIVYGKDETWKRVQLTWVIWEGVLYIFGAFLYGVRFPER 264
             RA  F+ F  S + P++ G  ++G  E W+RVQL  +  E + Y+ GA LYG R PE 
Sbjct: 217 HVRALFFIAFAGSGLIPLITGINIFGFPEVWQRVQLPSLTLELICYVIGALLYGYRIPEV 276

Query: 265 LAPGKFDIWGHS 276
            APGKFD  G+S
Sbjct: 277 FAPGKFDNIGNS 288

>Ecym_3588 Chr3 (1117646..1118563) [918 bp, 305 aa] {ON} similar to
           Ashbya gossypii AFR337W
          Length = 305

 Score =  214 bits (544), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 115/257 (44%), Positives = 160/257 (62%), Gaps = 4/257 (1%)

Query: 21  GTKKTVRVYERRVYSWDEIPDWQKDNEHILHGYVRETQSWKELFHSLFYLHNESVNIYTH 80
           G KK    + RR+YS+DE+P+WQKDNE I  GYVRET S+ E   S+ Y +NESVNIYTH
Sbjct: 13  GHKKN---FNRRLYSFDELPEWQKDNELIRMGYVRETNSFLECLKSMTYFNNESVNIYTH 69

Query: 81  LIPAVALFFIMLFATHHVINE-YPTTSAIDYFMINLFFFGCATCLTMSSMFHTIKCHSLP 139
           L+P+V  F ++L     V+   +P T+  +Y MI+ + FG   CL  S+ FH +K HS  
Sbjct: 70  LVPSVTYFILLLLFVDLVVTPMFPGTTMREYIMIDFYLFGVFVCLMCSTCFHCLKQHSES 129

Query: 140 IATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYPFAGLTSLFGLICGYMSLKDKFR 199
                +K+DY+GI+V I++S++SIL+YGF+D        + LT   G+ C    L D+F 
Sbjct: 130 HNRIWSKVDYIGIIVQITSSIVSILYYGFYDHISHIKWLSVLTLTLGVCCVTFVLNDRFN 189

Query: 200 SREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKRVQLTWVIWEGVLYIFGAFLYGV 259
           + ++R  RA  F +FG S V P++ G   +G  E   R+QL +V+   + YIFGA +YG 
Sbjct: 190 AIDYRLLRAIFFTVFGFSGVVPVLIGIYQFGLIEWLARIQLKFVLAGTIFYIFGALIYGF 249

Query: 260 RFPERLAPGKFDIWGHS 276
           R PE LAPGKFD  GHS
Sbjct: 250 RIPEALAPGKFDFIGHS 266

>KNAG0K02160 Chr11 (436744..437715) [972 bp, 323 aa] {ON} Anc_3.90
           YOL101C
          Length = 323

 Score =  180 bits (456), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 111/318 (34%), Positives = 165/318 (51%), Gaps = 14/318 (4%)

Query: 4   RKRSVVTEETALIEET-----------PGTKKTVRVYER-RVYSWDEIPDWQKDNEHILH 51
           RKR+V   ETA+   T            GT       +R R+  ++E+P WQ+DN+ I  
Sbjct: 6   RKRAVSLGETAIETATVSRGSRGKLLVTGTSSGAPSGQRGRLCRYEELPAWQQDNDCIRT 65

Query: 52  GYVRETQSWKELFHSLFYLHNESVNIYTHLIPAVA-LFFIMLFATHHVINEYPTTSAIDY 110
           GYVRET S +    SL Y +NESVN+Y+HL+PAV  +    L  +   +  +PTT+  DY
Sbjct: 66  GYVRETLSVRRCLGSLLYWNNESVNMYSHLVPAVLYIAGATLALSQWGVPRFPTTTWSDY 125

Query: 111 FMINLFFFGCATCLTMSSMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHD 170
            +IN F  G   CL  SS+FH +K HS       +++DY+GI++LI+ S I ++++G+ D
Sbjct: 126 LIINTFLVGAGACLLCSSLFHCLKQHSERHCEAWSRMDYMGIILLIACSTIPMIYFGYFD 185

Query: 171 SSLLFYPFAGLTSLFGLIC-GYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVY 229
                  F  +T   G+ C G +    +F S  ++  RA  F+ F  + + P+  GF+ +
Sbjct: 186 YMGHCLLFTAVTVALGVACSGVVLFNKQFNSSSFKLVRAAFFIAFAFNGLIPMATGFVKF 245

Query: 230 GKDETWKRVQLTWVIWEGVLYIFGAFLYGVRFPERLAPGKFDIWGHSXXXXXXXXXXXXX 289
           G      R+ L +V +E V YI GA LYG R PE   PGK D+WG+S             
Sbjct: 246 GIPGVLDRISLKYVWFEAVFYIAGAMLYGFRVPEIWIPGKVDLWGNSHQMFHVMVVFGSL 305

Query: 290 XXXXXXXXSYGLVHQALS 307
                   SY L+H+ L+
Sbjct: 306 CHLKAVLESYSLMHRHLA 323

>TBLA0B08255 Chr2 (1973757..1974647) [891 bp, 296 aa] {ON}
          Length = 296

 Score =  138 bits (347), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 82/266 (30%), Positives = 137/266 (51%), Gaps = 29/266 (10%)

Query: 32  RVYSWDEIPDWQKDNEHILHGYVRETQSWKELFHSLFYLHNESVNIYTHLIPAVALFFIM 91
           ++ +++++PDWQKDN  I++ YVRET S  +   S+F  H+ES+NI+THLIPA      +
Sbjct: 7   QLCNFNDLPDWQKDNPLIVNYYVRETNSLFKSLCSIFLFHSESMNIFTHLIPA------L 60

Query: 92  LFATHHVINEYPTTSAIDYFMINLFFFGCATCLTMSSMFHTIKCHSLPIATFGNKLDYLG 151
           L+A     N   T   + Y ++  +      C  +SS+FH  KC S+    F  KLDY+G
Sbjct: 61  LYA-KFTYNAITTLEQVSYPIV-FYLISVIICFLLSSLFHLFKCTSVQSNEFWGKLDYVG 118

Query: 152 IVVLISTSMISILFYGFHDS--SLLFYPFAGLTSLFGLICGYMSLKDKFRSRE------- 202
           I +LI+ +++S+   GF++S  +++   F   TS        +++K   +  E       
Sbjct: 119 ISLLINATIVSMALLGFNESRYTIMKNTFVTQTSCLTAYVIILAIKSHPKQGENEDDNDG 178

Query: 203 ------------WRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKRVQLTWVIWEGVLY 250
                        +  RA +F   GLS + P++ G  +YG    + ++ +  VI   + Y
Sbjct: 179 TLSEDDDCCCDDHKGTRAKLFASLGLSGLIPVITGLYIYGPKVVYYKINIPMVIASVLCY 238

Query: 251 IFGAFLYGVRFPERLAPGKFDIWGHS 276
           I G  +Y  + PE+  PG+FD+ G S
Sbjct: 239 IVGTLIYVFKIPEKFYPGRFDLVGSS 264

>NCAS0C04920 Chr3 complement(1003692..1004672) [981 bp, 326 aa] {ON}
           Anc_3.90
          Length = 326

 Score =  117 bits (293), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 87/283 (30%), Positives = 140/283 (49%), Gaps = 10/283 (3%)

Query: 2   STRKRSVVTEETALIEETP-GTKKTVRVYERR---VYSWDEIPDWQKD--NEHILHGYVR 55
           ST K+   TE     + TP    K    + RR   +    E+P WQK   N  I++GYVR
Sbjct: 6   STTKKQTATEIQDADKLTPFNAPKYSVTFPRRPKVLPILKELPQWQKQYSNSKIINGYVR 65

