Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D01309g6.25ON74474436940.0
SAKL0E01452g6.25ON73774921190.0
ACL001C6.25ON74575819310.0
Ecym_30306.25ON74774118420.0
NCAS0H008606.25ON75576018390.0
KAFR0G026606.25ON73575018300.0
Kpol_1037.296.25ON74676118010.0
TPHA0J003706.25ON74375817900.0
Kwal_56.224476.25ON73575117630.0
KLTH0C11066g6.25ON73572517550.0
KNAG0M012306.25ON73874817540.0
Suva_15.1766.25ON74574817530.0
YOR001W (RRP6)6.25ON73375917500.0
Smik_15.1706.25ON77374917460.0
NDAI0D008506.25ON79076917220.0
TDEL0G044406.25ON73567417160.0
ZYRO0C07678g6.25ON74176617040.0
CAGL0E02585g6.25ON73774816920.0
TBLA0A071706.25ON77175516920.0
Skud_15.1626.25ON73475116840.0
SAKL0H25168g8.155ON2672114734.6
KAFR0G004208.860ON37449708.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D01309g
         (744 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D01309g Chr4 (114713..116947) [2235 bp, 744 aa] {ON} simila...  1427   0.0  
SAKL0E01452g Chr5 (108911..111124) [2214 bp, 737 aa] {ON} simila...   820   0.0  
ACL001C Chr3 complement(354804..357041) [2238 bp, 745 aa] {ON} S...   748   0.0  
Ecym_3030 Chr3 (58929..61172) [2244 bp, 747 aa] {ON} similar to ...   714   0.0  
NCAS0H00860 Chr8 complement(156180..158447) [2268 bp, 755 aa] {O...   712   0.0  
KAFR0G02660 Chr7 (549718..551925) [2208 bp, 735 aa] {ON} Anc_6.2...   709   0.0  
Kpol_1037.29 s1037 complement(68981..71221) [2241 bp, 746 aa] {O...   698   0.0  
TPHA0J00370 Chr10 complement(81371..83602) [2232 bp, 743 aa] {ON...   694   0.0  
Kwal_56.22447 s56 (133578..135785) [2208 bp, 735 aa] {ON} YOR001...   683   0.0  
KLTH0C11066g Chr3 complement(910359..912566) [2208 bp, 735 aa] {...   680   0.0  
KNAG0M01230 Chr13 complement(223471..225687) [2217 bp, 738 aa] {...   680   0.0  
Suva_15.176 Chr15 (301216..303453) [2238 bp, 745 aa] {ON} YOR001...   679   0.0  
YOR001W Chr15 (326832..329033) [2202 bp, 733 aa] {ON}  RRP6Nucle...   678   0.0  
Smik_15.170 Chr15 (294013..296334) [2322 bp, 773 aa] {ON} YOR001...   677   0.0  
NDAI0D00850 Chr4 complement(190801..193173) [2373 bp, 790 aa] {O...   667   0.0  
TDEL0G04440 Chr7 (805881..808088) [2208 bp, 735 aa] {ON} Anc_6.2...   665   0.0  
ZYRO0C07678g Chr3 (582236..584461) [2226 bp, 741 aa] {ON} simila...   660   0.0  
CAGL0E02585g Chr5 (246427..248640) [2214 bp, 737 aa] {ON} simila...   656   0.0  
TBLA0A07170 Chr1 (1784984..1787299) [2316 bp, 771 aa] {ON} Anc_6...   656   0.0  
Skud_15.162 Chr15 (286822..289026) [2205 bp, 734 aa] {ON} YOR001...   653   0.0  
SAKL0H25168g Chr8 complement(2188094..2196112) [8019 bp, 2672 aa...    33   4.6  
KAFR0G00420 Chr7 (122124..123248) [1125 bp, 374 aa] {ON} Anc_8.860     32   8.7  

>KLLA0D01309g Chr4 (114713..116947) [2235 bp, 744 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 744

 Score = 1427 bits (3694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 705/744 (94%), Positives = 705/744 (94%)

Query: 1   MSSEDKDTLLSSLVQTVRSSSALAAQDIDFYKSLDSNINASLEDTXXXXXXXXXXXXXXX 60
           MSSEDKDTLLSSLVQTVRSSSALAAQDIDFYKSLDSNINASLEDT               
Sbjct: 1   MSSEDKDTLLSSLVQTVRSSSALAAQDIDFYKSLDSNINASLEDTSTNILSLINDLLLSI 60

Query: 61  XXXXXVIQQGKDSFVDSWKSISNIMDNLFEKSDHALDNIRXXXXXXXXXPSLKYLNDDDR 120
                VIQQGKDSFVDSWKSISNIMDNLFEKSDHALDNIR         PSLKYLNDDDR
Sbjct: 61  DPNNDVIQQGKDSFVDSWKSISNIMDNLFEKSDHALDNIRAGNGGNAGGPSLKYLNDDDR 120

Query: 121 SNNKPSKRIEKPQLSFKTPVDNTELHPFKPLLEYKPHSLQPFEISLKMVPEEESIPSHYP 180
           SNNKPSKRIEKPQLSFKTPVDNTELHPFKPLLEYKPHSLQPFEISLKMVPEEESIPSHYP
Sbjct: 121 SNNKPSKRIEKPQLSFKTPVDNTELHPFKPLLEYKPHSLQPFEISLKMVPEEESIPSHYP 180

Query: 181 HPYEYEIDHQKYNDSILVATEPIPSKDWDETEAIWVDTVEGLNKMKDELSKATELAIDLE 240
           HPYEYEIDHQKYNDSILVATEPIPSKDWDETEAIWVDTVEGLNKMKDELSKATELAIDLE
Sbjct: 181 HPYEYEIDHQKYNDSILVATEPIPSKDWDETEAIWVDTVEGLNKMKDELSKATELAIDLE 240

Query: 241 HHDYRSYYGIVCLMQISDREHDWIVDTIALREELYILNDIFTDPNVTKVLHGAFMDIIWL 300
           HHDYRSYYGIVCLMQISDREHDWIVDTIALREELYILNDIFTDPNVTKVLHGAFMDIIWL
Sbjct: 241 HHDYRSYYGIVCLMQISDREHDWIVDTIALREELYILNDIFTDPNVTKVLHGAFMDIIWL 300

Query: 301 QRDLGLYIVGLFDTYHASRMLGFPKHSLAYLLERFANFKTSKKYQLADWRIRPLTKPMLA 360
           QRDLGLYIVGLFDTYHASRMLGFPKHSLAYLLERFANFKTSKKYQLADWRIRPLTKPMLA
Sbjct: 301 QRDLGLYIVGLFDTYHASRMLGFPKHSLAYLLERFANFKTSKKYQLADWRIRPLTKPMLA 360

Query: 361 YARADTHFLLNIFDKLRNSLLEQNKMSDVLHESRKVAKRRFEYSSFRPKVPSSAVFSPIE 420
           YARADTHFLLNIFDKLRNSLLEQNKMSDVLHESRKVAKRRFEYSSFRPKVPSSAVFSPIE
Sbjct: 361 YARADTHFLLNIFDKLRNSLLEQNKMSDVLHESRKVAKRRFEYSSFRPKVPSSAVFSPIE 420

Query: 421 KDEPWKNIMFQYNIPASKELLLRRLYEWRDTIARRDDESPRYVMPNQLLVSLVAGAPTEP 480
           KDEPWKNIMFQYNIPASKELLLRRLYEWRDTIARRDDESPRYVMPNQLLVSLVAGAPTEP
Sbjct: 421 KDEPWKNIMFQYNIPASKELLLRRLYEWRDTIARRDDESPRYVMPNQLLVSLVAGAPTEP 480

Query: 481 INVLSVSSYVSEHLRTNSKVIANLIKRTLEDLKGNSNSSAIPLLESAESNGTDLANIITT 540
           INVLSVSSYVSEHLRTNSKVIANLIKRTLEDLKGNSNSSAIPLLESAESNGTDLANIITT
Sbjct: 481 INVLSVSSYVSEHLRTNSKVIANLIKRTLEDLKGNSNSSAIPLLESAESNGTDLANIITT 540

Query: 541 SQIKSIQNIFHSLASEINSQKLNNEQNSEKSVLFNGISNLDVNTAVRYTPKTRTLIPQHE 600
           SQIKSIQNIFHSLASEINSQKLNNEQNSEKSVLFNGISNLDVNTAVRYTPKTRTLIPQHE
Sbjct: 541 SQIKSIQNIFHSLASEINSQKLNNEQNSEKSVLFNGISNLDVNTAVRYTPKTRTLIPQHE 600

Query: 601 LLKRQHEITRTLEQEYTDRQAQSIVLPSNEDEAPTQVSNDENRNEVITSDPSQEEIEENK 660
           LLKRQHEITRTLEQEYTDRQAQSIVLPSNEDEAPTQVSNDENRNEVITSDPSQEEIEENK
Sbjct: 601 LLKRQHEITRTLEQEYTDRQAQSIVLPSNEDEAPTQVSNDENRNEVITSDPSQEEIEENK 660

Query: 661 DEVITLRKRQSQSNNKRKTISPPASHEIMDYAAGSDLLNSTKNNTNSQKHKKRRFDPYSV 720
           DEVITLRKRQSQSNNKRKTISPPASHEIMDYAAGSDLLNSTKNNTNSQKHKKRRFDPYSV
Sbjct: 661 DEVITLRKRQSQSNNKRKTISPPASHEIMDYAAGSDLLNSTKNNTNSQKHKKRRFDPYSV 720

Query: 721 EHVGPQPIXXXXXXXXXXNVSFKR 744
           EHVGPQPI          NVSFKR
Sbjct: 721 EHVGPQPIKKKSKPAKGKNVSFKR 744

>SAKL0E01452g Chr5 (108911..111124) [2214 bp, 737 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 737

 Score =  820 bits (2119), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/749 (56%), Positives = 545/749 (72%), Gaps = 19/749 (2%)

Query: 1   MSSEDKDTLLSSLVQTVRSSSALAAQDIDFYKSLDSNINASLEDTXXXXXXXXXXXXXXX 60
           MSS+  D LLS+LV TVR++SAL+AQD+DF+KSLDS I+ S+E +               
Sbjct: 1   MSSDKPDKLLSNLVGTVRAASALSAQDLDFFKSLDSGISKSVEGSSSKLLNLINEVLLSI 60

Query: 61  XXXXXVIQQGKDSFVDSWKSISNIMDNLFEKSDHALDNIRXXXXXXXXXPSLKYLNDDDR 120
                 I+ GKD+F +SWK I +IMDNLFEKSDHA D ++          +++YL+D  R
Sbjct: 61  DENNDTIEYGKDNFQESWKDIGDIMDNLFEKSDHAFDALKRNSINQGNS-NVQYLDDSSR 119

Query: 121 SNNKPSKRIEKPQLSFKTPVDNTELHPFKPLLEYKPHSLQPFEISLKMVPEEESIPSHYP 180
           SN  PSKRIEKPQL+FKTP+DNTE HPFKPLLE KPH+L+P    LK  PE E+IPSHYP
Sbjct: 120 SNLNPSKRIEKPQLNFKTPIDNTESHPFKPLLENKPHALRPLSEILKQTPETENIPSHYP 179

Query: 181 HPYEYEIDHQKYNDSILVATEPIPSKDWDETEAIWVDTVEGLNKMKDELSKATELAIDLE 240
           HPY YEID Q+YN+SIL   +PIPS+ W++T+ +WVDT E L K+ +EL  A E+A+DLE
Sbjct: 180 HPYGYEIDTQEYNESILQIRDPIPSQPWEDTDPVWVDTKESLQKLLNELRSAKEIAVDLE 239

Query: 241 HHDYRSYYGIVCLMQISDREHDWIVDTIALREELYILNDIFTDPNVTKVLHGAFMDIIWL 300
           HHDYRSYYGIVCLMQIS RE DW+VDTIALREEL++LN+IFTDP+V KV HGAFMDIIWL
Sbjct: 240 HHDYRSYYGIVCLMQISTRERDWLVDTIALREELHVLNEIFTDPSVLKVFHGAFMDIIWL 299

Query: 301 QRDLGLYIVGLFDTYHASRMLGFPKHSLAYLLERFANFKTSKKYQLADWRIRPLTKPMLA 360
           QRDLG+Y+V LFDTYHASR LG P+HSLAYLLE+FA FKTSKKYQLADWRIRPLTKPM A
Sbjct: 300 QRDLGIYVVSLFDTYHASRSLGLPRHSLAYLLEKFAQFKTSKKYQLADWRIRPLTKPMRA 359

Query: 361 YARADTHFLLNIFDKLRNSLLEQNKMSDVLHESRKVAKRRFEYSSFRPKVPSSAVFSPIE 420
           YARADTHFLLNI+D+LRNSL+EQNK++ VLH+SR VAKRRFEY+SFRPK+ S+ VFSPIE
Sbjct: 360 YARADTHFLLNIYDQLRNSLIEQNKLAAVLHDSRNVAKRRFEYTSFRPKIVSADVFSPIE 419

Query: 421 KDEPWKNIMFQYNIPASKELLLRRLYEWRDTIARRDDESPRYVMPNQLLVSLVAGAPTEP 480
           KDEPW+N+M+QYNIP S+E L+R+LYEWRDTIARRDDESPRYVMPNQLLVSLVA APT+P
Sbjct: 420 KDEPWRNLMYQYNIPLSREPLMRKLYEWRDTIARRDDESPRYVMPNQLLVSLVAIAPTDP 479

Query: 481 INVLSVSSYVSEHLRTNSKVIANLIKRTLEDLKGN---SNSSAIPLLESAESNGTDLANI 537
             VLSVS+++++++R+NSK+++NLIK+TLE LK     +N++    LE       DL+ +
Sbjct: 480 AGVLSVSNFITDYVRSNSKMLSNLIKKTLESLKNGDVSTNNAGSSQLEEK-----DLSQV 534