Query: 56  ETQSWKELFHSLFYLHNESVNIYTHLIPAVALFFIMLFATH-HVINEYPTTSAIDYFMIN 114
           ET S  +  H++ Y +N++VNI  + + +   F ++LF T  ++I   P T+  DY M+N
Sbjct: 66  ETNSLIKCLHTVTYWNNQTVNIILNTVFSTVYFTLLLFFTDLYLIPSSPATTMSDYIMVN 125

Query: 115 LFFFGCATCLTMSSMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLL 174
            + FG      ++S+F+ ++ HSL       KL +L  +  ISTS+I+ L+Y F D+   
Sbjct: 126 FYLFGAFQYFALNSIFYLLESHSLAKCHLWFKLSHLAFINYISTSIITQLYYTFFDNVFY 185

Query: 175 FYPFAGLTSLFGLICGYMSLKDKFRSREWRPYRATMFVLFGLS-AVFPIVAGFIVYGKDE 233
           F      T L   I    +L ++F  R+ R  R  + + F +S  + P  +    +    
Sbjct: 186 FKFLTISTLLISSIFAIFTLSEQFL-RKNRSQRNMVSITFIVSLLILPTASLMFKFNTFR 244

Query: 234 TWKRVQLTWVIWEGVLYIFGAFLYGVRFPERLAPGKFDIWGHS 276
             +RV+   ++ E  LY+F   L  V+ PER +   FD  G+S
Sbjct: 245 ILRRVEGKAILLELSLYLFSMTLKAVQVPERFSEN-FDFIGNS 286

>NDAI0G04300 Chr7 (1035664..1036620) [957 bp, 318 aa] {ON} Anc_3.90
          Length = 318

 Score =  102 bits (255), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 74/297 (24%), Positives = 139/297 (46%), Gaps = 7/297 (2%)

Query: 17  EETPGTKK-TV--RVYERRVYSWDEIPDWQK--DNEHILHGYVRETQSWKELFHSLFYLH 71
           +  P +K+ TV  ++  R  Y   E+P+WQ+  ++  ++ G+++ET S+K+   S  Y H
Sbjct: 14  DNYPTSKRYTVISKLSTRNHYKLKELPEWQREFNSGKVITGFLKETNSFKKCLWSTMYWH 73

Query: 72  NESVNIYTHLIPAVALFFIMLFATH-HVINEYPTTSAIDYFMINLFFFGCATCLTMSSMF 130
           N S+NI  + I A   F ++ F T  ++I  +P+T+  DY ++NL+         + ++F
Sbjct: 74  NSSINISLNGIAATVYFMLLFFFTDCYLIPSFPSTTMSDYIVLNLYLLTATQNFMVGTIF 133

Query: 131 HTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYPFAGLTSLFGLICG 190
           + +K HS   A    KL+ +G++  I++S++++L+Y + D    F  F  +T L   +  
Sbjct: 134 YIMKSHSKQQAFLWYKLNNIGLINHIASSVVTLLYYHYFDYVFYFKFFTIVTLLLITLFT 193

Query: 191 YMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKRVQLTWVIWEGVLY 250
              + D F           +     L  + P +   + +G  +  +R+ L  +I E  +Y
Sbjct: 194 CSIISDSFNKMTRIRKNFLLLAYIILLTLMPSLFAILRFGLAKVLERISLNLIILEIFIY 253

Query: 251 IFGAFLYGVRFPERLAPGKFDIWGHSXXXXXXXXXXXXXXXXXXXXXSYGLVHQALS 307
            FG  +   + PER     FD  G+S                     SY L+H  ++
Sbjct: 254 AFGLTIRTSQLPERFF-NSFDFLGNSENVYQLSIIVCSFIHFKILMNSYCLMHSGVN 309

>CAGL0I07491g Chr9 complement(719539..720444) [906 bp, 301 aa] {ON}
           similar to uniprot|Q03419 Saccharomyces cerevisiae
           YDR492w
          Length = 301

 Score = 95.5 bits (236), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 71/248 (28%), Positives = 122/248 (49%), Gaps = 14/248 (5%)

Query: 23  KKTVRVYERRVYSWDEIPDWQK--DNEHILHGYVRETQ-SWKELFHSLFYLHNESVNIYT 79
           KKTV   + ++ + +++P W +   N  I  GY   T  ++      L   +N+S++IY 
Sbjct: 3   KKTV---QSKIVTLEKLPVWYRRYGNSRIKTGYFYYTNATYLGCLQKLVKFNNDSISIYM 59

Query: 80  HLIPAVALFFIMLFATH-HVINEYPTTSAIDYFMINLFFFGCATCLTMSSMFHTIKCHSL 138
           +L+  +    ++LF T   +I  +P+T+  DY +INLF     T     ++   +K HS 
Sbjct: 60  NLVCGLISGVMLLFYTDVRLIPSHPSTTMTDYIIINLFLMATTTYFATMTLGQLLKGHSE 119

Query: 139 PIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYPFAGLTSLFGLICGYMSLKDKF 198
                 N+   L +V+L++ S++++L+Y F D   LF  F   T L   I   + + D++
Sbjct: 120 YQGKLWNQAKQLALVLLLTCSIVTLLYYAFFDHVFLFKLFVIWTCLLMSITSIVIINDQY 179

Query: 199 RSREWRPYRATMFVLFG-LSAVFPIVAGFIVYGKDETWK--RVQLTWVIWEGVLYIFGAF 255
           +    R  + +  V+FG LS   PI    I +G  +++K  R+    + WE VLY   A 
Sbjct: 180 K----RVQKLSCVVIFGVLSISLPIAVSIIKFGLFDSYKKQRIPFQVLTWEIVLYSLSAM 235

Query: 256 LYGVRFPE 263
           L   R PE
Sbjct: 236 LQLTRLPE 243

>KAFR0J00670 Chr10 (120378..121907) [1530 bp, 509 aa] {ON} Anc_5.197
           YLR023C
          Length = 509

 Score = 77.8 bits (190), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 65/270 (24%), Positives = 129/270 (47%), Gaps = 13/270 (4%)

Query: 2   STRKRSVVTEETALIEETPGTKKTVRVYERRVYSWDEIPDWQKDNEHILHGYVRETQSWK 61
           +T++  + +E+   + +  G  +   + +     + ++P   ++N +I++ Y R   S K
Sbjct: 161 TTKEAKLSSEQIKSLIKIFGYDRAYELGKSEHLHYYQLPFPYRENRYIINNY-RFYDSHK 219

Query: 62  ELFHSLFYLHNESVNIYTHLIPAVALFFIMLFATHHVI----NEYPTTSAIDYFMINLFF 117
           +   S+F LHNE+ NI++HL+ A+   +++     + I    +  PTT+ +    + LF 
Sbjct: 220 KSLLSIFKLHNEATNIWSHLLGAIYFLYVLFHDLPNSIIVSSSMVPTTAKL---FLYLFV 276

Query: 118 FGCATCLTMSSMFHTIKCHS-LPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFY 176
           F    C+  S+ +HT    S L +      +DY GI +LI++S++SI F   +D   +  
Sbjct: 277 FASLKCMLSSTFYHTFNGTSMLKLRRKFMCVDYSGISILITSSILSIQFISLYDYPNILK 336

Query: 177 PFAGLTSLFGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWK 236
            +   + + G++  +M+    F S E RP R   F+L      F ++   +V+ +   + 
Sbjct: 337 FYMCASFMLGVLGIFMNWSPLFDSPEARPLRIKFFILLSSCGAFALLH--LVFLEKSIFA 394

Query: 237 RVQLTWVIWEG--VLYIFGAFLYGVRFPER 264
            + +   +     V Y+ G   YG   PER
Sbjct: 395 AIDVLLPLTNKSIVWYLVGVVFYGSFIPER 424

>Suva_15.64 Chr15 complement(100035..100973) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 75.1 bits (183), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 67/246 (27%), Positives = 115/246 (46%), Gaps = 12/246 (4%)

Query: 72  NESVNIYTHLIPAVALFFIMLFATH-HVINEYPTTSAI-DYFMINLFFFGCATCLTMSSM 129
           +ES+    +L+ +++ F +++F T  ++I  +PTT+ + DY + N +         +  +
Sbjct: 62  SESLVALIYLLGSMSSFCLLIFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFVFCMIHFI 121

Query: 130 FHTIKCHSLPI-ATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYPFAGLTSLFGLI 188
           +H IK  SL        K  YL  + L+ +S I+IL+Y F+D    F  F  L +  GL 
Sbjct: 122 YHFIKNISLQQHIEIWQKFSYLANINLLISSQITILYYLFYDYVFFFKIFTLLMTFIGLA 181

Query: 189 CGYMSLKDKFRSREWRPYRATMFVLFGLSAV---FPIVAGFIVYGKDETWK-RVQLTWVI 244
             ++ L DK  S  ++ +  T+F +  +S V    P++   I +   E  K R++L  + 
Sbjct: 182 AYFVILTDKLNS--YKRFNKTVFFI-SVSVVCCSLPLLTAIITFDGLENLKDRIKLNAIT 238

Query: 245 WEGVLYIFGAFLYGVRFPERLA--PGKFDIWGHSXXXXXXXXXXXXXXXXXXXXXSYGLV 302
           WE V  +  + +Y  RFPE L     K + W HS                     SY L+
Sbjct: 239 WELVTLVVASMIYVTRFPESLCRRNEKEEGWNHSEYFFHLLISGTAFYHFFILIQSYILM 298

Query: 303 HQALSQ 308
           H +L+Q
Sbjct: 299 HSSLNQ 304

>KLLA0F15510g Chr6 (1433494..1435362) [1869 bp, 622 aa] {ON} some
           similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 622

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 74/280 (26%), Positives = 123/280 (43%), Gaps = 45/280 (16%)

Query: 16  IEETPGTKKTVRVYE---------RRVYSWDEIPDWQKDNEHILHGYVRETQSWKELFHS 66
           IE+    KKT++ Y          +R   + E+P   ++N +I+HGY       K +   
Sbjct: 272 IEDPHSIKKTIQFYNWDNACDLGRQRHLHFYELPFPWRENRYIIHGYRFYDSHVKSVLSV 331

Query: 67  LFYL--HNESVNIYTHLIPAVALFFIMLFATHHVINEYPTTSAI--------DYFMINLF 116
           + +   HNE++NI++HL  AV L +++         + PTT              +I +F
Sbjct: 332 VNWYGWHNETLNIWSHLFGAVYLAYLLFI-------QLPTTKVFMSQDVPLFGKLIIQVF 384

Query: 117 FFGCATCLTMSSMFHTIK--CHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHD---- 170
                 CL  SS++HT+   C  LP+      +DY GI VLI+ S++S  F   ++    
Sbjct: 385 LIAGVKCLLSSSVWHTLNGTC-CLPLRCKFACIDYTGITVLITASILSTEFVSVYNLATQ 443

Query: 171 ---SSLLFYPFAGLTSLFGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFI 227
              +S+  Y    L+   G+   +M+   +F   E RP+R   +VL     +   +   I
Sbjct: 444 SLSTSMTVY--MSLSLCLGIFGSFMNWSPRFDRPESRPFRIAFYVLLAGLGMISFLHLTI 501

Query: 228 VYGKDETWKRVQLTW---VIWEGVLYIFGAFLYGVRFPER 264
             G D + +  +  W   +IW    Y+ G   YG   PER
Sbjct: 502 SRGIDHSSQFFKPVWNRSLIW----YLIGVVFYGSFIPER 537

>Kpol_2002.94 s2002 (229517..231250) [1734 bp, 577 aa] {ON}
           (229517..231250) [1734 nt, 578 aa]
          Length = 577

 Score = 75.1 bits (183), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 65/234 (27%), Positives = 113/234 (48%), Gaps = 11/234 (4%)

Query: 38  EIPDWQKDNEHILHGYVRETQSWKELFHSLFY---LHNESVNIYTHLIPAVALFFIMLFA 94
           ++P   ++N +I++GY R      +L  S+F     HNE+ NI++HL+ A+   +I+LF 
Sbjct: 255 QLPFPWRENRYIINGY-RFYHKNSKLLLSVFNWYGFHNETANIWSHLLGAIYFAYIVLFE 313

Query: 95  -THHVINEYPTTSAIDYFMINLFFFGCATCLTMSSMFHTIK--CHSLPIATFGNKLDYLG 151
                I + P       +++ LF      C+  S  +HT    C S+ +      +DY G
Sbjct: 314 FPKSFIVQSPEVPPSAKYIVYLFLLAGIKCMLASVFWHTFNGTC-SIKLRPKYCCVDYSG 372

Query: 152 IVVLISTSMISILFYGFHDSSLLFYPFAGLTSLFGLICGYMSLKDKFRSREWRPYRATMF 211
           I +LI+ S+++  F   +D   +   +  L+ LFG    Y++   KF S E RP R   F
Sbjct: 373 ITILITASILTAEFVSLYDHRSIMTVYMSLSLLFGCFGLYLNWSPKFDSPEARPLRIKFF 432

Query: 212 VLFGLSAVFPIVAGFIVYGKDETWKRVQLTWVIWEGVL-YIFGAFLYGVRFPER 264
           +L  L+A+  +    + Y +   +     + V  + ++ Y+ G F YG   PER
Sbjct: 433 IL--LAALGGLAFFHVAYLEGMAYAAWLYSPVTSKSIVWYLIGVFFYGSFIPER 484

>TPHA0E03120 Chr5 complement(654079..655788) [1710 bp, 569 aa] {ON}
           Anc_5.197 YLR023C
          Length = 569

 Score = 74.7 bits (182), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 69/244 (28%), Positives = 112/244 (45%), Gaps = 30/244 (12%)

Query: 38  EIPDWQKDNEHILHGYVRETQSWKELFHSLFY---LHNESVNIYTHLIPAVALFFIML-- 92
           E+P   ++N++I+HGY R    + +L  S+F    +HNE+ NI+TH++ A  L +++   
Sbjct: 248 ELPFPWRENKYIIHGY-RFHDKFYQLILSVFNWYGVHNETTNIWTHMLAAFYLIYLLTVD 306

Query: 93  FATHHVINEYPTTSAIDYFMINLFFFGCATCLTMSSMFHTIK-CHSLPIATFGNKLDYLG 151
           F    ++ +     A   ++I +F      C+  S  +HT     S+ +      +DY G
Sbjct: 307 FQKTFIVLDTEHVPATTKYIIYMFLGAGIKCMFASVFWHTFNGTTSIRLRPKFCCVDYTG 366

Query: 152 IVVLISTSMIS---ILFYGFHDSSLLFYPFAGLTSLFGLICGYMSLKDKFRSREWRPYRA 208
           I +LIS S++S   I  Y +  +   +   +G+ ++FGL   Y++   KF S E RP R 
Sbjct: 367 ITLLISASIMSAEYITLYDYPKAMSFYMILSGIFAVFGL---YLNWSPKFDSPEARPLRI 423

Query: 209 TMFVLFGLSAVFPIVAGFIVYGKDETWKRVQLTWVIW--------EGVLYIFGAFLYGVR 260
             FVL         V    + G         L+  IW          + YI G F YG  
Sbjct: 424 KFFVLLAAVGGLSFVNLVCLEG---------LSRAIWLFSPVTNKSVIYYIIGVFFYGSF 474

Query: 261 FPER 264
            PER
Sbjct: 475 IPER 478

>Smik_15.56 Chr15 complement(90083..91021) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 72.8 bits (177), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 66/244 (27%), Positives = 110/244 (45%), Gaps = 8/244 (3%)