Query: 538 ITTSQIKSIQNIFHSLASEINSQKLNNEQNS--EKSVLFNGISNLDVNTAVRYTPKTRTL 595
           ++ SQI+++   F+SLAS++  +K N+  NS  + S+LF+G      + AV Y+  ++ +
Sbjct: 535 LSISQIQNMCLQFNSLASKV--KKANSATNSMPKVSILFDGDHIFSNDRAVLYSKNSKIV 592

Query: 596 IPQHELLKRQHEITRTL-EQEYTDRQAQSIVLPSNEDEAPTQVSNDENRNEVITSDPSQE 654
           I +++L +R+ E++  L E +  D +    V     DE    VS  ++ N    +DP   
Sbjct: 593 IDENQLQERKLEVSEKLKEVQEPDFRLHVNVTTKETDEVSKDVSEKDDVNRASETDP--- 649

Query: 655 EIEENKDEVITLRKRQSQSNNKRKTISPPASHEIMDYAAGSDLLNSTKNNTNSQKHKKRR 714
            +E NKDE+I L+K++      RK +      E MDY     LL ++K  ++ QK  KRR
Sbjct: 650 -LETNKDEIIVLKKKKRHEPQDRKKVGNSTDVEPMDYKNAEKLLGNSK-KSSKQKTTKRR 707

Query: 715 FDPYSVEHVGPQPIXXXXXXXXXXNVSFK 743
           FDPY+ E+VGPQ            N+SFK
Sbjct: 708 FDPYTSENVGPQSAKKRKKPTPGKNMSFK 736

>ACL001C Chr3 complement(354804..357041) [2238 bp, 745 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR001W
           (RRP6)
          Length = 745

 Score =  748 bits (1931), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/758 (50%), Positives = 517/758 (68%), Gaps = 28/758 (3%)

Query: 1   MSSEDKDTLLSSLVQTVRSSSALAAQDIDFYKSLDSNINASLEDTXXXXXXXXXXXXXXX 60
           M+S D+D L   +V T+R+++AL+AQDIDFY+SL  ++   L+DT               
Sbjct: 1   MASTDEDPLFKRIVSTIRAAAALSAQDIDFYRSLHPSVGQELDDTSATVVSLINELLLSV 60

Query: 61  XXXXXVIQQGKDSFVDSWKSISNIMDNLFEKSDHALDNIRXXXXXXXXXPSLKYLNDDDR 120
                 ++ G+D+F DSWK +SN+MDN+FEKSDHA D+I+          +++YL D   
Sbjct: 61  DENNNELKPGRDNFEDSWKELSNVMDNIFEKSDHAFDSIKHGSSSRNEGVNMQYLADSSH 120

Query: 121 SNNKPSKRIEKPQLSFKTPVDNTELHPFKPLLEYKPHSLQPFEISLKMVPEEESIPSHYP 180
            ++ PSKRIEKPQL FKTPVDNTELHPFKPLL+ KPH+L+P E SL + PEEE++P+HYP
Sbjct: 121 DDSTPSKRIEKPQLLFKTPVDNTELHPFKPLLKEKPHALKPLEESLMLAPEEENVPAHYP 180

Query: 181 HPYEYEIDHQKYNDSILVATEPIPSKDWDETEAIWVDTVEGLNKMKDELSKATELAIDLE 240
           HPYEYEID Q YNDS+L   E I  + W+ TE IWVD VE L++M DEL +  ELA+DLE
Sbjct: 181 HPYEYEIDKQPYNDSVLEVRERIDPQPWEATEPIWVDNVESLSQMLDELKEVKELAVDLE 240

Query: 241 HHDYRSYYGIVCLMQISDREHDWIVDTIALREELYILNDIFTDPNVTKVLHGAFMDIIWL 300
           HHDYRSYYGIVCLMQIS R  DW+VDTIALR++L++LN I  DP V KV HGAFMD+IWL
Sbjct: 241 HHDYRSYYGIVCLMQISSRSKDWLVDTIALRDDLHVLNVILPDPTVVKVFHGAFMDMIWL 300

Query: 301 QRDLGLYIVGLFDTYHASRMLGFPKHSLAYLLERFANFKTSKKYQLADWRIRPLTKPMLA 360
           QRDLGLY+V LFDTYHASR LGFPKHSLAYLLE FA FKTSKKYQLADWR+RPL KP+  
Sbjct: 301 QRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFAKFKTSKKYQLADWRVRPLPKPLRD 360

Query: 361 YARADTHFLLNIFDKLRNSLLEQNKMSDVLHESRKVAKRRFEYSSFRPKVPSSAVFSPIE 420
           YAR+DTHFLL+I+D LRN+L++  K+++VL+ SR VAKRRFEY+SFRP++P S V+SPIE
Sbjct: 361 YARSDTHFLLSIYDDLRNALVKAGKLAEVLNASRNVAKRRFEYTSFRPRIPDSNVYSPIE 420

Query: 421 KDEPWKNIMFQYNIPASKELLLRRLYEWRDTIARRDDESPRYVMPNQLLVSLVAGAPTEP 480
             EPW+ +M+QYN+P SKE LL++LYEWRDT+ARRDDES RYVMPNQLLVSLV+ +P+E 
Sbjct: 421 STEPWRKLMYQYNLPPSKEPLLKKLYEWRDTVARRDDESVRYVMPNQLLVSLVSLSPSET 480

Query: 481 INVLSVSSYVSEHLRTNSKVIANLIKRTLEDLKGNSNSSAIPLLESAESNGTDLANIITT 540
             VLSVS+YV++++R+N++ +ANLIKRTLE +K  + S A     S+E   ++ A  ++ 
Sbjct: 481 AGVLSVSTYVTDYVRSNARTLANLIKRTLETIKAGTASVA--EFSSSERALSNPAATLSL 538

Query: 541 SQIKSIQNIFHSLASEINSQKLNNEQNSEKSVLFNGISNLDVN-TAVRYTPKTRTLIPQH 599
             I+++ + F SL  E   Q  +       S+LFN  S+L    +AV YT   + +I  +
Sbjct: 539 HMIQNLDDHFRSLLMEAQKQSGSICSQHSSSLLFN--SDLATGPSAVEYTNGQKHVIGDN 596

Query: 600 ELLKRQHEITRTLEQEYTDRQAQSIVLPSNEDEAPTQVSNDEN---RNEVITSDP--SQE 654
            L  R+H     L Q++T +  +    P  + EAP+  S+ EN     ++  S+P  SQ 
Sbjct: 597 VLQTRKH----ALLQKFTSQPVE----PVTDIEAPSHQSSSENPQVSEDISPSEPQESQN 648

Query: 655 EIEEN-----KDEVITLRKRQSQSNNKRKTISPPASHEIMDYAAGSDLLN----STKNNT 705
           E++++     K E++ LRK++     K K  S   + E +DY+   ++L     ST    
Sbjct: 649 EVQKDEPDFEKSEIVVLRKKKKAHAQKPKGTSSSPT-ETVDYSNAKEVLGKGTSSTAKRG 707

Query: 706 NSQKHKKRRFDPYSVEHVGPQPIXXXXXXXXXXNVSFK 743
           +  + +KR+FDPY  ++  P  +          ++SFK
Sbjct: 708 DKDRPRKRKFDPYGQDNNAPSGVKKKNKPSKGKSISFK 745

>Ecym_3030 Chr3 (58929..61172) [2244 bp, 747 aa] {ON} similar to
           Ashbya gossypii ACL001C
          Length = 747

 Score =  714 bits (1842), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/741 (50%), Positives = 495/741 (66%), Gaps = 47/741 (6%)

Query: 1   MSSEDKDTLLSSLVQTVRSSSALAAQDIDFYKSLDSNINASLEDTXXXXXXXXXXXXXXX 60
           MSS++KD LL+ ++ TVR++S+LAAQDIDF + LD+++   L++T               
Sbjct: 1   MSSDNKDALLTKILGTVRAASSLAAQDIDFCRHLDASVGELLDETSQYIVSLLNEVILST 60

Query: 61  XXXXXVIQQGKDSFVDSWKSISNIMDNLFEKSDHALD--NIRXXXXXXXXXPSLKYLNDD 118
                 ++ GKD+   +WK +SNI+DNLFEKSDH+LD               +++YLN D
Sbjct: 61  SKANNDLEVGKDNLEAAWKDLSNIIDNLFEKSDHSLDVLQKLLSSSSSQLDTNMQYLNVD 120

Query: 119 DRSNNKPSKRIEKPQLSFKTPVDNTELHPFKPLLEYKPHSLQPFEISLKMVPEEESIPSH 178
            + + K S+RI KPQL FK PVDN+E HPFKPLL+ KPH+L+P E    +  E E +P+H
Sbjct: 121 SQRDGKLSQRIVKPQLQFKIPVDNSECHPFKPLLKVKPHALKPLEEVSSLTVETECVPAH 180

Query: 179 YPHPYEYEIDHQKYNDSILVATEPIPSKDWDETEAIWVDTVEGLNKMKDELSKATELAID 238
           YPHPYEYEID+Q Y+DS+L   EPI   +WDE E IWVD +  LN M + L    E+A+D
Sbjct: 181 YPHPYEYEIDNQPYDDSVLTIKEPIEPSNWDENEPIWVDNITALNDMLNGLKNVKEIAVD 240

Query: 239 LEHHDYRSYYGIVCLMQISDREHDWIVDTIALREELYILNDIFTDPNVTKVLHGAFMDII 298
           LEHHDYRSYYG+VCLMQIS RE DW+VDTIALR++L +LN+IFTDP++ KV HGAFMDII
Sbjct: 241 LEHHDYRSYYGLVCLMQISTRESDWLVDTIALRQDLQVLNEIFTDPSILKVFHGAFMDII 300

Query: 299 WLQRDLGLYIVGLFDTYHASRMLGFPKHSLAYLLERFANFKTSKKYQLADWRIRPLTKPM 358
           WLQRDLGLY+V LFDTYHASR LGFPKHSLAYLLE FANFKTSKKYQLADWRIRPL+KPM
Sbjct: 301 WLQRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFANFKTSKKYQLADWRIRPLSKPM 360

Query: 359 LAYARADTHFLLNIFDKLRNSLLEQNKMSDVLHESRKVAKRRFEYSSFRPKVPSSAVFSP 418
             YARADTHFLLNI+DKLRNSL++++K+S VLH SR VAKRRFEY+SFRPKV S  VFSP
Sbjct: 361 KTYARADTHFLLNIYDKLRNSLIKEDKLSGVLHASRNVAKRRFEYTSFRPKVLSPTVFSP 420

Query: 419 IEKDEPWKNIMFQYNIPASKELLLRRLYEWRDTIARRDDESPRYVMPNQLLVSLVAGAPT 478
           IEKD+PW+ +M QYN+P  KE L+R+LY+WRD +AR+DDES RYVMPNQLLVSLV  AP+
Sbjct: 421 IEKDDPWRTLMSQYNVPDIKEPLMRKLYKWRDMVARKDDESVRYVMPNQLLVSLVTLAPS 480

Query: 479 EPINVLSVSSYVSEHLRTNSKVIANLIKRTLEDLKGNSNSSAIPLLESAESNGTDLANII 538
           +P  +L+V SY+ +H+R N++V+ N+I +T+E++K  S+             G  + N+ 
Sbjct: 481 DPSGLLTVKSYIPDHVRANARVLCNIINKTMEEIKSGSHE------------GQSIENVT 528

Query: 539 TT-----------SQIKSIQNIFHSLASEINSQKLNNEQNSEKSVLFNGISNLDVNTAVR 587
           TT           S IK++   F  L  E+ S  +      E S+LF G    D   AV 
Sbjct: 529 TTYVSAQDPEMSVSLIKTMDRHFKFLLDEVQSHAVEPSSVCEDSLLFKGFL-FDKPKAVA 587

Query: 588 YTPKTRTLIPQHELLKRQHEITRTLEQEYTDRQAQSIVLPSNEDE--APTQVSNDENRNE 645
           Y    + L+   ELL R+ ++++   + +   +A  I + S+ ++  + +++  D   N 
Sbjct: 588 YNSVGKRLVNDRELLDRKSDLSQKFSKVF---KAAGIAIGSHIEKLSSNSELPADTTSN- 643

Query: 646 VITSDPSQEE-------IEENKDEVITL-RKRQSQSNNKRKTISPPASHEIMDYAAGSDL 697
                PS+EE       ++E+K E+I L RKR   SN K  +  P   H  +DY   + +
Sbjct: 644 --VESPSKEESKNNSDDLKEDKHEIIVLKRKRDYGSNTKSTSKQPKKEH--VDYNNVNSI 699

Query: 698 LNST--KNNTNSQKH-KKRRF 715
           L++T  ++  NS +H  KR+F
Sbjct: 700 LDNTSQQDKPNSGRHVDKRKF 720

>NCAS0H00860 Chr8 complement(156180..158447) [2268 bp, 755 aa] {ON}
           Anc_6.25 YOR001W
          Length = 755

 Score =  712 bits (1839), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/760 (49%), Positives = 497/760 (65%), Gaps = 26/760 (3%)

Query: 2   SSEDKDTLLSSLVQTVRSSSALAAQDIDFYKSLDSNINASLEDTXXXXXXXXXXXXXXXX 61
           S E + TLL  +V TVR++SALAAQD+DFY+S+D +I  SLE +                
Sbjct: 5   SQEQEKTLLPKVVNTVRAASALAAQDVDFYRSIDKDIAHSLEQSSNQIADMINSVLLSID 64