Query: 72  NESVNIYTHLIPAVALFFIMLFATH-HVINEYPTTSAI-DYFMINLFFFGCATCLTMSSM 129
           NESV    +L+ ++  F +++F T  ++I  +PTT+ + DY + N +         +  +
Sbjct: 62  NESVVALIYLLGSMLSFCLLIFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFVFCMVHFI 121

Query: 130 FHTIKCHSLPI-ATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYPFAGLTSLFGLI 188
           +H IK  SL        K  YL  + L+ +S I+IL+Y F+D    F  F  L +  GL+
Sbjct: 122 YHFIKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDYVFFFKIFTLLMNFIGLV 181

Query: 189 CGYMSLKDKFRSREWRPYRATMFVLFG-LSAVFPIVAGFIVYGKDETWK-RVQLTWVIWE 246
             +  L DK  S + R  +   F+    +    P++   I +   E  K R+++  + WE
Sbjct: 182 AYFFILTDKLISSK-RFNKTVFFISVSVICCSLPLLTAIITFDGLENLKERIKVNAITWE 240

Query: 247 GVLYIFGAFLYGVRFPERLAPGKF--DIWGHSXXXXXXXXXXXXXXXXXXXXXSYGLVHQ 304
            V  +  + +Y  RFPE    GK   + W HS                     SY L+H 
Sbjct: 241 LVALVAASIIYVTRFPELFLRGKKKEEGWNHSEYLFHLIISGAAFYHFFILIQSYILMHS 300

Query: 305 ALSQ 308
           +L+Q
Sbjct: 301 SLNQ 304

>YOL101C Chr15 complement(126982..127920) [939 bp, 312 aa] {ON}
           IZH4Membrane protein involved in zinc ion homeostasis,
           member of the four-protein IZH family, expression
           induced by fatty acids and altered zinc levels; deletion
           reduces sensitivity to excess zinc; possible role in
           sterol metabolism
          Length = 312

 Score = 71.6 bits (174), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 66/246 (26%), Positives = 113/246 (45%), Gaps = 12/246 (4%)

Query: 72  NESVNIYTHLIPAVALFFIMLFATH-HVINEYPTTSAI-DYFMINLFFFGCATCLTMSSM 129
           NES+    +L+ ++  F +++F T  ++I  +PTT+ + DY + N +         +  +
Sbjct: 62  NESLVALIYLLGSMLSFCLLIFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFVFCMVHFI 121

Query: 130 FHTIKCHSLPI-ATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYPFAGLTSLFGLI 188
           +H +K  SL        K  YL  + L+ +S I+IL+Y F+D    F  F  L +  GL+
Sbjct: 122 YHFVKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDYVFFFKIFTLLMNFIGLV 181

Query: 189 CGYMSLKDKFRSREWRPYRATMFVLFGLSAV---FPIVAGFIVYGKDETWK-RVQLTWVI 244
             +  L DK  S   + +  T+F +  +S V    P++   I +   E  K R+++  + 
Sbjct: 182 AYFFILTDKLISS--KRFNKTVFFI-SVSVVCCSLPLLTAIITFDGLENLKERIKVNAIT 238

Query: 245 WEGVLYIFGAFLYGVRFPERL--APGKFDIWGHSXXXXXXXXXXXXXXXXXXXXXSYGLV 302
           WE V  +  + +Y  RFPE L     K + W HS                     SY L+
Sbjct: 239 WELVALVAASIIYVTRFPESLFRRNKKEEGWNHSEYLFHLLISGTAFYHFFILIQSYILM 298

Query: 303 HQALSQ 308
           H +L+Q
Sbjct: 299 HSSLNQ 304

>NCAS0D02600 Chr4 (499689..501320) [1632 bp, 543 aa] {ON} Anc_5.197
           YLR023C
          Length = 543

 Score = 70.9 bits (172), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 74/281 (26%), Positives = 126/281 (44%), Gaps = 30/281 (10%)

Query: 5   KRSVVTEETALIEETPGTKKTVRVYERRV---------YSWDEIPDWQKDNEHILHGYVR 55
           K  VVTE   L + +   K  +  Y   V          ++ ++P   ++N +I++ Y R
Sbjct: 178 KLDVVTEYQPLTKPSEEVKNLICSYNHEVAYEIGKTEHLNYYQLPFPWRENRYIIYNY-R 236

Query: 56  ETQSWKELFHSLFYL---HNESVNIYTHLIPAVALFFIMLF----ATHHVINEYPTTSAI 108
              S K+   S+F     HNE+ NI+THLI  + L ++ ++    +   + ++ PTT+ +
Sbjct: 237 FYDSHKKSLLSIFNWYGWHNETSNIWTHLIGGLYLIYMAVYDFPRSEIFLSDKIPTTAKL 296

Query: 109 DYFMINLFFFGCATCLTMSSMFHTIK--CHSLPIATFGNKLDYLGIVVLISTSMISILFY 166
              ++ LF F    CL  S  +H+    C +L + +    +DY GI +LI+ S+++  F 
Sbjct: 297 ---IVYLFLFAAIKCLFASVFWHSFNGTC-TLKLRSKFACVDYSGISILITASILTTEFV 352

Query: 167 GFHDSSLLFYPFAGLTSLFGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIV-AG 225
             + S      +  ++   G+   +M+   KF   E RP R   FVL     V   +   
Sbjct: 353 TLYSSYRAMCVYMAISLSLGIFGVFMNWSPKFDRPEARPLRIKFFVLLASMGVLSFLHLT 412

Query: 226 FIVYGKDETWKRVQLT--WVIWEGVLYIFGAFLYGVRFPER 264
           F+   K  TW    +T   ++W    Y  G   YG   PER
Sbjct: 413 FLTDWKYATWLLAPVTNKSIVW----YCIGVVFYGSFIPER 449

>Ecym_7109 Chr7 complement(210829..212535) [1707 bp, 568 aa] {ON}
           similar to Ashbya gossypii AAL153C
          Length = 568

 Score = 70.9 bits (172), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 68/273 (24%), Positives = 122/273 (44%), Gaps = 28/273 (10%)

Query: 15  LIEETPGTKKTVRVYERRVYSWD--------------EIPDWQKDNEHILHGYVRETQSW 60
           L + T G   +V     + YSW               E+P   ++N +I++G+ R   S 
Sbjct: 207 LPDATDGDAVSVADGGDKSYSWAKSYMLGRARHLHYYELPQPWRENPYIIYGH-RFYHSH 265

Query: 61  KELFHSLFYL---HNESVNIYTHLIPAVALFFIML--FATHHVINEYPTTSAIDYFMINL 115
           K+   S+  +   HNE++NI++H+  A+ L +IML  F    V N       +    I +
Sbjct: 266 KKSLLSILNVYGWHNETINIWSHIAGAIILLYIMLRGFPNSDVFNS-TQVPKVAKGAIYV 324

Query: 116 FFFGCATCLTMSSMFHTIK--CHSLPIATFGNKLDYLGIVVLISTS-MISILFYGFHDSS 172
           F      C+  S M+HT    CH LP+ +  + +DY GI +LI+ S M +  F  +  + 
Sbjct: 325 FLLCGIKCMVSSVMWHTFSGTCH-LPLRSRFSCVDYTGITILITASVMTTEAFTLYRLAP 383

Query: 173 LLFYPFAGLTSLFGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKD 232
              Y + G++   G+   + +   +F   + R +R   +V+     +   V   +    D
Sbjct: 384 KAMYLYMGISLCLGVFAAFTNWSRRFDGPDSRIFRVAFYVILAGLGLISFV--HLTVHSD 441

Query: 233 ETWKRVQLTWVIWEGVL-YIFGAFLYGVRFPER 264
            +  R+ +T +I + ++ Y+ G   Y    PER
Sbjct: 442 WSSSRLMITPLINKSIVWYLIGVVFYATLVPER 474

>Skud_15.53 Chr15 complement(86339..87277) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 69.7 bits (169), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 66/246 (26%), Positives = 113/246 (45%), Gaps = 12/246 (4%)

Query: 72  NESVNIYTHLIPAVALFFIMLFATH-HVINEYPTTSAI-DYFMINLFFFGCATCLTMSSM 129
           NES+    +L+ +++ F +++F T  ++I  +PTT+ + DY + N +         +  +
Sbjct: 62  NESLVALIYLLGSMSSFCLLIFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFVFCMVHFV 121

Query: 130 FHTIKCHSLPI-ATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYPFAGLTSLFGLI 188
           +H IK  SL        K  YL  + L+ +S I+IL+Y F+D    F  F  L +  GL+
Sbjct: 122 YHFIKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDYVFFFKIFTLLMNFIGLV 181

Query: 189 CGYMSLKDKFRSREWRPYRATMFVLFGLSAV---FPIVAGFIVYGKDETWK-RVQLTWVI 244
             +  L DK  S   + +  T+F +  +S V    P++   I +   E  K R+++  + 
Sbjct: 182 AYFFILTDKLNSS--KRFNKTVFFI-SVSVVCCSLPLLTAIITFDGLENLKERIKVKAIT 238

Query: 245 WEGVLYIFGAFLYGVRFPERL--APGKFDIWGHSXXXXXXXXXXXXXXXXXXXXXSYGLV 302
            E V  +  + +Y  RFPE L     K + W HS                     SY L+
Sbjct: 239 CELVALVAASIIYVTRFPESLFRRNKKEESWNHSEYLFHLVISGTAFYHFFILIQSYILM 298

Query: 303 HQALSQ 308
           H +L+Q
Sbjct: 299 HSSLNQ 304

>Kwal_33.15122 s33 (968885..970585) [1701 bp, 566 aa] {ON} YLR023C -
           Hypothetical ORF [contig 94] FULL
          Length = 566

 Score = 69.7 bits (169), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 69/243 (28%), Positives = 107/243 (44%), Gaps = 24/243 (9%)

Query: 38  EIPDWQKDNEHILHGYVRETQSWKELFHSLFYL---HNESVNIYTHLIPAVALFFIMLFA 94
           E+P   ++N  I+HGY R   S+K+   S+F     HNE+VNI+THL  A+ L +++   
Sbjct: 239 ELPFPWRENRFIIHGY-RFYNSYKKSLLSIFNWYGWHNETVNIWTHLGGALYLAYLLFRG 297

Query: 95  -THHVINEYPTTSAIDYFMINLFFFGCATCLTMSSMFHTIK--CHSLPIATFGNKLDYLG 151
            +   + +          M  +F      C   S ++HT    CH L   +    +DY G
Sbjct: 298 FSQTAVYQSELVPTAAKCMAFVFLLSGLECFLFSVVWHTFNGICH-LQQRSNCACVDYTG 356

Query: 152 IVVLISTSMISILFYGFHDS-------SLLFYPFAGLTSLFGLICGYMSLKDKFRSREWR 204
           I +L++ S+++  F     +       SLLF  F   +S+ G+I  YM+   KF   E R
Sbjct: 357 ITILVTASILTTEFVTLSGAAEAPFTWSLLF--FTTTSSILGVIGVYMNWSPKFDRPESR 414

Query: 205 PYRATMFVLFGLSAVFPIVAGFIVY---GKDETWKRVQLTWVIWEGVLYIFGAFLYGVRF 261
           P R   ++L      F  +   I +      E  K V    + W    Y+ G   YG   
Sbjct: 415 PLRIAFYLLLASFGFFSYLHSRIFHTSISSSELIKPVLSKSLAW----YLIGVVFYGTFI 470

Query: 262 PER 264
           PER
Sbjct: 471 PER 473

>NDAI0I02330 Chr9 (532412..534148) [1737 bp, 578 aa] {ON} Anc_5.197
          Length = 578

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 65/238 (27%), Positives = 111/238 (46%), Gaps = 19/238 (7%)

Query: 38  EIPDWQKDNEHILHGYVRETQSWKELFHSLFYL---HNESVNIYTHLIPAVALFFIML-- 92
           ++P   ++N +I++ Y R   S K+   S+F     HNES NI+THL+ A+ L ++ +  
Sbjct: 254 QLPFPWRENRYIIYNY-RFYDSHKKSLLSIFNWYGWHNESSNIWTHLLGAIYLIYLSIYD 312

Query: 93  FATHHVIN--EYPTTSAIDYFMINLFFFGCATCLTMSSMFHTIKCHS-LPIATFGNKLDY 149
           F    +    + PTT+ +   ++ LF F    CL  S  +HT    S L + +    +DY
Sbjct: 313 FPNSEIFQSEKVPTTAKL---IVYLFLFAAIKCLLASVFWHTFNGTSFLKLRSKFACVDY 369

Query: 150 LGIVVLISTSMISILFYGFHDSSLLFYPFAGLTSLFGLICGYMSLKDKFRSREWRPYRAT 209
            GI +LI+ S+++  F   + S      +  ++   G+   +M+   KF   E RP R  
Sbjct: 370 SGITILITASILTTEFVTMYSSFFAMCIYMTISLSLGMFGVFMNWSPKFDRPEARPLRIK 429

Query: 210 MFVLFGLSAVFPIV-AGFIVYGKDETWKRVQLT--WVIWEGVLYIFGAFLYGVRFPER 264
            F+L     V   +   ++   +  TW    +T   ++W    Y+ G   YG   PER
Sbjct: 430 FFILLASMGVLSFLHLTYLTNLQYATWLLTPVTNKSIVW----YLVGVVFYGSFIPER 483

>KLTH0B03498g Chr2 complement(281148..282788) [1641 bp, 546 aa] {ON}
           some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 546

 Score = 68.6 bits (166), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 69/256 (26%), Positives = 112/256 (43%), Gaps = 24/256 (9%)

Query: 25  TVRVYERRVYSWDEIPDWQKDNEHILHGYVRETQSWKELFHSLFYL---HNESVNIYTHL 81
            +++ ++R   + E+P   ++N  I+HGY R   S+ +   S+F     HNE+VNI+THL
Sbjct: 206 ALQLGQQRHLHYYELPFPWRENRFIIHGY-RFYNSYSKSLLSIFNWYGWHNETVNIWTHL 264

Query: 82  IPAVALFFIMLFA-THHVINEYPTTSAIDYFMINLFFFGCATCLTMSSMFHTIK--CHSL 138
             A+   F++    +   + +         FM  +F      C   S ++HT    CH L
Sbjct: 265 CGALYFAFLIFKGFSQTTVYQSELVPTAAKFMAFVFLTAGLECFLFSVVWHTFNGICH-L 323

Query: 139 PIATFGNKLDYLGIVVLISTSMISILFYGFHDS-------SLLFYPFAGLTSLFGLICGY 191
              +    +DY GI VL++ S+++  F     S       SLLF  F G ++  G +  +
Sbjct: 324 KQRSNCACVDYTGITVLVTASILTTEFVTLSGSSDATFTWSLLF--FTGASAALGAVGVF 381

Query: 192 MSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFI---VYGKDETWKRVQLTWVIWEGV 248
           M+   KF   E RP R   ++L      F  +   +        +  K V +  + W   
Sbjct: 382 MNWSPKFDRPESRPLRIAFYLLLASFGFFSYLHSRLFNTAVDSSDLIKPVFMKSLAW--- 438

Query: 249 LYIFGAFLYGVRFPER 264
            YI G   YG   PER
Sbjct: 439 -YIIGVVFYGTFIPER 453

>KNAG0B05100 Chr2 (976101..977717) [1617 bp, 538 aa] {ON} Anc_5.197
           YLR023C
          Length = 538