Query: 62  XXXXVIQQGKDSFVDSWKSISNIMDNLFEKSDHALDNIRXXXXXXXXXPSLKYLNDDDRS 121
                +   K++  D WK   N+MDNLFEKSD ++D I            ++Y+++    
Sbjct: 65  ENSEQVDGTKENLEDIWKDFGNLMDNLFEKSDRSIDIITRGHGGSNGQSGMQYIDEFSGR 124

Query: 122 NNKPSKRIEKPQLSFKTPVDNTELHPFKPLLEYKPHSLQPFEISLKMVPEEESIPSHYPH 181
           +  P K+I KPQL F TP+DNTE HPF PLL+ KP +L+P E S++M+PE+E+ P HYP 
Sbjct: 125 DLTPGKQILKPQLKFTTPIDNTESHPFIPLLKEKPFALKPLEESMQMIPEDETSPMHYPQ 184

Query: 182 PYEYEIDHQKYNDSILVATEPIPSKDWDETEAIWVDTVEGLNKMKDELSKATELAIDLEH 241
           PYEYEIDHQ+YND IL   +PIPS  W + E IWVDTV  L  +  +L  +TE+A+DLEH
Sbjct: 185 PYEYEIDHQEYNDLILQKKDPIPSTSWTDNEPIWVDTVSQLQSIMPDLEASTEIAVDLEH 244

Query: 242 HDYRSYYGIVCLMQISDREHDWIVDTIALREELYILNDIFTDPNVTKVLHGAFMDIIWLQ 301
           HDYR+YYGI CLMQIS R++D+++DT+ALRE+L ILN++F +P +TKV HGAFMDIIWLQ
Sbjct: 245 HDYRTYYGITCLMQISTRKNDYLIDTLALREDLQILNNVFANPMITKVFHGAFMDIIWLQ 304

Query: 302 RDLGLYIVGLFDTYHASRMLGFPKHSLAYLLERFANFKTSKKYQLADWRIRPLTKPMLAY 361
           RDLGLY+VGLFDT+HASR +G PKHSLAYLLE+FA FKTSKKYQLADWRIRPL+K M AY
Sbjct: 305 RDLGLYVVGLFDTFHASRAMGLPKHSLAYLLEKFAQFKTSKKYQLADWRIRPLSKAMHAY 364

Query: 362 ARADTHFLLNIFDKLRNSLLEQNKMSDVLHESRKVAKRRFEYSSFRPKV--PSSAVFSPI 419
           ARADTHFLLNIFD++RNSL+EQNK++ VL ESR VAKRRFEYSSFRPKV   +  V+SPI
Sbjct: 365 ARADTHFLLNIFDQMRNSLIEQNKLAGVLKESRNVAKRRFEYSSFRPKVLQTNGLVYSPI 424

Query: 420 EKDEPWKNIMFQYNIPASKELLLRRLYEWRDTIARRDDESPRYVMPNQLLVSLVAGAPTE 479
           EKD+PWK IMFQYNIP  KE LL+ LY+WRD IARRDDESPR+VMPNQLLVSLVA  P +
Sbjct: 425 EKDDPWKTIMFQYNIPPQKEPLLKELYQWRDKIARRDDESPRFVMPNQLLVSLVAYTPID 484

Query: 480 PINVLSVSSYVSEHLRTNSKVIANLIKRTLEDLKGNS---NSSAIPLLESAESNGTDLAN 536
              V+SVS+ V++++R+NSK++ANLIK  L  +K N    N+ A   +      G DL+ 
Sbjct: 485 APGVVSVSNSVTDYVRSNSKILANLIKNCLAKMKDNKFLDNNVAEEGISVVPETGHDLSQ 544

Query: 537 IITTSQIKSIQNIFHSLASEINSQKLNNEQNSEKSVLFNGISNLDVNTAVRYTPKTRTLI 596
            +T  Q++++++ F  L+ + N+       N ++  LF+GIS  D +  ++Y    +   
Sbjct: 545 KLTIHQLQNLKSKFQLLSDKFNNSVKTRLSNHDQLYLFDGISFAD-DVTIKYFADGKIQT 603

Query: 597 PQHELLKRQHEITRTLEQ----EYTDRQAQSIVLPSNEDEAP--TQVSNDENR-NEVITS 649
              +  +R  +    ++Q    EY     +      ++D  P  T  +N E + NE+I  
Sbjct: 604 TAEQYKERSEQFDDAMKQLEEVEYCIPVIEENKQTQDQDNIPPITVATNAEGQVNEMI-- 661

Query: 650 DPSQEEIEENKDEVITLRK--RQSQSNNKRKTISPPASHEIMDYAAGSDLLNSTKN---N 704
                E  E+ DEVI LRK  +     NK K    P   EI+DY   + +L + KN    
Sbjct: 662 -----EKPEDLDEVIVLRKTNKNKSIKNKPKNREEP-ELEIIDYFKTAKVLTNDKNSRGG 715

Query: 705 TNSQKHKKRRFDPYSVEHVGPQPIXXXXXXXXXXNVSFKR 744
            N+  +K++RFDPYS  + GP             NVSFKR
Sbjct: 716 RNNNGNKRKRFDPYSAANEGPAAPKKRKNVTRGKNVSFKR 755

>KAFR0G02660 Chr7 (549718..551925) [2208 bp, 735 aa] {ON} Anc_6.25
           YOR001W
          Length = 735

 Score =  709 bits (1830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/750 (49%), Positives = 499/750 (66%), Gaps = 22/750 (2%)

Query: 1   MSSEDKDTLLSSLVQTVRSSSALAAQDIDFYKSLDSNINASLEDTXXXXXXXXXXXXXXX 60
           M  E++  LLS +V TVR+SS LAAQD+DFY+SLDS ++ S+ +                
Sbjct: 1   MLLEEQKKLLSDVVNTVRASSTLAAQDVDFYRSLDSEVSHSINEVTDELNDMVNSIILSI 60

Query: 61  XXXXXVIQQGKDSFVDSWKSISNIMDNLFEKSDHALDNIRXXXXXXXXXPSLKYLNDDDR 120
                 + +GK+   +SWKS+SNI+DNLFEKSD +LD ++         P  +Y  +   
Sbjct: 61  DENYETLDEGKEELTESWKSLSNIVDNLFEKSDRSLDILKTGAKKKPTNPPFEYFENATT 120

Query: 121 SNNKPSKRIEKPQLSFKTPVDNTELHPFKPLLEYKPHSLQPFEISLKMVPEEESIPSHYP 180
           + N P KRI KPQL F  P+DN+E HPF PLL+ KP++L+  + S K++  +E++P HY 
Sbjct: 121 TENIPQKRINKPQLKFVPPIDNSESHPFIPLLKEKPNALKTIDESTKLINSDENVPEHYA 180

Query: 181 HPYEYEIDHQKYNDSILVATEPIPSKDWDETEAIWVDTVEGLNKMKDELSKATELAIDLE 240
           HPYEYEID+Q YNDSIL   EPIPSK W ETE +WVD VE LN M +++ K TE+AIDLE
Sbjct: 181 HPYEYEIDNQPYNDSILQVREPIPSKSWSETEGVWVDNVESLNHMLNDIKKYTEIAIDLE 240

Query: 241 HHDYRSYYGIVCLMQISDREHDWIVDTIALREELYILNDIFTDPNVTKVLHGAFMDIIWL 300
           HHDYR+YYGIVCLMQIS RE D++VDTIALR +L +LN++FTDP+V KVLHGAFMDIIWL
Sbjct: 241 HHDYRTYYGIVCLMQISTRETDYLVDTIALRNDLKVLNEVFTDPSVVKVLHGAFMDIIWL 300

Query: 301 QRDLGLYIVGLFDTYHASRMLGFPKHSLAYLLERFANFKTSKKYQLADWRIRPLTKPMLA 360
           QRDLGLYIV LFDT+HASR LGFP+HSLAYLLE FANFKTSKKYQLADWR+RPL+K M A
Sbjct: 301 QRDLGLYIVSLFDTFHASRALGFPRHSLAYLLEEFANFKTSKKYQLADWRVRPLSKAMTA 360

Query: 361 YARADTHFLLNIFDKLRNSLLEQNKMSDVLHESRKVAKRRFEYSSFRPKVPSSAVFSPIE 420
           YARADTHFLLNI+D+LRN L+E NK+  VL+ESR VAKRRFEYS FRP+VPS  V+S +E
Sbjct: 361 YARADTHFLLNIYDQLRNRLVETNKLVGVLNESRNVAKRRFEYSKFRPRVPSPNVYSALE 420

Query: 421 KDEPWKNIMFQYNIPASKELLLRRLYEWRDTIARRDDESPRYVMPNQLLVSLVAGAPTEP 480
           K++PW+ +MFQYNIP+ +E LL+ L+EWRD IARRDDESPRY+MPNQL+V+LVA  PT+P
Sbjct: 421 KEDPWRTLMFQYNIPSEREDLLKGLFEWRDMIARRDDESPRYIMPNQLMVTLVAYTPTDP 480

Query: 481 INVLSVSSYVSEHLRTNSKVIANLIKRTLEDLKGNSNSSAIPLLESAESNGTDLANIITT 540
             V+S S  V++++R+NSK+IANLIK  L   K + N     + ++         + +T 
Sbjct: 481 AGVISASQVVTDYVRSNSKIIANLIKNALTRAK-DQNRQLQFVADNHTRESYRSTDKMTV 539

Query: 541 SQIKSIQNIFHSLASEINSQKLNNEQNSEKSV----LFNGIS-NLDVNTAVRYTPKTRTL 595
           SQIK   ++F  +A ++ +   NN+Q   KS      F  +S  LD+   + Y    +  
Sbjct: 540 SQIKETASVFIQIAEKLGT--CNNDQQQSKSFARSNYFGSLSKKLDI---IEYKNGEKHS 594

Query: 596 IPQHELLKRQHEITRTLEQEYTDRQAQSIVLPSNEDEAPTQVSNDENRNEVITSD--PSQ 653
           + Q +L+ R +  T+ +  E T+ + +   LP +++    Q  + E   + I +D  P++
Sbjct: 595 VKQQQLVSRFNTYTKQV-NELTNVRYE---LPVHKEPPQLQKDDVEEVKKTIIADSIPAK 650

Query: 654 EEIEENKDEVITLRKRQSQSNNKRKTISPPASHEIMDYAAGSDLLNSTKNNTNSQKHKKR 713
            EI+   DEV+ L+K   Q N  +  +      + +DY+    +L   K     ++ KKR
Sbjct: 651 PEID--LDEVVVLKKVNRQPNKTK--LEENEKIDFIDYSKSEKILKGDKQR-KKRESKKR 705

Query: 714 RFDPYSVEHVGPQPIXXXXXXXXXXNVSFK 743
           +FDP++  + GP+            N+S+K
Sbjct: 706 QFDPFAASNEGPKAARKRKSGTRGRNLSYK 735

>Kpol_1037.29 s1037 complement(68981..71221) [2241 bp, 746 aa] {ON}
           complement(68981..71221) [2241 nt, 747 aa]
          Length = 746

 Score =  698 bits (1801), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/761 (48%), Positives = 499/761 (65%), Gaps = 32/761 (4%)

Query: 1   MSSEDKDTLLSSLVQTVRSSSALAAQDIDFYKSLDSNINASLEDTXXXXXXXXXXXXXXX 60
           MS +    LLSS+V TVR++S+LAAQD+DFY++LD  I+ SL ++               
Sbjct: 1   MSEDINKELLSSVVSTVRAASSLAAQDVDFYRNLDKEISTSLNESSKEITNMINTLLLSI 60

Query: 61  XXXXXVIQQGKDSFVDSWKSISNIMDNLFEKSDHALDNIRXXXXXXXXXPSLKYLNDDDR 120
                 ++ GK+     WK  SN+MDNLFEKSD +LD I             +YL+D  +
Sbjct: 61  NENNEELESGKEGLEQYWKDFSNVMDNLFEKSDRSLDIITRSKTSNDNKSEFQYLSDSAQ 120

Query: 121 SNNKPSKRIEKPQLSFKTPVDNTELHPFKPLLEYKPHSLQPFEISLKMVPEEESIPSHYP 180
           S++ PSKR+ KPQL F  PVDN+E  PF PLL  KPHS++ F  SL ++PE E +PSHY 
Sbjct: 121 SDSNPSKRVTKPQLQFSRPVDNSESKPFMPLLNDKPHSIKSFTDSLIIIPESEELPSHYA 180

Query: 181 HPYEYEIDHQKYNDSILVATEPIPSKDWDETEAIWVDTVEGLNKMKDELSKATELAIDLE 240
           HPYE EID Q+YN S+L   EP+ S+ W+ +E+ WVDT E L  M D+L + TE+A+DLE
Sbjct: 181 HPYEVEIDKQEYNASVLQVAEPLKSQPWN-SESTWVDTSEALQSMLDKLKECTEIAVDLE 239

Query: 241 HHDYRSYYGIVCLMQISDREHDWIVDTIALREELYILNDIFTDPNVTKVLHGAFMDIIWL 300
           HHDYRSYYGIVCLMQIS R+ D++VDT+ALR+EL+ILN++F DPN+ KVLHGAFMDIIWL
Sbjct: 240 HHDYRSYYGIVCLMQISTRKEDFLVDTLALRDELHILNEVFADPNILKVLHGAFMDIIWL 299

Query: 301 QRDLGLYIVGLFDTYHASRMLGFPKHSLAYLLERFANFKTSKKYQLADWRIRPLTKPMLA 360
           QRDLGLY+V LFDTYHASR LGFP+HSLAYLLE++ANFKTSKKYQLADWR+RPL+KPM A
Sbjct: 300 QRDLGLYVVSLFDTYHASRALGFPRHSLAYLLEKYANFKTSKKYQLADWRVRPLSKPMHA 359