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 107/237 (45%), Gaps = 17/237 (7%)

Query: 38  EIPDWQKDNEHILHGYVRETQSWKELFHSLFYL--HNESVNIYTHLIPAVALFFIMLFAT 95
           E+P   ++N +I+H Y     + K L  ++ +   HNE+ NI++H +     F+++  A 
Sbjct: 221 ELPFPWRENRYIIHNYRFYDSNVKSLLSAINWYGWHNETSNIWSHFL---GFFYVVYLAV 277

Query: 96  HH----VINEYPTTSAIDYFMINLFFFGCATCLTMSSMFHTIKCHS-LPIATFGNKLDYL 150
           +     V+ +     +   F++ +F F    CL  S+ +HT    + L +      +DY 
Sbjct: 278 YEFPQSVVFQSDRIPSSAKFVVYIFLFAAMKCLIASAFWHTFNGTAFLKMRRRFACVDYS 337

Query: 151 GIVVLISTSMISILFYGFHDSSLLFYPFAGLTSLFGLICGYMSLKDKFRSREWRPYRATM 210
           GI +LI+ S+++  F   +D   +   +  ++   G+I  +++   +F + E RP R   
Sbjct: 338 GISILITASILTAEFVTLNDHRPMMILYMTISLTLGIIGVFLNCSPQFDTPEARPLRIRF 397

Query: 211 FVLFGLSAVFPIVAGFIVYGKDETWK-RVQLTWVIWEG--VLYIFGAFLYGVRFPER 264
           F+L     V      FI     E+W   V L   I     V Y+ G   YG   PER
Sbjct: 398 FMLLAAMGVL----SFINASYLESWAYAVDLLSPITNKSIVWYLVGVVFYGSFIPER 450

>Skud_12.91 Chr12 complement(177334..178962) [1629 bp, 542 aa] {ON}
           YLR023C (REAL)
          Length = 542

 Score = 65.5 bits (158), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 65/276 (23%), Positives = 115/276 (41%), Gaps = 22/276 (7%)

Query: 5   KRSVVTEETALIEETPGTKKTVRVYER-RVYSWDE--------IPDWQKDNEHILHGYVR 55
           KR ++ EE   +  T   K  +  Y     YS  E        +P   ++N +I+HGY  
Sbjct: 179 KREILIEEP--LNPTTDIKSFINSYNHSEAYSLGESQHLHYYQLPFPWRENRYIIHGYRF 236

Query: 56  ETQSWKELFHSLFYL--HNESVNIYTHLIPAVALFFIMLFA-THHVINEYPTTSAIDYFM 112
                K L   + +   HNE+ NI++HL+ A+ + ++ ++      +   P       ++
Sbjct: 237 YNTHSKSLLSIINWYGWHNETSNIWSHLLGAMYIIYLAIYDFPQSEVWRNPNVPQQARWI 296

Query: 113 INLFFFGCATCLTMSSMFHTIKCHS-LPIATFGNKLDYLGIVVLISTSMISILFYGFHDS 171
           + +F      C+  S  +HT    S L + +    +DY GI +LI+ S+++  F   +  
Sbjct: 297 VFMFLAAALKCMLSSVFWHTFNGTSFLRLRSKFACVDYSGITILITASILTTEFVTMYSC 356

Query: 172 SLLFYPFAGLTSLFGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFI---V 228
                 + G++   G+I  +M+   +F   E RP R   F+L     V   +       +
Sbjct: 357 YWAMCTYMGISLALGVIGVFMNWSPRFDRPEARPLRIRFFILLATMGVLSFLHLIFLTDI 416

Query: 229 YGKDETWKRVQLTWVIWEGVLYIFGAFLYGVRFPER 264
           Y     +  V    V+W    Y+ G   YG   PER
Sbjct: 417 YYASRLFGPVTYKSVVW----YLVGVVFYGSFIPER 448

>Smik_12.86 Chr12 complement(172288..173916) [1629 bp, 542 aa] {ON}
           YLR023C (REAL)
          Length = 542

 Score = 65.5 bits (158), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 54/232 (23%), Positives = 106/232 (45%), Gaps = 7/232 (3%)

Query: 38  EIPDWQKDNEHILHGYVRETQSWKELFH--SLFYLHNESVNIYTHLIPAVALFFIMLFA- 94
           ++P   ++N +I+HGY       K L    + +  HNE+ NI++HL+ A+ L ++ ++  
Sbjct: 219 QLPFPWRENRYIIHGYRFYNTHSKSLLSIFNWYGWHNETSNIWSHLLGAMYLIYLAIYDF 278

Query: 95  THHVINEYPTTSAIDYFMINLFFFGCATCLTMSSMFHTIKCHS-LPIATFGNKLDYLGIV 153
               + + P       +++ +F      C+  S  +HT    S L + +    +DY GI 
Sbjct: 279 PQSEVWKNPKVPPQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLKLRSKFACVDYSGIT 338

Query: 154 VLISTSMISILFYGFHDSSLLFYPFAGLTSLFGLICGYMSLKDKFRSREWRPYRATMFVL 213
           +LI+ S+++  F   +        + G++   G+   +M+   +F   E RP R   F+L
Sbjct: 339 ILITASILTTEFVTMYSCYWAMCTYMGISLALGIFGVFMNWSPRFDRPEARPLRIRFFIL 398

Query: 214 FGLSAVFPIVAGFIVYGKDETWKRVQLTWVIWEGVL-YIFGAFLYGVRFPER 264
                V   +   +++  D  +     + V ++ V+ Y+ G   YG   PER
Sbjct: 399 LATMGVLSFL--HLIFLTDLRYAARLFSPVTYKSVVWYLVGVAFYGSFIPER 448

>ZYRO0B10538g Chr2 complement(830311..831906) [1596 bp, 531 aa] {ON}
           some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 531

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 114/238 (47%), Gaps = 19/238 (7%)

Query: 38  EIPDWQKDNEHILHGYVRETQSWKELFHSL---FYLHNESVNIYTHLIPAVALFFIMLFA 94
           ++P   ++N++I+HGY R   S K+ F S+   +  HNE+ NI+THL+  + L ++  + 
Sbjct: 209 QLPFPYRENKYIIHGY-RFYASHKKSFLSIINWYGWHNETSNIWTHLLGGLYLIYLAFYH 267

Query: 95  THH----VINEYPTTSAIDYFMINLFFFGCATCLTMSSMFHTIK-CHSLPIATFGNKLDY 149
             H    + +  P  +     ++ +F      C+  S  +HT    H L + +    +DY
Sbjct: 268 FPHSNIWLSDRVPKPAKC---IVAVFLAAAIKCMFASVFWHTFNGTHLLRLRSKFACVDY 324

Query: 150 LGIVVLISTSMISILFYGFHDS--SLLFYPFAGLTSLFGLICGYMSLKDKFRSREWRPYR 207
            GI +LI+ S++++ F   +D   SLLFY    L    G+I   M+   KF   E RP R
Sbjct: 325 TGITILITASILTVEFVTMYDYKISLLFYMICSLA--LGIIGVSMNWSPKFDRPEARPLR 382

Query: 208 ATMFVLFGLSAVFPIVAGFIVYGKDETWKRVQLTWVIWEGVL-YIFGAFLYGVRFPER 264
              F+L         +   +V+  +  +    LT +  + V+ Y+ G F YG   PER
Sbjct: 383 IKFFILLATVGCSSFIR--LVFLTNWRYAADLLTPLTNKSVVWYLIGVFFYGSFIPER 438

>YLR023C Chr12 complement(185498..187129) [1632 bp, 543 aa] {ON}
           IZH3Membrane protein involved in zinc ion homeostasis,
           member of the four-protein IZH family, expression
           induced by zinc deficiency; deletion reduces sensitivity
           to elevated zinc and shortens lag phase, overexpression
           reduces Zap1p activity
          Length = 543

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 67/279 (24%), Positives = 120/279 (43%), Gaps = 22/279 (7%)

Query: 4   RKRSVVTEETALIEE----TPGTKKTVRVYER-RVYSWDE--------IPDWQKDNEHIL 50
           RK  V TE   LIEE    T   K  +  Y   + YS  E        +P   ++N +I+
Sbjct: 175 RKSMVKTE--ILIEEPLNPTTDIKSFINSYNHGKAYSLGETQHLHYYQLPFPWRENRYII 232

Query: 51  HGYVRETQSWKELFH--SLFYLHNESVNIYTHLIPAVALFFIMLFA-THHVINEYPTTSA 107
           HGY       K L    + +  HNE+ NI++HL+ A+ + ++ ++      +        
Sbjct: 233 HGYRFYNTHSKSLLSIFNWYGWHNETSNIWSHLLGAIYIIYLAIYDFPQSEVWRNSQVPP 292

Query: 108 IDYFMINLFFFGCATCLTMSSMFHTIKCHS-LPIATFGNKLDYLGIVVLISTSMISILFY 166
              +++ +F      C+  S  +HT    S L + +    +DY GI +LI+ S+++  F 
Sbjct: 293 QARWIVFMFLAAALKCMLSSVFWHTFNGTSFLKLRSKFACVDYSGITILITASILTTEFV 352

Query: 167 GFHDSSLLFYPFAGLTSLFGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGF 226
             +      Y +  ++   G+   +M+   +F   E RP R   F+L     V   +   
Sbjct: 353 TMYSCYWAMYTYMSISLALGVFGVFMNWSPRFDRPEARPLRIRFFILLATMGVLSFL--H 410

Query: 227 IVYGKDETWKRVQLTWVIWEGVL-YIFGAFLYGVRFPER 264
           +++  D  +     + V ++ V+ Y+ G   YG   PER
Sbjct: 411 LIFLTDLHYAATLFSPVTYKSVVWYLVGVVFYGSFIPER 449

>Suva_10.104 Chr10 complement(191663..193288) [1626 bp, 541 aa] {ON}
           YLR023C (REAL)
          Length = 541

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 56/239 (23%), Positives = 104/239 (43%), Gaps = 21/239 (8%)

Query: 38  EIPDWQKDNEHILHGYVRETQSWKELFHSLFYL--HNESVNIYTHLIPAVALFFIMLFA- 94
           ++P   ++N +I+HGY      +K L   + +   HNE+ NI+THL+ A+ + ++ ++  
Sbjct: 219 QLPFPWRENRYIIHGYRFYNTHYKSLLSVINWYGWHNETSNIWTHLLGAMYIVYLAVYDF 278

Query: 95  THHVINEYPTTSAIDYFMINLFFFGCATCLTMSSMFHTIKCHS-LPIATFGNKLDYLGIV 153
            H  + + P       +++  F      C+  S  +HT    S L + +    +DY GI 
Sbjct: 279 PHSEVWQNPEVPQQARWIVFAFLAAALKCMLSSVFWHTFNGTSFLGLRSKFACVDYSGIT 338

Query: 154 VLISTSMISILFYGFHDSSLLFYPFAGLTSLFGLICGYMSLKDKFRSREWRPYRATMFVL 213
           +LI+ S+++  F   +        +  ++   G+   +M+   +F   E RP R   F+L
Sbjct: 339 ILITASILTTEFVTMYSCYWAMCTYMTISLALGVFGVFMNWSPRFDRPEARPLRIRFFIL 398

Query: 214 FGLSAVFPIVAGFIVYGKDETWKRVQLTWVIW--------EGVLYIFGAFLYGVRFPER 264
                V   +   +++  D       L + IW          V Y+ G   YG   PER
Sbjct: 399 LATMGVLSFL--HLIFLTD-------LHYAIWLFSPVTNKSVVWYLVGVVFYGSFIPER 448

>AAL153C Chr1 complement(75086..76345) [1260 bp, 419 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR023C
          Length = 419

 Score = 60.8 bits (146), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 65/264 (24%), Positives = 112/264 (42%), Gaps = 28/264 (10%)

Query: 17  EETP--GTKKTVRVYERRVYSWDEIPDWQKDNEHILHGYVRETQSWKELFHSL--FYLHN 72
           EE P    +   R   R ++ W E+P   ++N +I++G+       K L   L  +  HN
Sbjct: 87  EEQPLHWAESRARGLARHLHYW-ELPYAWRENRYIIYGHRFYHSHRKSLLSVLNAYGWHN 145

Query: 73  ESVNIYTHLIPAVALFFIMLFA-THHVINEYPTTSAIDYFMINLFFFGCATCLTMSSMFH 131
           E++NI++HL+ A  L +++ +      +        +  + I  F      C+  S  +H
Sbjct: 146 ETINIWSHLVGAAVLAYLLCWGWPRSDVYRAAQVPRLAKWAIGAFLACGVKCMASSVAWH 205

Query: 132 TIK--CHSLPIATFGNKLDYLGIVVLISTSM---ISILFYGFHDSSLLFYPFAGLTSLFG 186
           T    CH L + +    +DY GI +L++ S+   +++  YG   S  L Y +   +   G
Sbjct: 206 TFNGTCH-LKLRSRFVCVDYTGITLLVTASVVTTVAVTLYGL--SRPLMYAYMVASIGLG 262

Query: 187 LICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKRVQL------ 240
              G M+    F   E RP R  ++V  GL+A+   +  F+       W    L      
Sbjct: 263 TAAGVMNWSPHFDRPEARPLRIAVYV--GLAALG--LVSFVHVWMQVRWASAHLMAPLVY 318

Query: 241 TWVIWEGVLYIFGAFLYGVRFPER 264
             ++W G+    G   Y    PER
Sbjct: 319 KSLVWYGI----GVVFYATLVPER 338

>CAGL0D03322g Chr4 complement(340949..342586) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q07959 Saccharomyces cerevisiae
           YLR023c
          Length = 545

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 62/235 (26%), Positives = 100/235 (42%), Gaps = 13/235 (5%)

Query: 38  EIPDWQKDNEHILHGYVRETQSWKELFH--SLFYLHNESVNIYTHLIPAVALFFIML--F 93
           E+P   ++N  I++GY       K L    + +  HNE+ NI+THL+  + + ++M   F
Sbjct: 218 ELPFPWRENRCIINGYRFYNSHKKSLLSIVNWYGWHNETSNIWTHLLGGLYILYLMFYQF 277

Query: 94  ATHHVINEYPTTSAIDYFMINLFFFGCATCLTMSSMFHTIKCHSL-PIATFGNKLDYLGI 152
            +  V        A    +  +F    A CL  S  +HT    SL  +      +DY GI
Sbjct: 278 PSSEVFMSEQVPKAAK-LITYVFLIAAAKCLFSSVFWHTFNGTSLLRLRCKFACVDYSGI 336

Query: 153 VVLISTSMISILFYGFHDSSLLFYPFAGLTSLFGLICGYMSLKDKFRSREWRPYRATMFV 212
            +LI+ S+++  F   +        +  L++  G+   +M+   KF   E RP R   F+
Sbjct: 337 SILITASILTTEFVTMYQCPWAMVSYMALSTALGIFGVFMNWSPKFDRPEARPLRIKFFI 396

Query: 213 LFGLSAVFPIV-AGFIVYGKDETWKRVQLTW--VIWEGVLYIFGAFLYGVRFPER 264
           L     +   +   FI      TW    +T   V+W    Y+ G   YG   PER
Sbjct: 397 LLASMGILSFLHLTFITSLSHSTWLLSPITKKSVVW----YLVGVVFYGSFIPER 447

>TDEL0E04320 Chr5 complement(804655..806007) [1353 bp, 450 aa] {ON}
           Anc_5.197 YLR023C
          Length = 450