Query: 361 YARADTHFLLNIFDKLRNSLLEQNKMSDVLHESRKVAKRRFEYSSFRPKVPSSAVFSPIE 420
           YARADTHFLLNI+D++RN L+ +NK+++VL ESR VAKRRFEYS FRPKVPS AVF+PIE
Sbjct: 360 YARADTHFLLNIYDQIRNQLIRENKLAEVLFESRNVAKRRFEYSRFRPKVPSPAVFTPIE 419

Query: 421 KDEPWKNIMFQYNIPASKELLLRRLYEWRDTIARRDDESPRYVMPNQLLVSLVAGAPTEP 480
           K+EPW+ +++QYN+P++K  LL+R++EWRD IARRDDESPRY+MPNQL++SLV   P +P
Sbjct: 420 KEEPWRTLVYQYNVPSTKIELLKRIWEWRDMIARRDDESPRYIMPNQLMISLVEYTPIDP 479

Query: 481 INVLSVSSYVSEHLRTNSKVIANLIKRTLEDLKGNSNSSAIPLLESAESNGTDLA-NIIT 539
             V+SVS+ +++H+R+NSKVIANLIK++LED+K     +           G   A + +T
Sbjct: 480 AGVISVSNVMTDHVRSNSKVIANLIKKSLEDMKSVPAGALTAFQNIDYKIGQKFASDKLT 539

Query: 540 TSQIKSIQNIFHSLASEINSQKLNNEQNSE-KSVLFNGISNLDVNTAVRYTPKTRTLIPQ 598
            SQI+++  +F  +AS  N   +  + + +   +LF+ I  L  N  V Y    R ++  
Sbjct: 540 ISQIQNMTALFKEIAS--NPSIIEKDVSKKIDPILFSNIF-LSKNEIVLYDHDKRHVVTN 596

Query: 599 HELLKRQHEITRTLEQEYTDRQAQSIVLPSNEDEAPTQVSNDENRNEVITSDPSQEEIE- 657
            +L  R  E+   + +      A +I     E  A   V   E + +     P    +E 
Sbjct: 597 EQLAGRAEEVEGFMNEANNTTLAINI-----ESSAEMHVEEPEAKEKNALFSPPISNVEN 651

Query: 658 ---------ENKDEVITL---RKRQSQSNNKRKTISPPASHEIMDYAAGSDLLNSTKNNT 705
                    E+ +++I L   +KR +  ++K+K   P  + E++DY+    +L+  K   
Sbjct: 652 ASSSNTDGFEDMNDIIVLKDVKKRTNIKDHKKKQGMP--NKEVIDYSKLDTILSKEKR-- 707

Query: 706 NSQKHKKRRFDPYSVEHV--GPQPIXXXXXXXXXXNVSFKR 744
             +  KKR+ DP+  E+   GP+            NVSFKR
Sbjct: 708 --ENSKKRKGDPFGEENGLEGPKAAKKRKQINRGKNVSFKR 746

>TPHA0J00370 Chr10 complement(81371..83602) [2232 bp, 743 aa] {ON}
           Anc_6.25 YOR001W
          Length = 743

 Score =  694 bits (1790), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/758 (48%), Positives = 500/758 (65%), Gaps = 38/758 (5%)

Query: 7   DTLLSSLVQTVRSSSALAAQDIDFYKSLDSNINASLEDTXXXXXXXXXXXXXXXXXXXXV 66
           D LL  +V +VR++SALAAQD+DFY+SLD  I +SL +T                     
Sbjct: 4   DELLPLVVSSVRAASALAAQDVDFYRSLDKEIASSLTNTSQKVTDMINSIISSVDENSEG 63

Query: 67  IQQGKDSFVDSWKSISNIMDNLFEKSDHALDNIRXXXXXXXXXPSLKYLNDDDRSNNKPS 126
           + +GK++  +SWK I N++D+LFE +DH++D +          P +KYLND     +   
Sbjct: 64  LVEGKENLDESWKDIGNLLDSLFELADHSIDALSKASQKSSNDPKMKYLNDSLNFESDNV 123

Query: 127 KRIEKPQLSFKTPVDNTELHPFKPLLEYKPHSLQPFEISLKMVPEEESIPSHYPHPYEYE 186
            R+ KPQL+F  PVDN+E HPF+PLL  KP+++ P +  LK+V   E  P HYP PYE E
Sbjct: 124 TRLSKPQLNFSVPVDNSETHPFRPLLTDKPNAVVPLDEVLKIVDGTEDTPQHYPQPYETE 183

Query: 187 IDHQKYNDSILVATEPIPSKDWDETEAIWVDTVEGLNKMKDELSKATELAIDLEHHDYRS 246
           ID Q+YN+ +L  ++PIPSK W+ETEAIWVD  E L  M +EL  ATELA+DLEHHD+RS
Sbjct: 184 IDKQEYNEQVLQFSDPIPSKVWEETEAIWVDNEESLAAMLNELKTATELAVDLEHHDFRS 243

Query: 247 YYGIVCLMQISDREHDWIVDTIALREELYILNDIFTDPNVTKVLHGAFMDIIWLQRDLGL 306
           YYGI CLMQIS R  D++VDTIALR++L +LN +FTDP +TK+LHGAFMDIIWLQRDLGL
Sbjct: 244 YYGITCLMQISTRNTDYLVDTIALRDKLQVLNVVFTDPKITKILHGAFMDIIWLQRDLGL 303

Query: 307 YIVGLFDTYHASRMLGFPKHSLAYLLERFANFKTSKKYQLADWRIRPLTKPMLAYARADT 366
           YIV LFDTYHASR LGFP+HSLAYLLERFA+FKTSK+YQLADWR RPL+K M AYARADT
Sbjct: 304 YIVSLFDTYHASRALGFPRHSLAYLLERFAHFKTSKQYQLADWRTRPLSKAMNAYARADT 363

Query: 367 HFLLNIFDKLRNSLLEQNKMSDVLHESRKVAKRRFEYSSFRPKVPSSAVFSPIEKDEPWK 426
           HFLLNIFD+LRN L++++K++ +LHESRKVAKRRFEYS ++P +PSSAVFSP E D PW+
Sbjct: 364 HFLLNIFDQLRNMLIQEDKLASMLHESRKVAKRRFEYSKYKPTLPSSAVFSPTESDMPWR 423

Query: 427 NIMFQYNIPASKELLLRRLYEWRDTIARRDDESPRYVMPNQLLVSLVAGAPTEPINVLSV 486
           ++++QYNIP+ K  L++RL+EWRDTIARRDDESPRY+MPNQL+ SLV   PT P  V+SV
Sbjct: 424 SMIYQYNIPSQKVELVKRLWEWRDTIARRDDESPRYIMPNQLIASLVEYVPTNPAGVISV 483

Query: 487 SSYVSEHLRTNSKVIANLIKRTLEDLKGNSNSSAIPLLESAESNGTDLANIITTSQIKSI 546
           +  +++ +R+N+K IANLIK TLED+K N+ S+ +  + +   +    +N ++TSQIK I
Sbjct: 484 NRMMTDPVRSNAKAIANLIKSTLEDMKNNNISTTV--VSTTAKDKETSSNDLSTSQIKFI 541

Query: 547 QNIFHSLASEINSQKLN----NEQNSEKSVLFNGISNLDVNTAVRYTPKTRTLIPQHELL 602
            + F ++  + +S   N      +  + S++F+ I N   +  + Y   T+ LI + +L 
Sbjct: 542 VSQFENILEKYSSNNSNLNDVTSKEGKDSLVFSKIFN-SRDDIITYDKGTKHLITEQQLS 600

Query: 603 KRQHEITRTLEQ--------EYTDRQAQSIVLPSNEDEAPTQVSNDENRNEVITSD--PS 652
            RQ E+   ++Q        E  D   +S+  P  E E            EVI+    P+
Sbjct: 601 DRQKEVDAAMKQAEEIAFSMEVQDTHKESMKQPFPEPE------------EVISQSHLPA 648

Query: 653 QEEIEENK--DEVITLRKRQSQSN--NKRKTISPPASHEIMDYAAGSDLLNSTKNNTNSQ 708
            E+ EE +  DE+I L+  + + N  ++ +  S  + H ++DY+ G  +L+    +   +
Sbjct: 649 FEDKEEQEDLDEIIVLKDTKDRRNRQHRGRGRSADSDHTVIDYSKGDKILS---QDNRRR 705

Query: 709 KHKKRRFDPYSVEH--VGPQPIXXXXXXXXXXNVSFKR 744
              KR++DP+S ++     Q            NVSFKR
Sbjct: 706 TPNKRKYDPFSADNNENALQGAKRRRPTAKNRNVSFKR 743

>Kwal_56.22447 s56 (133578..135785) [2208 bp, 735 aa] {ON} YOR001W
           (RRP6) - involved in 5.8S rRNA processing [contig 185]
           FULL
          Length = 735

 Score =  683 bits (1763), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/751 (47%), Positives = 499/751 (66%), Gaps = 57/751 (7%)

Query: 2   SSEDK-DTLLSSLVQTVRSSSALAAQDIDFYKSLDSNINASLEDTXXXXXXXXXXXXXXX 60
           + EDK  ++L+ +V T+R+SSA++AQD+DFYKSLDS I+ SL++T               
Sbjct: 4   TQEDKRSSILTQVVGTIRASSAISAQDVDFYKSLDSTISESLDETSAKLLSLINDVVISI 63

Query: 61  XXXXXVIQQGKDSFVDSWKSISNIMDNLFEKSDHALDNIRXXXXXXXXXPSLKYLNDDDR 120
                +I+ G+    +SW +I  +MD LFEKS+HAL  ++          +L+YL+D   
Sbjct: 64  DDNNDLIEPGRAGLENSWNNIGEVMDLLFEKSEHALAAMKKKGSNIIGN-NLQYLDDSQP 122

Query: 121 SNNKPSKRIEKPQLSFKTPVDNTELHPFKPLLEYKPHSLQPFEISLKMVPEEESIPSHYP 180
             +    +I KPQ SF  PVDNTE HPFKPLL  KP++L+P +  L++  EEE IP+HYP
Sbjct: 123 LTDTTLTKITKPQASFSRPVDNTESHPFKPLLVQKPNALRPLDDVLQLTVEEEGIPAHYP 182

Query: 181 HPYEYEIDHQKYNDSILVATEPIPSKDWDETEAIWVDTVEGLNKMKDELSKATELAIDLE 240
           HPYEYEIDHQ+Y++S+L    PIPSK W+ET+A WVD +  LN M  ELSKA ELAIDLE
Sbjct: 183 HPYEYEIDHQEYDESVLEIRPPIPSKPWEETDATWVDNLGTLNDMIRELSKAKELAIDLE 242

Query: 241 HHDYRSYYGIVCLMQISDREHDWIVDTIALREELYILNDIFTDPNVTKVLHGAFMDIIWL 300
           HHDYR+YYGI CLMQIS RE+DW+VDTIALR+ L++LN+IFT+P V KV HGAFMD+IWL
Sbjct: 243 HHDYRTYYGITCLMQISTRENDWLVDTIALRDHLWVLNEIFTNPKVIKVFHGAFMDVIWL 302

Query: 301 QRDLGLYIVGLFDTYHASRMLGFPKHSLAYLLERFANFKTSKKYQLADWRIRPLTKPMLA 360
           QRDLGLY+V LFDT+HASR+LGFPKHSLAYLLER+A+FKTSKKYQLADWRIRPL+KP+ A
Sbjct: 303 QRDLGLYLVSLFDTFHASRLLGFPKHSLAYLLERYAHFKTSKKYQLADWRIRPLSKPLKA 362

Query: 361 YARADTHFLLNIFDKLRNSLLEQNKMSDVLHESRKVAKRRFEYSSFRPKVPSSAVFSPIE 420
           YARADTHFLLNI+D++RNSL+EQ K++  LH SR VAKRRFEY+ FRP V +S V+SP+E
Sbjct: 363 YARADTHFLLNIYDQMRNSLIEQGKLAQSLHNSRGVAKRRFEYTKFRPTVMTSEVYSPVE 422

Query: 421 KDEPWKNIMFQYNIPASKELLLRRLYEWRDTIARRDDESPRYVMPNQLLVSLVAGAPTEP 480
           +++PW++++F YNIP SK  LL+RLYEWRDTIARRDDESPRYVMPNQLLV+LV  APT+ 
Sbjct: 423 REDPWRSLIFHYNIPQSKSFLLKRLYEWRDTIARRDDESPRYVMPNQLLVALVMNAPTDT 482

Query: 481 INVLSVSSYVSEHLRTNSKVIANLIKRTL---EDLKGNSNSSAIPLLESAESNGTDLANI 537
             +LSV+S+V+EH+R+N+K ++ LIK+TL   +DL  +        +   +SN + + + 
Sbjct: 483 YGLLSVTSFVTEHVRSNAKSLSQLIKKTLASPQDLFTDQ-------INHMDSNKSMVDSK 535

Query: 538 ITTSQIKSIQNIFHSLASEINSQKLNNEQNSEKSVLFNGISNLDVNTAVRYTPKTRTLIP 597
           ++   +K+            N Q  +      + ++ +G + +   +     P     +P
Sbjct: 536 LSPGDVKA------------NHQNFDQYTRKSRELVIHGPTVVRGCSLFPGKP-----LP 578

Query: 598 QHELLKRQ----HEITRTLEQEYTDRQAQSIVLPSNEDE----------APTQVSNDENR 643
               +  Q    H I  T+  +  +  AQ+I   +N  E          AP +VS++ + 
Sbjct: 579 NEAYVSYQGTQVHHIEPTVLDDRRELVAQNITTTANVTEKLQVAVEKTPAP-EVSDELDE 637

Query: 644 NEVI-TSDPSQEEIEENKDEVITLRKRQSQSNNKRKTISPPAS-----HEIMDYAAGSDL 697
            E    SD +  +++E+KDE++ L++R++   +     SPP +      EI+D+     +
Sbjct: 638 GEAKELSDDTVSQLKEDKDEIVVLKRRKALPQSS----SPPKNAEGNPKEILDFKNNKKI 693

Query: 698 LNSTKNNTNSQKHKKRRFDPYSVEHVGPQPI 728
           + +T    +  +   +RFDPY+++  GP  +
Sbjct: 694 MTAT---ASVPRKSTKRFDPYAIQASGPDGV 721

>KLTH0C11066g Chr3 complement(910359..912566) [2208 bp, 735 aa] {ON}
           similar to uniprot|Q12149 Saccharomyces cerevisiae
           YOR001W RRP6 Exonuclease component of the nuclear
           exosome contributes to the quality-control system that
           retains and degrades aberrant mRNAs in the nucleus
          Length = 735

 Score =  680 bits (1755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/725 (47%), Positives = 489/725 (67%), Gaps = 14/725 (1%)

Query: 2   SSEDKDTLLSSLVQTVRSSSALAAQDIDFYKSLDSNINASLEDTXXXXXXXXXXXXXXXX 61
            SED  ++L+ ++ T+R+SSA+ AQD+ FYK+LD +I  S+ +                 
Sbjct: 6   GSED-GSVLNQVIATIRASSAVTAQDVSFYKNLDPSIATSVNNISARLLGLINDILLSVD 64

Query: 62  XXXXVIQQGKDSFVDSWKSISNIMDNLFEKSDHALDNIRXXXXXXXXXPSLKYLNDDDRS 121
               +I+QG +    +W ++  +MD LFEKS+HAL              +++YL+D    
Sbjct: 65  ENNDIIEQGSEGLESAWSNVGEVMDLLFEKSEHAL-AAGEKRDNGELSKTVQYLDDSPSL 123

Query: 122 NNKPSKRIEKPQLSFKTPVDNTELHPFKPLLEYKPHSLQPFEISLKMVPEEESIPSHYPH 181
           ++   K+I KPQL FK P+DN+E HPFKPLL+ KPH+L+  + SL++  E+E +P+HYP 
Sbjct: 124 HDGAPKKILKPQLLFKRPIDNSESHPFKPLLKKKPHALRSLDESLRLTAEQEDVPAHYPQ 183

Query: 182 PYEYEIDHQKYNDSILVATEPIPSKDWDETEAIWVDTVEGLNKMKDELSKATELAIDLEH 241
           PYEYEIDHQ+YN+S+L  +EP+PS  WDETEA WVD  + L  M +EL  A E+AIDLEH
Sbjct: 184 PYEYEIDHQEYNESVLQISEPVPSLPWDETEAEWVDNTDALKLMLNELLLANEIAIDLEH 243

Query: 242 HDYRSYYGIVCLMQISDREHDWIVDTIALREELYILNDIFTDPNVTKVLHGAFMDIIWLQ 301
           HDYR+YYGI CLMQIS RE DW++DTIALR++L+ILN++FTDP +TKVLHGAFMDIIWLQ
Sbjct: 244 HDYRTYYGITCLMQISTREKDWLIDTIALRDDLWILNEVFTDPKITKVLHGAFMDIIWLQ 303

Query: 302 RDLGLYIVGLFDTYHASRMLGFPKHSLAYLLERFANFKTSKKYQLADWRIRPLTKPMLAY 361
           RDLGLYIV LFDTYHASR+LG PKHSLAYLLER+A+FKTSKKYQL+DWR+RPL K + AY
Sbjct: 304 RDLGLYIVSLFDTYHASRLLGSPKHSLAYLLERYAHFKTSKKYQLSDWRVRPLPKALKAY 363

Query: 362 ARADTHFLLNIFDKLRNSLLEQNKMSDVLHESRKVAKRRFEYSSFRPKVPSSAVFSPIEK 421
           ARADTHFLLNI+D +RNSL+EQNK+S VLH+SR VAKRRFE+++FRPK+ +S VFSPIE+
Sbjct: 364 ARADTHFLLNIYDNMRNSLIEQNKLSQVLHDSRNVAKRRFEFTTFRPKIVTSHVFSPIER 423

Query: 422 DEPWKNIMFQYNIPASKELLLRRLYEWRDTIARRDDESPRYVMPNQLLVSLVAGAPTEPI 481
           ++PW+ +MFQYNIP SK LL+RRLYEWRD +ARRDDESPRYV+PNQLLVSL   APT P 
Sbjct: 424 EDPWRTLMFQYNIPQSKSLLVRRLYEWRDMVARRDDESPRYVIPNQLLVSLAVNAPTTPA 483

Query: 482 NVLSVSSYVSEHLRTNSKVIANLIKRTLEDLKGNSNSSAIPLLESAESNGTDLANIITTS 541
            +++ S++V+EH+R N+K +A LIK++LE    +S++    LL SA +        +++ 
Sbjct: 484 LIMATSTFVTEHIRQNAKSLALLIKKSLE----SSSNEFGQLLNSANTVQNSSPTKMSSE 539

Query: 542 QIKSIQNIFHSLASEINSQKLNNEQNSEKSVLFNGISNLDVNTAVRYTPKTRTLIPQHEL 601
            I+    +F     + + +K  +   S  S LF     +     V Y     +L+  + L
Sbjct: 540 DIEKNSRMFEKFLEDFSYEKAADCGISLGSSLFQK-KFVPCEEYVSYQESRASLVDHNSL 598

Query: 602 LKRQHEITRTLEQEYTDRQAQSIVLPSNEDEAPTQVSNDENRNEVITSDPSQEEIEENKD 661
             R+H++++  E E    + Q  +  ++      + +  E+ NE  +++   +  +E  D
Sbjct: 599 ENRRHQVSKKYEAERDIARPQVHIRAASSHAVCDKEAGAED-NE--SAEEENKARKEEMD 655

Query: 662 EVITLRKRQSQSNNKRKTISPPA-SHEIMDYAAGSDLLNSTKNNTNSQKHKKRRFDPYSV 720
           EVI L++R++ ++ +++ +     S E +D  +   +L +  NN    +  K+RFDPY+ 
Sbjct: 656 EVIVLKQRKTLADKEQRAVDKATPSIEPLDLQSARKILEAPSNNV---RRPKKRFDPYAT 712

Query: 721 EHVGP 725
              GP
Sbjct: 713 LAAGP 717

>KNAG0M01230 Chr13 complement(223471..225687) [2217 bp, 738 aa] {ON}
           Anc_6.25 YOR001W
          Length = 738

 Score =  680 bits (1754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/748 (48%), Positives = 481/748 (64%), Gaps = 14/748 (1%)

Query: 1   MSSEDKDTLLSSLVQTVRSSSALAAQDIDFYKSLDSNINASLEDTXXXXXXXXXXXXXXX 60
           M SE++  LLS  V TVR+SS+L  QD+ F+ +LD+N+ +S+++                
Sbjct: 1   MDSEEQKKLLSKAVGTVRASSSLVGQDVQFFSNLDANVASSVKELGNEVLEMINDILFSI 60

Query: 61  XXXXXVIQQGKDSFVDSWKSISNIMDNLFEKSDHALDNIRXXXXXXXXXPS-LKYLNDDD 119
                   +  +   +SW+  +N+ DNLFEKSD ++D I           S ++YL+D  
Sbjct: 61  DENSKPFAESAEQVGESWRDFTNLTDNLFEKSDRSMDIIAQGTRKNGQAGSEVQYLDDLV 120

Query: 120 RSNNKPSKRIEKPQLSFKTPVDNTELHPFKPLLEYKPHSLQPFEISLKMVPEEESIPSHY 179
            +++   KRI KPQL F  PVDN+E  PFKPLL  KP++L+P + SL+MVP  E+IPSHY
Sbjct: 121 GNDSSSGKRITKPQLHFSRPVDNSESQPFKPLLTEKPNALKPLKESLQMVPATENIPSHY 180

Query: 180 PHPYEYEIDHQKYNDSILVATEPIPSKDWDETEAIWVDTVEGLNKMKDELSKATELAIDL 239
           P+PY+YEI +Q+YN+ IL    PIPS  W E+E +WVD+ EGL  +  +L K  ELAIDL
Sbjct: 181 PNPYDYEISNQEYNNDILETRAPIPSTPWHESEPVWVDSTEGLQSLLKDLKKYKELAIDL 240

Query: 240 EHHDYRSYYGIVCLMQISDREHDWIVDTIALREELYILNDIFTDPNVTKVLHGAFMDIIW 299
           EHHDYRSYYGIVCLMQIS R+ D++VDTIALR+EL+ILN +FTDP VTKV HGAFMDIIW
Sbjct: 241 EHHDYRSYYGIVCLMQISTRDTDYLVDTIALRDELHILNQVFTDPMVTKVFHGAFMDIIW 300

Query: 300 LQRDLGLYIVGLFDTYHASRMLGFPKHSLAYLLERFANFKTSKKYQLADWRIRPLTKPML 359
           LQRDLGLYIV LFDT+HAS+ LGFPKHSLAYLLE  ANFKTSKKYQLADWRIRPL+KPM 
Sbjct: 301 LQRDLGLYIVSLFDTFHASKALGFPKHSLAYLLETLANFKTSKKYQLADWRIRPLSKPMS 360

Query: 360 AYARADTHFLLNIFDKLRNSLLEQNKMSDVLHESRKVAKRRFEYSSFRPKVPSSAVFSPI 419
            YARADTHFLLNIFD++RN L++ NK++ VL ESRKVAKRRFEYS FRPK+    VF+PI
Sbjct: 361 VYARADTHFLLNIFDQMRNQLIKDNKLAGVLGESRKVAKRRFEYSKFRPKLAQPDVFTPI 420

Query: 420 EKDEPWKNIMFQYNIPASKELLLRRLYEWRDTIARRDDESPRYVMPNQLLVSLVAGAPTE 479
           EK+ PW+ +MFQYN+   KE L++ LYEWRDTIARRDDESPRY+MPNQLL+SL A  PT+
Sbjct: 421 EKESPWRTLMFQYNVTPEKEELVKALYEWRDTIARRDDESPRYIMPNQLLISLSAYTPTD 480

Query: 480 PINVLSVSSYVSEHLRTNSKVIANLIKRTLEDLKGNSNSSAIPLLESAESNGTDLANIIT 539
           P++++SV+SYV++ +R+NSKV+ANLIK  +E  K    SS  P  E+     T    ++T
Sbjct: 481 PVSLVSVNSYVTDCVRSNSKVLANLIKSFVESSKLGPQSSYTPNTEN-----TSTPFVLT 535

Query: 540 TSQIKSIQNIFHSLASEINSQKLNNEQNSEKSVLFNGISNLDVNTAVRYTPKTRTLIPQH 599
            SQIK I   F  L     S         ++S  F  +S   V   V Y     T + Q 
Sbjct: 536 LSQIKDIGMRFTKLTENFQSSSCQKISPLQRSSFFGDLSKGKV--TVSYNDAKTTPVSQS 593

Query: 600 ELLKRQHEITRTLEQEYTDRQAQ--SIVLPSNEDEAPTQVSNDENRNEVITSDPSQEEIE 657
            L  R  +    + + + D + +  SIV P  +   P+  ++ E+ +      P +  I+
Sbjct: 594 VLESRSKQFNEYM-KAFGDIEYKIPSIVEPVMDLPIPSGTTSTESADSKTVEKPPK-NIK 651

Query: 658 ENKDEVITLRKRQSQSNNKRKTISPPASHEIMDYAAGSDLLNSTK-NNTNSQKHKKRRFD 716
           E+ DE++ L+K + +   K K     A  EI+DY+    +L   + +      + K+RFD
Sbjct: 652 EDMDEIVVLKKVKREL-PKPKGNDEDAEREIVDYSKEDKVLVQRQFDKKKKNNNNKKRFD 710

Query: 717 PYSVEHVGPQPIXXXXXXXXXXNVSFKR 744
           P+S    GP+            N SFKR
Sbjct: 711 PFSAISEGPKAPKKRKAVTKGKNASFKR 738

>Suva_15.176 Chr15 (301216..303453) [2238 bp, 745 aa] {ON} YOR001W
           (REAL)
          Length = 745

 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/748 (47%), Positives = 484/748 (64%), Gaps = 25/748 (3%)

Query: 1   MSSEDKDTLLSSLVQTVRSSSALAAQDIDFYKSLDSNINASLEDTXXXXXXXXXXXXXXX 60
           M+SE+ D LLS +V  +R++S+LAAQD+DFY++LD + +  L+                 
Sbjct: 19  MASENSDVLLSKVVNVIRAASSLAAQDVDFYRNLDRDFSKILQSKSSKLTEMVNGIVLSI 78

Query: 61  XXXXXVIQQGKDSFVDSWKSISNIMDNLFEKSDHALDNIRXXXXXXXXXPSLKYLNDDDR 120
                 ++  ++   D WK   NIMDNL EKSDH+LDN+            L+YL D   
Sbjct: 79  DEHHDSLELKEEEISDLWKDFGNIMDNLLEKSDHSLDNLNRTSNSNNSAADLQYLGDFSG 138

Query: 121 SNNKPSKRIEKPQLSFKTPVDNTELHPFKPLLEYKPHSLQPFEISLKMVPEEESIPSHYP 180
            +++P+KR+EKPQL FKTP+DN+E HPF PLL+ KP++L+P   SL+M+  EE+ P HYP
Sbjct: 139 KDSQPTKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRMIETEENSPGHYP 198