 Score = 58.5 bits (140), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 57/242 (23%), Positives = 107/242 (44%), Gaps = 27/242 (11%)

Query: 38  EIPDWQKDNEHILHGYVRETQSWKELFH--SLFYLHNESVNIYTHLIPAVALFFIMLFAT 95
           ++P   ++N  I+HGY      +K L    + +  HNE+ NI+THL  A+ + ++ ++  
Sbjct: 136 QLPFPWRENRFIIHGYRFYDSHYKSLLSIVNWYGWHNETANIWTHLGGALYVLWLAVY-- 193

Query: 96  HHVINEYPTTSA--------IDYFMINLFFFGCATCLTMSSMFHTIK--CHSLPIATFGN 145
                ++P TS         +   ++ +F      C+  S   HT    C  L + +   
Sbjct: 194 -----DFPRTSVWESEQVPMVAKCIVYVFLAAALKCMLASVFGHTFNGTC-CLALRSKFA 247

Query: 146 KLDYLGIVVLISTSMISILFYGFHDSSLLFYPFAGLTSLFGLICGYMSLKDKFRSREWRP 205
            +DY GI +LI+ S+++  F   ++       +  ++++ G+    M+   KF   E RP
Sbjct: 248 CVDYSGITMLITASILTTEFVTMYNYPWSLRFYLAVSTVLGIFGVIMNWSPKFDRPEARP 307

Query: 206 YRATMFVLF-GLSAVFPIVAGFIVYGKDETWKRVQLTW--VIWEGVLYIFGAFLYGVRFP 262
            R   F+L   +  +  +  G +   K  +W    +T   ++W    Y+ G   YG   P
Sbjct: 308 LRIKFFILLAAMGGLSFMQLGLLGGWKYASWLMAPVTHKSLVW----YLLGVAFYGSFVP 363

Query: 263 ER 264
           ER
Sbjct: 364 ER 365

>SAKL0G12980g Chr7 complement(1108751..1110442) [1692 bp, 563 aa]
           {ON} some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 563

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 68/252 (26%), Positives = 109/252 (43%), Gaps = 39/252 (15%)

Query: 38  EIPDWQKDNEHILHGYVRETQSWKELFHSLFYL--HNESVNIYTHLIPAVALFFIMLFAT 95
           E+P   ++N  I+HGY       K L   L +   HNE+ NI+THL  ++ + ++  +  
Sbjct: 236 ELPFPWRENRFIIHGYRFYHSHTKSLLSILNWYGWHNETTNIWTHLFGSLYIAYLAFY-- 293

Query: 96  HHVINEYPTTSA--------IDYFMINLFFFGCATCLTMSSMFHTIK--CHSLPIATFGN 145
                E+P +S            +M+ LF      CL  S  +HT    C  L + +   
Sbjct: 294 -----EFPQSSVYLSGDVPQFAKYMVYLFLGAGFKCLVSSVTWHTFNGTC-KLHLRSKFA 347

Query: 146 KLDYLGIVVLISTSMISILF---YGFHDS-------SLLFYPFAGLTSLFGLICGYMSLK 195
            +DY GI VLI+ S+++  F   YG  D+       SL+FY    ++S+      +M+  
Sbjct: 348 CMDYTGITVLITASIMTAEFVSLYGNGDNPNSPVTFSLIFY--MAVSSVLCCFGVFMNWS 405

Query: 196 DKFRSREWRPYRATMFVLF-GLSAVFPIVAGFIVYGKDETW--KRVQLTWVIWEGVLYIF 252
            +F   E RP R   ++L  G+  +  +    I      +W  + V    V W    Y+ 
Sbjct: 406 PRFDRPESRPLRIAFYLLLAGMGFLAFLHLTLITNFAHSSWLIRPVLDKSVCW----YLI 461

Query: 253 GAFLYGVRFPER 264
           G   YG   PER
Sbjct: 462 GVIFYGSFIPER 473

>TBLA0C06050 Chr3 (1468152..1469465) [1314 bp, 437 aa] {ON}
           Anc_5.197 YLR023C
          Length = 437

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 59/236 (25%), Positives = 100/236 (42%), Gaps = 15/236 (6%)

Query: 38  EIPDWQKDNEHILHGYVRETQSWKELFHSLFYL--HNESVNIYTHLIPAVALFFIMLFA- 94
           ++P   ++N +I+ GY     + K L   + Y   HNE++NI++HL   + L +I +F  
Sbjct: 118 QLPFPWRENRYIIKGYRFYDSNVKCLLSVVNYYGWHNETLNIWSHLGGFLTLLYIAVFVY 177

Query: 95  --THHVINEY-PTTSAIDYFMINLFFFGCATCLTMSSMFHTIK--CHSLPIATFGNKLDY 149
             T    +E  PTT+ +  F   +F      C+  S  +HT    C       F   +DY
Sbjct: 178 PNTEVYQSELIPTTAKMLLF---VFLIAGMKCMLASVFWHTFDGTCSYTLRPKFCC-VDY 233

Query: 150 LGIVVLISTSMISILFYGFHDSSLLFYPFAGLTSLFGLICGYMSLKDKFRSREWRPYRAT 209
            GI +LI+ S+++  +     + +  + +  L+   G    Y++   KF   E RP R  
Sbjct: 234 TGITILITASILTAEYVSLSHAPIWMFIYMSLSLALGTFGVYINWSPKFDGPEARPLRIK 293

Query: 210 MFVLFGLSAVFPIV-AGFIVYGKDETWKRVQLTWVIWEGVLYIFGAFLYGVRFPER 264
            FV          V   F    +   W    +  +    + Y+ G F YG   PE+
Sbjct: 294 FFVTLSAMGCLSFVHLIFTTSLRHACWLLAPI--ISKSTIWYVIGVFFYGSFIPEK 347

>KNAG0K00670 Chr11 complement(119419..120384) [966 bp, 321 aa] {ON} 
          Length = 321

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 28/126 (22%), Positives = 64/126 (50%), Gaps = 18/126 (14%)

Query: 86  ALFFIML--FATHHVINEYPTTSAIDYFMINLFF---FGCATCLTMSSMFHTIKCHSLPI 140
           A++F++L  F   +++  + +T+  DY ++N+F    F CA C       H ++C +   
Sbjct: 104 AVYFVLLVFFTDVYLVPRHVSTTMTDYVLLNVFLATAFQCAAC-------HMVQCFT--- 153

Query: 141 ATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYPFAGLTSLFGLICGYMSLKDKFRS 200
            T G+ L  + ++   + S +++L+Y ++D+   F   A  T+ + L+   +++     +
Sbjct: 154 TTAGSVLSTITMLNHWACSAVTLLYYSYYDNVFYFKLLALFTANWTLVVAAVTVTSTASN 213

Query: 201 ---REW 203
              R+W
Sbjct: 214 SPKRQW 219

>TPHA0A04200 Chr1 (943575..947285) [3711 bp, 1236 aa] {ON} Anc_3.223
           YBR023C
          Length = 1236

 Score = 30.8 bits (68), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 11/67 (16%)

Query: 173 LLFYPFAGLTSLFGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKD 232
           L F+  A L +LFGL       K   R   WR   A + ++F L+A+     GFI+YG  
Sbjct: 236 LTFWAPAPLLALFGL-------KSLDRQTAWRDKIALISIIFYLAAII----GFIIYGCS 284

Query: 233 ETWKRVQ 239
           +T  + Q
Sbjct: 285 KTICKTQ 291

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.328    0.141    0.458 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 30,565,675
Number of extensions: 1273806
Number of successful extensions: 4005
Number of sequences better than 10.0: 79
Number of HSP's gapped: 3986
Number of HSP's successfully gapped: 79
Length of query: 308
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 199
Effective length of database: 40,982,805
Effective search space: 8155578195
Effective search space used: 8155578195
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 65 (29.6 bits)