Query: 181 HPYEYEIDHQKYNDSILVATEPIPSKDWDETEAIWVDTVEGLNKMKDELSKATELAIDLE 240
           HPYEYEIDHQ+YN +IL     IPSK WD +E IW+++   L  M ++L  A E+A+DLE
Sbjct: 199 HPYEYEIDHQEYNPNILQIKPEIPSKPWDASEPIWINSKATLKSMLEDLKNAHEIAVDLE 258

Query: 241 HHDYRSYYGIVCLMQISDREHDWIVDTIALREELYILNDIFTDPNVTKVLHGAFMDIIWL 300
           HHDYRSYYG+VCLMQ+S RE D++VDT+ LRE+L+ILN++FT+P++ KV HGAFMDIIWL
Sbjct: 259 HHDYRSYYGVVCLMQVSTRERDYLVDTLELREDLHILNEVFTNPSIVKVFHGAFMDIIWL 318

Query: 301 QRDLGLYIVGLFDTYHASRMLGFPKHSLAYLLERFANFKTSKKYQLADWRIRPLTKPMLA 360
           QRDLGLY+VGLFDTYHAS+ +G P+HSLAYLLE FANFKTSKKYQLADWRIRPL+KPM A
Sbjct: 319 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTA 378

Query: 361 YARADTHFLLNIFDKLRNSLLEQNKMSDVLHESRKVAKRRFEYSSFRPKVPSSAVFSPIE 420
           YARADTHFLLNI+D+LRN L+E NK++ VL+ESR VAKRRFEYS +RP  PSS V+SP E
Sbjct: 379 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPITPSSKVYSPTE 438

Query: 421 KDEPWKNIMFQYNIPASKELLLRRLYEWRDTIARRDDESPRYVMPNQLLVSLVAGAPTEP 480
           K+ PW+ +M+QYNI   +E L++ LYEWRD IARRDDESPR++MPNQLL +LVA  P + 
Sbjct: 439 KENPWRVLMYQYNIAPEREELVKDLYEWRDVIARRDDESPRFIMPNQLLAALVAYTPIDV 498

Query: 481 INVLSVSSYVSEHLRTNSKVIANLIKRTLEDLKGNSNSSAIPLLESAESNGTDLANIITT 540
           I V+S+S+ V++H+R N+K++ANLIK  L  +K     SA  +    +S   +    IT 
Sbjct: 499 IGVVSLSNGVTDHVRQNAKILANLIKSALRSMKDTHKESAEIVSSKFKSASLE---AITV 555

Query: 541 SQIKSIQNIFHSLASEINSQKLNNEQNS-EKSVLFNGISNLDVNTAVRYTPKTRTLIPQH 599
           SQI+ I + F   +S  NS   +   +S   S+LF  I   +    V            +
Sbjct: 556 SQIRDIMDRFSVFSS--NSVTEDRSMDSTASSILFGKILPYEEGDIV------------Y 601

Query: 600 ELLKRQHEITRTLEQEYTDRQAQSIVLPSN---EDEAPTQVSNDENRNEVITSDPSQEEI 656
           E     H++     ++   R   ++V   +   E E P  V   E      T +P  +  
Sbjct: 602 EDSGLPHKVKVEDMRDRAQRFNSALVGLEDIKFEVEKPVNVEKSEMVKIETTPEPPTK-- 659

Query: 657 EENKDEVITLRKRQSQSNNKRKTISPPASHEIMDYAAGSDLLNSTKNNTNSQKHKKRRFD 716
            E+ DEV+ L+K++       K  S  A+ E +DY+   ++L S+K   N+++ +KRRFD
Sbjct: 660 IEDPDEVVVLKKKRIHKKQVAKR-SDVAAEEAVDYSKIPNVL-SSKPGQNNKQQRKRRFD 717

Query: 717 PYSVEHVGPQPIXXXXXXXXXXNVSFKR 744
           P   +  GP+            NVSFKR
Sbjct: 718 PSFNDSEGPRAPKKKRPTTRGKNVSFKR 745

>YOR001W Chr15 (326832..329033) [2202 bp, 733 aa] {ON}  RRP6Nuclear
           exosome exonuclease component; has 3'-5' exonuclease
           activity; involved in RNA processing, maturation,
           surveillance, degradation, tethering, and export; has
           similarity to E. coli RNase D and to human PM-Sc1 100
           (EXOSC10); mutant displays reduced transcription
           elongation in the G-less-based run-on (GLRO) assay
          Length = 733

 Score =  678 bits (1750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/759 (47%), Positives = 490/759 (64%), Gaps = 41/759 (5%)

Query: 1   MSSEDKDTLLSSLVQTVRSSSALAAQDIDFYKSLDSNINASLEDTXXXXXXXXXXXXXXX 60
           M+SE+ D LLS ++  VR++S+LA+QD+DFYK+LD   +  L+                 
Sbjct: 1   MTSENPDVLLSRVINVVRAASSLASQDVDFYKNLDRGFSKDLKSKADKLADMANEIILSI 60

Query: 61  XXXXXVIQQGKDSFVDSWKSISNIMDNLFEKSDHALDNIRXXXXXXXXXPSLKYLNDDDR 120
                  +  ++   D W +  NIMDNL E SDH+LD +            L+YL +   
Sbjct: 61  DEHHESFELKEEDISDLWNNFGNIMDNLLEMSDHSLDKLNCAINSKSRGSDLQYLGEFSG 120

Query: 121 SNNKPSKRIEKPQLSFKTPVDNTELHPFKPLLEYKPHSLQPFEISLKMVPEEESIPSHYP 180
            N  P+KR+EKPQL FK+P+DN+E HPF PLL+ KP++L+P   SL++V ++E+ PSHYP
Sbjct: 121 KNFSPTKRVEKPQLKFKSPIDNSESHPFIPLLKEKPNALKPLSESLRLVDDDENNPSHYP 180

Query: 181 HPYEYEIDHQKYNDSILVATEPIPSKDWDETEAIWVDTVEGLNKMKDELSKATELAIDLE 240
           HPYEYEIDHQ+Y+  IL   E IPSK WD++  IWVDT   L  M ++L    E+A+DLE
Sbjct: 181 HPYEYEIDHQEYSPEILQIREEIPSKSWDDSVPIWVDTSTELESMLEDLKNTKEIAVDLE 240

Query: 241 HHDYRSYYGIVCLMQISDREHDWIVDTIALREELYILNDIFTDPNVTKVLHGAFMDIIWL 300
           HHDYRSYYGIVCLMQIS RE D++VDT+ LRE L+ILN++FT+P++ KV HGAFMDIIWL
Sbjct: 241 HHDYRSYYGIVCLMQISTRERDYLVDTLKLRENLHILNEVFTNPSIVKVFHGAFMDIIWL 300

Query: 301 QRDLGLYIVGLFDTYHASRMLGFPKHSLAYLLERFANFKTSKKYQLADWRIRPLTKPMLA 360
           QRDLGLY+VGLFDTYHAS+ +G P+HSLAYLLE FANFKTSKKYQLADWRIRPL+KPM A
Sbjct: 301 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTA 360

Query: 361 YARADTHFLLNIFDKLRNSLLEQNKMSDVLHESRKVAKRRFEYSSFRPKVPSSAVFSPIE 420
           YARADTHFLLNI+D+LRN L+E NK++ VL+ESR VAKRRFEYS +RP  PSS V+SPIE
Sbjct: 361 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPLTPSSEVYSPIE 420

Query: 421 KDEPWKNIMFQYNIPASKELLLRRLYEWRDTIARRDDESPRYVMPNQLLVSLVAGAPTEP 480
           K+ PWK +M+QYNIP  +E+L+R LY+WRD IARRDDESPR+VMPNQLL +LVA  PT+ 
Sbjct: 421 KESPWKILMYQYNIPPEREVLVRELYQWRDLIARRDDESPRFVMPNQLLAALVAYTPTDV 480

Query: 481 INVLSVSSYVSEHLRTNSKVIANLIKRTLEDLKGNSNSSAIPLLESAESNGTDLANIITT 540
           I V+S+++ V+EH+R N+K++ANLI+  L ++K N+N  A P+  S       L   I+ 
Sbjct: 481 IGVVSLTNGVTEHVRQNAKLLANLIRDALRNIK-NTNEEATPIPSSETKADGILLETISV 539

Query: 541 SQIKSIQNIFHSLA-SEINSQKLNNEQNSEKSVLFNGISNLDVNTAVRYTPKTRTLIPQH 599
            QI+ +   F  L  S I+  +     NS  S+L   I            P+      +H
Sbjct: 540 PQIRDVMERFSVLCNSNISKSRAKPVTNS--SILLGKI-----------LPRE-----EH 581

Query: 600 ELLKRQHEITRTLEQEYTDRQAQSI--VLPSNED-----EAPTQVSNDENRNEVITSDPS 652
           ++   +  +   ++ E    +AQ+    L + ED     E P  V       E+ T DP+
Sbjct: 582 DIAYSKDGLPNKVKTEDIRIRAQNFKSALANLEDIIFEIEKPLVVP--VKLEEIKTVDPA 639

Query: 653 QE-----EIEENKDEVITLRKR--QSQSNNKRKTISPPASHEIMDYAAGSDLLNSTKNNT 705
                  EI +N D+++ L+K+  Q +   K K ++     + +DY+   ++L S K   
Sbjct: 640 SAPNHSPEI-DNLDDLVVLKKKNIQKKQPAKEKGVT---EKDAVDYSKIPNIL-SNKPGQ 694

Query: 706 NSQKHKKRRFDPYSVEHVGPQPIXXXXXXXXXXNVSFKR 744
           N+++ KKRRFDP S +  GP+            N+SFKR
Sbjct: 695 NNRQQKKRRFDPSSSDSNGPRAAKKRRPAAKGKNLSFKR 733

>Smik_15.170 Chr15 (294013..296334) [2322 bp, 773 aa] {ON} YOR001W
           (REAL)
          Length = 773

 Score =  677 bits (1746), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/749 (46%), Positives = 477/749 (63%), Gaps = 21/749 (2%)

Query: 1   MSSEDKDTLLSSLVQTVRSSSALAAQDIDFYKSLDSNINASLEDTXXXXXXXXXXXXXXX 60
           M+S++ D LLS +V  +R++S+LA QD+DFYK+LD      L+                 
Sbjct: 41  MASQNPDVLLSKVVNVIRAASSLAGQDVDFYKNLDREFGKVLKSKSDKLADMANEIILSI 100

Query: 61  XXXXXVIQQGKDSFVDSWKSISNIMDNLFEKSDHALDNIRXXXXXXXXXPSLKYLNDDDR 120
                  +   +     W    NIMDNL E SDH+LD +            L+YL D   
Sbjct: 101 DEHHESFELKDEDISGLWNDFGNIMDNLLEMSDHSLDKLNRAVTSKPNGADLQYLGDFSE 160

Query: 121 SNNKPSKRIEKPQLSFKTPVDNTELHPFKPLLEYKPHSLQPFEISLKMVPEEESIPSHYP 180
            N  P+KR+EKPQL FKTP+DN+E HPF PLL+ KP++L+P   SL+++ E+++ PSHYP
Sbjct: 161 KNLSPAKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRLIEEDDNTPSHYP 220

Query: 181 HPYEYEIDHQKYNDSILVATEPIPSKDWDETEAIWVDTVEGLNKMKDELSKATELAIDLE 240
           HPYEYEIDHQ+Y  +IL   + IPSK W+++E IW+DT+  L  M +EL    E+A+DLE
Sbjct: 221 HPYEYEIDHQEYGSNILQIRKEIPSKSWNDSEPIWIDTMPKLESMLEELKNVQEIAVDLE 280

Query: 241 HHDYRSYYGIVCLMQISDREHDWIVDTIALREELYILNDIFTDPNVTKVLHGAFMDIIWL 300
           HHDYRSYYGIVCLMQIS RE D++VDT+ LRE L+ILN++FTDP++ KV HGAFMDIIWL
Sbjct: 281 HHDYRSYYGIVCLMQISTREKDYLVDTLELRETLHILNEVFTDPSIVKVFHGAFMDIIWL 340

Query: 301 QRDLGLYIVGLFDTYHASRMLGFPKHSLAYLLERFANFKTSKKYQLADWRIRPLTKPMLA 360
           QRDLGLY+VGLFDTYHAS+ +G P+HSLAYLLE FANFKTSKKYQLADWRIRPL+KPM+A
Sbjct: 341 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMIA 400

Query: 361 YARADTHFLLNIFDKLRNSLLEQNKMSDVLHESRKVAKRRFEYSSFRPKVPSSAVFSPIE 420
           YARADTHFLLNI+D+LRN L+E NK++ VL+ESR VAKRRFEYS +RP++PSS V+SPIE
Sbjct: 401 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPRIPSSEVYSPIE 460

Query: 421 KDEPWKNIMFQYNIPASKELLLRRLYEWRDTIARRDDESPRYVMPNQLLVSLVAGAPTEP 480
           K+ PW+ +M+QYNI + KE L++ LY+WRD IARRDDESPR+VMPNQLL +LVA  P + 
Sbjct: 461 KEAPWRVLMYQYNITSEKEELVKDLYQWRDVIARRDDESPRFVMPNQLLAALVAYTPIDV 520

Query: 481 INVLSVSSYVSEHLRTNSKVIANLIKRTLEDLKGNSNSSAIPLLESAESNGTDLANIITT 540
           I V+S+++ ++EH+R N+KV+ NLIK +L  +K      +      + +N   L   IT 
Sbjct: 521 IGVISLTNGITEHVRQNAKVLVNLIKNSLRHIKDTYKEDSPVTFSESMTNEVSL-EAITI 579

Query: 541 SQIKSIQNIFHSLASEINSQKLNNEQNSEKSVLFNGISNLDVNTAVRYTPKTRTLIPQHE 600
            QI+ I   F S+ S  N      +  +  S+L   I  L+ N            +   +
Sbjct: 580 PQIRDIMERF-SVLSNSNVSNCRAKNGATPSILLGRILPLEENDIAYKNNGLPNRVKFED 638

Query: 601 LLKRQHEITRTLEQEYTDRQAQSIVLPSNEDEAPTQVSNDENRNEVITSD--PSQEEIEE 658
           +  R       L         +  +L   E E P  +  +  + E I ++  P      E
Sbjct: 639 IRARAQSFNSALS------NLEDCML---EVEKPHILPTNVKKIERINTEDVPKHSATIE 689

Query: 659 NKDEVITLRKR---QSQSNNKRKTISPPASHEIMDYAAGSDLLNSTKNNTNSQKHKKRRF 715
           N D+++ L+K+   ++QS N + T+   A    +DY+   ++L S+K++ N ++ KKRR 
Sbjct: 690 NPDDIVVLKKKNIHRTQSMNAKDTMGEKA----IDYSKIPNVL-SSKSDQNRRQQKKRRS 744

Query: 716 DPYSVEHVGPQPIXXXXXXXXXXNVSFKR 744
           DP   +  GP+            NVSFKR
Sbjct: 745 DPLFNDSDGPRAAKKKRPATRGRNVSFKR 773

>NDAI0D00850 Chr4 complement(190801..193173) [2373 bp, 790 aa] {ON}
           Anc_6.25 YOR001W
          Length = 790

 Score =  667 bits (1722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/769 (47%), Positives = 503/769 (65%), Gaps = 33/769 (4%)

Query: 6   KDTLLSSLVQTVRSSSALAAQDIDFYKSLDSNINASLEDTXXXXXXXXXXXXXXXXXXXX 65
           KD LL  +VQTVR+S ALAAQD+DFY+S+D     +L++T                    
Sbjct: 25  KDQLLPQVVQTVRASVALAAQDVDFYRSMDKTTAKTLKETTSQLADMINSVLLAVDENSE 84

Query: 66  VIQQGKDSFVDSWKSISNIMDNLFEKSDHALDNIRXXXXXXXXXPSLKYLNDDDRSNNKP 125
            +   K++  D+WK  SN+MDNL EKSD ++D +           +++YL++    ++  
Sbjct: 85  TLDGTKENLEDNWKDFSNLMDNLLEKSDRSMDMLLRSKNTNTNNSNMQYLDEYSGRDDTS 144

Query: 126 SKR--IEKPQLSFKTPVDNTELHPFKPLLEYKPHSLQPFEISLKMVPEEESIPSHYPHPY 183
           SKR  I KPQL F  PVDNTE HPF PLL+ KP++L+  + S++++P +E++P HY  PY
Sbjct: 145 SKRRAIGKPQLEFDVPVDNTETHPFIPLLKSKPNALKSLDESIQLLPVDENVPEHYAQPY 204

Query: 184 EYEIDHQKYNDSILVATEPIPSKDWDETEAIWVDTVEGLNKMKDELSKATELAIDLEHHD 243
           EYEID+Q YND IL  ++PIPS+ W ET AIWVDT E L  M  +L+  TE A+DLEHHD
Sbjct: 205 EYEIDNQPYNDKILQLSDPIPSQPWMETTAIWVDTPESLQSMIKDLNNCTEFAVDLEHHD 264

Query: 244 YRSYYGIVCLMQISDREHDWIVDTIALREELYILNDIFTDPNVTKVLHGAFMDIIWLQRD 303
           YR+YYGIVCLMQIS R  D+IVDT+ LR  L  LN+ FT+P +TKVLHGAFMDIIWLQRD
Sbjct: 265 YRTYYGIVCLMQISTRTQDYIVDTLKLRSHLQPLNEPFTNPQITKVLHGAFMDIIWLQRD 324

Query: 304 LGLYIVGLFDTYHASRMLGFPKHSLAYLLERFANFKTSKKYQLADWRIRPLTKPMLAYAR 363
           LGLYIV LFDT+HASR LGFPK+SLAYLLE+F+NFKTSKKYQ+ADWRIRPL+K M +YAR
Sbjct: 325 LGLYIVSLFDTFHASRALGFPKNSLAYLLEKFSNFKTSKKYQMADWRIRPLSKAMNSYAR 384

Query: 364 ADTHFLLNIFDKLRNSLLEQNKMSDVLHESRKVAKRRFEYSSFRPKVPSSAVFSPIEKDE 423
           +DTHFLLNIFD++RN L++  K++ VL ESR VAKRRFEY  +RP + SSAV+SPIEK +
Sbjct: 385 SDTHFLLNIFDQMRNKLVQDGKLAGVLKESRNVAKRRFEYVKYRPLITSSAVYSPIEKID 444

Query: 424 PWKNIMFQYNIPASKELLLRRLYEWRDTIARRDDESPRYVMPNQLLVSLVAGAPTEPINV 483
           PWK +M+QYNIP +KELLL+ LY+WRD IARRDDESPRY+MPNQLLVSLVA AP EP  V
Sbjct: 445 PWKTLMYQYNIPLAKELLLKELYQWRDKIARRDDESPRYIMPNQLLVSLVAYAPVEPAGV 504

Query: 484 LSVSSYVSEHLRTNSKVIANLIKRTLEDLKGNSNSSAIPLLESAESNGT-------DLAN 536
           +SVS+ V++H+R+NSK++ANLIK  L  +K  +++ ++ L +     GT       DL+ 
Sbjct: 505 VSVSNMVTDHVRSNSKILANLIKNCLTKIKDTTDADSLILQQEQNQPGTSTTTTNVDLSE 564

Query: 537 IITTSQIKSIQNIFHSLASEIN--SQKLNNEQNSEKSVLF------NGISNLDVNTAVRY 588
            ++  Q+ ++++ F SL S++N      NN +N+EK   F         ++ D    ++Y
Sbjct: 565 QLSIHQLNTLKSQFLSLYSKVNHIEGVTNNARNAEKKNSFLLCTDHMSFNDEDGKNFIKY 624

Query: 589 --TPKTRTLIPQHELLKRQHEITRTLEQEYTDRQAQSIVLPSNE---DEAPTQVSNDENR 643
             +P  +  I   ELLKR+    + +EQ    +   SI +P NE    E+  Q  +    
Sbjct: 625 SVSPDKKDKITTEELLKREEMFDQAMEQ--LQQVEYSIPIPENEIVVVESEQQEPSIPAA 682

Query: 644 NEVITSDPSQEEIEENKDEVITLRKRQSQSNNKRKTI----SPPASHEIMDYAAGSDLLN 699
           N  IT+  +  + +E+ DE+I L+K       KR+            E++DY+    +L+
Sbjct: 683 NAEITTAVASRK-KEDLDEIIVLKKTNRNKGKKRERKHSDDDDEGEIEVIDYSKMEKVLD 741

Query: 700 ST----KNNTNSQKHKKRRFDPYSVEHVGPQPIXXXXXXXXXXNVSFKR 744
           ++      N N+  +K++RFDPY+V + GP+            NVSFKR
Sbjct: 742 NSNTKRNQNKNNNGNKRKRFDPYNVNNEGPRAPKKRKAMTRGKNVSFKR 790

>TDEL0G04440 Chr7 (805881..808088) [2208 bp, 735 aa] {ON} Anc_6.25
           YOR001W
          Length = 735

 Score =  665 bits (1716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/674 (51%), Positives = 461/674 (68%), Gaps = 27/674 (4%)

Query: 1   MSSEDKDTLLSSLVQTVRSSSALAAQDIDFYKSLDSNINASLEDTXXXXXXXXXXXXXXX 60
           M   ++D LL  +V T+R+SSALAAQD+DF++SL   I  SL++T               
Sbjct: 1   MPPAEEDQLLRKVVDTIRASSALAAQDVDFHRSLSRPIGKSLDETSTRMVSLINSLLSSI 60

Query: 61  XXXXXVIQQGKDSFVDSWKSISNIMDNLFEKSDHALDNIRXXXXXXXXXPSLKYLNDDDR 120
                 + +GK++  + WK  SN+MDNLFE SD + D +            LK+L++   
Sbjct: 61  DQNSEPLVEGKETLNEYWKDFSNMMDNLFELSDCSADILTRAPGSRKDGEKLKFLDNSSS 120

Query: 121 SNNKPSKRIEKPQLSFKTPVDNTELHPFKPLLEYKPHSLQPFEISLKMVPEEESIPSHYP 180
           +++ PSKRI KPQL+FK PV+NTE+ PF PLL+ KP +L+P  IS  +VP  +++P HY 
Sbjct: 121 NDSIPSKRISKPQLNFKNPVNNTEIQPFVPLLKEKPFALRPL-IS-DIVPGNDAVPEHYA 178

Query: 181 HPYEYEIDHQKYNDSILVATEPIPSKDWDETEAIWVDTVEGLNKMKDELSKATELAIDLE 240
            PYEYEI+HQ+Y +S++V +EPIPSK W+ TEA+WVD +E L  M  +L   TE+A+DLE
Sbjct: 179 QPYEYEIEHQEYGESVIVKSEPIPSKPWETTEALWVDNIEVLKTMISDLKSVTEIAVDLE 238

Query: 241 HHDYRSYYGIVCLMQISDREHDWIVDTIALREELYILNDIFTDPNVTKVLHGAFMDIIWL 300
           HHDYRSYYGIVCLMQIS RE D+++DTIALR++L ILN++F +P + KV HGAFMDIIWL
Sbjct: 239 HHDYRSYYGIVCLMQISTRERDYLIDTIALRDDLQILNEVFANPKILKVFHGAFMDIIWL 298

Query: 301 QRDLGLYIVGLFDTYHASRMLGFPKHSLAYLLERFANFKTSKKYQLADWRIRPLTKPMLA 360
           QRDLGLY+V LFDT+HASR +G P+HSLAYLLE+FANFKTSKKYQLADWR+RPL+K M A
Sbjct: 299 QRDLGLYVVSLFDTFHASRAIGLPRHSLAYLLEKFANFKTSKKYQLADWRLRPLSKAMNA 358

Query: 361 YARADTHFLLNIFDKLRNSLLEQNKMSDVLHESRKVAKRRFEYSSFRPKVPSSAVFSPIE 420
           YARADTHFLLNI+D+LRN+L+EQNK++ VL ESR VAKRRFEYS FRP  PS  V+ PI+
Sbjct: 359 YARADTHFLLNIYDQLRNTLIEQNKLAGVLAESRNVAKRRFEYSKFRPIAPSPTVYCPID 418

Query: 421 KDEPWKNIMFQYNIPASKELLLRRLYEWRDTIARRDDESPRYVMPNQLLVSLVAGAPTEP 480
           K +PWK +MFQY+I  ++E L+++LY+WRDTIARRDDESPRYVMPNQLLV L   APTEP
Sbjct: 419 KPDPWKVLMFQYSISPNREELVKKLYDWRDTIARRDDESPRYVMPNQLLVELARQAPTEP 478

Query: 481 INVLSVSSYVSEHLRTNSKVIANLIKRTLEDLKGNSNSSAIPLLESAESNGTDLANIITT 540
           INV+SV+S V++H+R+NS V+A+LIK TL      S+         A++N TD A+++T 
Sbjct: 479 INVISVNSIVTDHVRSNSLVLAHLIKNTLASSDKESDKGTF----EADNNSTDAASLLTV 534

Query: 541 SQIKSIQNIFHSLASEINSQKLNNE-QNSEKSVLFNGISNLDVNTAVRYTPKTRTLIPQH 599
            QI+ +   F  ++       L NE ++   S +F  I   + + AV Y       I + 
Sbjct: 535 PQIQKLAACFAGVSRAFTI--LQNEYKDGRSSSIFTDILTSE-DDAVNYVGNNMDHITKK 591

Query: 600 ELLKRQHEITRTLEQEYTDRQAQSIVLPSNEDEAPTQVSNDENRNEVITSDPSQEEI--- 656
           EL KR  +  +++EQ     +A S  +P  E      ++ + N  E I   P+ EE+   
Sbjct: 592 ELGKRAAKALQSMEQF---DEATSYYMPIPE------IAKESNTMEEIRP-PAPEEVKES 641

Query: 657 ----EENKDEVITL 666
               +E+ DE+ITL
Sbjct: 642 PSPPKEDMDEIITL 655

>ZYRO0C07678g Chr3 (582236..584461) [2226 bp, 741 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 741

 Score =  660 bits (1704), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/766 (46%), Positives = 498/766 (65%), Gaps = 47/766 (6%)

Query: 1   MSSEDKDTLLSSLVQTVRSSSALAAQDIDFYKSLDSNINASLEDTXXXXXXXXXXXXXXX 60
           M+ E  + LL  +V TVR+++ALAAQD+DFY+SLD  +  SL+ T               
Sbjct: 1   MAEESNEQLLPKVVGTVRAAAALAAQDVDFYRSLDKGVAKSLDKTSNELVSMINSTLLCI 60

Query: 61  XXXXXVIQQGKDSFVDSWKSISNIMDNLFEKSDHALDNIRXXXXXXXXXPSLKYLNDDDR 120
                +++ GK+   DS K  SN+MDNLFEKSD +LD +R          +L YL+D  R
Sbjct: 61  DQNSRLLEGGKEKLEDSRKDFSNLMDNLFEKSDRSLDILRGRAPDRKGA-ALMYLDDAAR 119

Query: 121 SNNKPSKRIEKPQLSFKTPVDNTELHPFKPLLEYKPHSLQPFEISLKMVPEEESIPSHYP 180
           S+  P+KRI KPQ+ F+ P+DNTE HPFKPLLE KPH+L+P    +++V  +E IP HYP
Sbjct: 120 SDMIPAKRILKPQVRFQRPIDNTETHPFKPLLENKPHALRPLSDCVRLVQADEDIPEHYP 179

Query: 181 HPYEYEIDHQKYNDSILVATEPIPSKDWDETEAIWVDTVEGLNKMKDELSKATELAIDLE 240
            PYEYEI++Q+YN+SIL   EPIPSK WD +E +WVD  E L+ M  +L K+TE+A+DLE
Sbjct: 180 QPYEYEIENQEYNESILKIAEPIPSKPWDGSEPVWVDNKESLDSMLQDLKKSTEIAVDLE 239

Query: 241 HHDYRSYYGIVCLMQISDREHDWIVDTIALREELYILNDIFTDPNVTKVLHGAFMDIIWL 300
           HHDYRSYYGIVCLMQ+S R+ D++VDT+ALR++L +LN++F +P + KV HGAFMDIIWL
Sbjct: 240 HHDYRSYYGIVCLMQVSTRQTDYLVDTLALRDDLVVLNEVFANPLIVKVFHGAFMDIIWL 299

Query: 301 QRDLGLYIVGLFDTYHASRMLGFPKHSLAYLLERFANFKTSKKYQLADWRIRPLTKPMLA 360
           QRDLGLYIV LFDTYHASR LGFP+HSLAYLLE FA+FKTSKKYQLADWR+RPL+K M A
Sbjct: 300 QRDLGLYIVSLFDTYHASRALGFPRHSLAYLLETFASFKTSKKYQLADWRVRPLSKAMSA 359

Query: 361 YARADTHFLLNIFDKLRNSLLEQNKMSDVLHESRKVAKRRFEYSSFRPKVPSSAVFSPIE 420
           YARADTHFLLNI+D+LRN L+ +NK++ VL ESR VAKR F+YS +RPKVP+S+V+SP++
Sbjct: 360 YARADTHFLLNIYDQLRNKLIIENKLAGVLAESRNVAKRSFQYSKYRPKVPNSSVYSPVD 419

Query: 421 KDEPWKNIMFQYNIPASKELLLRRLYEWRDTIARRDDESPRYVMPNQLLVSLVAGAPTEP 480
           + + WK +M QYNIP  KE+L++ LYEWRDTIARRDDESPRYVMPNQLL  LV   P +P
Sbjct: 420 RADGWKVLMNQYNIPLEKEILVKNLYEWRDTIARRDDESPRYVMPNQLLAYLVDYTPLDP 479

Query: 481 INVLSVSSYVSEHLRTNSKVIANLIKRTLEDLKGNSNSSAIPLLESAESNGTDLANIITT 540
             V+SVS  V++H+RTN+K +ANLI ++L+ +    +   +  ++  + +  DL+ ++T 
Sbjct: 480 TGVISVSPTVTDHVRTNAKALANLIVKSLQQIADAGSDIKVESVQHKDQH--DLSQVLTV 537

Query: 541 SQIKSIQNIFHSLASEINS-QKLNNEQNSEKSVLFNGISNLDVNTAVRYTPKTRTLIPQH 599
            QI+S  + FH L+       +  N  NS  S++F  I +      V Y    +  +   
Sbjct: 538 GQIESQVSQFHDLSKAFKGLSQGTNSSNSSSSIIFGNILHAPCGF-VGYGRSLKKPVTDK 596

Query: 600 ELLKRQHEITRTLEQEYTDRQAQSIVLPSNEDEAPTQVSNDENRNEVITSDPSQE-EIEE 658
           ++ KR+ E++  L  E+ D +  + +              +E+R   +T +P+ + ++ E
Sbjct: 597 QIEKRKLELSEAL--EFIDAETATTI-------------QEEDRGSELTHEPADDKKVSE 641

Query: 659 N----------------KDEVITLRKRQSQS-NNKRKTISPPASHEIMDYAAGSDLLNST 701
           N                K+E+ITL+K + +   +KR   S P   E +DY     +L + 
Sbjct: 642 NDESKKEEAKETEPEEDKNEIITLKKVKDRGKKSKRSNESEP--EEPIDYKKSKKILETE 699

Query: 702 KNNTNSQKHKKRRFDPYSVEH---VGPQPIXXXXXXXXXXNVSFKR 744
           K + +++   KR FDPY+  +     P+P           + SFKR
Sbjct: 700 KKSKSTK---KRAFDPYAASNDAGNAPKP-KKKRRMARGKSASFKR 741

>CAGL0E02585g Chr5 (246427..248640) [2214 bp, 737 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001w RRP6
          Length = 737

 Score =  656 bits (1692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/748 (47%), Positives = 489/748 (65%), Gaps = 15/748 (2%)

Query: 1   MSSEDKDTLLSSLVQTVRSSSALAAQDIDFYKSLDSNINASLEDTXXXXXXXXXXXXXXX 60
           MSS+  D +L  +++TVR+S+ALA+QD++F+KS+D+++  SLE +               
Sbjct: 1   MSSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSI 60

Query: 61  XXXXXVIQQGKDSFVDSWKSISNIMDNLFEKSDHALDNIRXXXXXXXXXPSLKYLNDDDR 120
                 +    ++  +  K  SN+MD LFEK+D +LD +           ++++L+D + 
Sbjct: 61  DNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNV 120

Query: 121 SNNKPSKRIEKPQLSFKTPVDNTELHPFKPLLEYKPHSLQPFEISLKMVPEEESIPSHYP 180
           + N PS+RI KPQL+FKTPVDN+E HPFKPLL  KP++L+  E S ++V   E IP H+ 
Sbjct: 121 AENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQ 180

Query: 181 HPYEYEIDHQKYNDSILVATEPIPSKDWDETEAIWVDTVEGLNKMKDELSKATELAIDLE 240
            PYEYEI +Q+YN+ IL   EPIPS  W +T AIWVD +  L  M  EL K++E+A+DLE
Sbjct: 181 QPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLE 240

Query: 241 HHDYRSYYGIVCLMQISDREHDWIVDTIALREELYILNDIFTDPNVTKVLHGAFMDIIWL 300
           HHD+RSYYG+VCLMQIS R  D+IVDTIALR++L +LN++FT+P +TKV HGAFMDIIWL
Sbjct: 241 HHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWL 300

Query: 301 QRDLGLYIVGLFDTYHASRMLGFPKHSLAYLLERFANFKTSKKYQLADWRIRPLTKPMLA 360
           QRDLGLYIV LFDT+HAS+ LG PKHSLAYLLE++ANFKTSKKYQLADWR RPL+K M+A
Sbjct: 301 QRDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMA 360

Query: 361 YARADTHFLLNIFDKLRNSLLEQNKMSDVLHESRKVAKRRFEYSSFRPKVPSSAVFSPIE 420
           YARADTHFLLNIFD++RN L+   K++ VL ESR VA RRFEYS ++PK+P + +F+P+E
Sbjct: 361 YARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVE 420

Query: 421 KDEPWKNIMFQYNIPASKELLLRRLYEWRDTIARRDDESPRYVMPNQLLVSLVAGAPTEP 480
           K+ PW+ +M+QYNIP  KE L+R LYEWRD +ARRDDESPRYVMPNQLLVSLVA  P +P
Sbjct: 421 KESPWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDP 480

Query: 481 INVLSVSSYVSEHLRTNSKVIANLIKRTLEDLKGNSNSSAIPLLESAESNGTDLANIITT 540
           I+V+SVSS V++H+R NSK +ANLIK+ LE++K     S    L S+     D    + +
Sbjct: 481 ISVVSVSSVVTDHVRRNSKTLANLIKKKLEEIKLGEVKSINNRLPSSLDVSQDELQFLPS 540

Query: 541 SQIKSIQNIFHSLASEINSQKLNNEQNSEKSVLFNGISNLDVNTAVRYTPKTRTLIPQHE 600
            +I+ +   F  + +++ +Q   ++Q    SV+ + I  L    AV+Y   +   + + E
Sbjct: 541 HKIELMTGAFKEIENQL-TQATKSKQAMTSSVVLSEIL-LHPEHAVKYHNGSACSVEESE 598

Query: 601 LLKRQHE-ITRTLEQEYTDRQAQSIVLPSNEDEAPTQVSNDENRNEVITSDPSQ--EEIE 657
           L  R    I  TL       +  ++VL ++   AP +     N+     SD  Q   E +
Sbjct: 599 LKDRYLSYIKATL---LAASKNINMVLETSNSNAPLETEETHNKK----SDQIQVIPEKQ 651

Query: 658 ENKDEVITLRKRQSQSNN-KRKTISPPASHEIMDYAAGSDLLNSTKNNTNSQKHKKRRFD 716
           E+ DE++ L+K++  SN+ K K        E +DY+  + L  ++ N    +K KKR FD
Sbjct: 652 EDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKANIL--ASDNREVKKKDKKRVFD 709

Query: 717 PYSVEHVGPQPIXXXXXXXXXXNVSFKR 744
           PYS    GP+             +SFK+
Sbjct: 710 PYSSTGEGPKAAKKRRLVTKGKKISFKK 737

>TBLA0A07170 Chr1 (1784984..1787299) [2316 bp, 771 aa] {ON} Anc_6.25
           YOR001W
          Length = 771

 Score =  656 bits (1692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/755 (45%), Positives = 483/755 (63%), Gaps = 20/755 (2%)

Query: 1   MSSEDKDTLLSSLVQTVRSSSALAAQDIDFYKSLDSNINASLEDTXXXXXXXXXXXXXXX 60
           MS ++ + LL ++V  VR+S+ALAAQD+DFYKSLD  ++ SL  T               
Sbjct: 26  MSEDNCEELLENIVGVVRASTALAAQDVDFYKSLDKKVSDSLNKTANDTLDIANSLLLSI 85

Query: 61  XXXXXVIQQGKDSFVDSWKSISNIMDNLFEKSDHALDNIRXXXXXXXXXPSLKYLNDDDR 120
                 +++GKD   D W   SNIMDNL EKSDH +D +              +L+++ R
Sbjct: 86  DENCSPLEEGKDRIPDFWNGFSNIMDNLIEKSDHFIDALSKPNNFNGKYNETTFLDNNSR 145

Query: 121 SNNKPSKRIEKPQLSFKTPVDNTELHPFKPLLEYKPHSLQPFEISLKMVPEEESIPSHYP 180
           +N+ PSKRIEKPQL F  PVDNT+  PFKPLL  KP++L+P + SL +VPE   +P+HY 
Sbjct: 146 TNSNPSKRIEKPQLLFSKPVDNTDSRPFKPLLVEKPNALKPLKDSLVLVPESGIVPTHYL 205

Query: 181 HPYEYEIDHQKYNDSILVATEPIPSKDWDETEAIWVDTVEGLNKMKDELSKATELAIDLE 240
            PYEYEID+Q+YN+ ++   +P P K W+ T AIW+DT E L  +  +L K +E+A+DLE
Sbjct: 206 QPYEYEIDNQEYNEEVVEIRDPTPYKPWETTSAIWIDTKESLADLLMDLRKQSEIAVDLE 265

Query: 241 HHDYRSYYGIVCLMQISDREHDWIVDTIALREELYILNDIFTDPNVTKVLHGAFMDIIWL 300
           HHD RSYYGI CLMQIS RE D+IVDTI+LR++L +LN+IFT+PN+TKV HGA MDIIWL
Sbjct: 266 HHDLRSYYGITCLMQISTREQDYIVDTISLRDDLIVLNEIFTNPNITKVFHGASMDIIWL 325

Query: 301 QRDLGLYIVGLFDTYHASRMLGFPKHSLAYLLERFANFKTSKKYQLADWRIRPLTKPMLA 360
           QRDLGLYIV LFDT+HAS+ LG  +HSLAYLLE +A+FKTSKKYQLADWR RPLT  MLA
Sbjct: 326 QRDLGLYIVSLFDTFHASKALGLARHSLAYLLENYASFKTSKKYQLADWRRRPLTNNMLA 385

Query: 361 YARADTHFLLNIFDKLRNSLLEQNKMSDVLHESRKVAKRRFEYSSFRPKVPSSAVFSPIE 420
           YAR+DTHFLLNIFD+LRN+L++QNK++ VLHESR VAKRRFEY  FRP VP   +++ IE
Sbjct: 386 YARSDTHFLLNIFDQLRNTLIKQNKLAGVLHESRNVAKRRFEYLKFRPTVPLPNLYTLIE 445

Query: 421 KDEPWKNIMFQYNIPASKELLLRRLYEWRDTIARRDDESPRYVMPNQLLVSLVAGAPTEP 480
           K+ PWK+++ QYNI   KE+L+++L+EWRD IARRDDESPRY+MP Q+L+SL++  PT+ 
Sbjct: 446 KEAPWKSLLIQYNIQDEKEILVQKLWEWRDMIARRDDESPRYIMPTQVLISLISYTPTDS 505

Query: 481 INVLSVSSYVSEHLRTNSKVIANLIKRTLEDLKGNSNSSAIPLLESAESNGTDLANIITT 540
             V+SVS+ V+EH+R+NS  +ANLIK+ LE  K   NSS      +     T++A++I+ 
Sbjct: 506 SGVISVSNMVTEHVRSNSTTLANLIKKALESTKSIPNSSDSSSTFNMSRTDTNVASLISI 565

Query: 541 SQIKSIQNIFHSLASEINSQKLNNEQNSEKSVLFNGISNLDVNTAVRYTPKTRTLIPQHE 600
           ++I +I   F+SL+   N+ K         S+LF+ I       +  Y+    T     +
Sbjct: 566 TEINNICLKFNSLSKHYNTSKFLTSGIEVSSLLFSNIMTSSPKIS-DYSKDKTTSFKSED 624

Query: 601 LLKRQHEITRTLEQEYTDRQAQSIVLPSNEDEAPTQVSNDENRNEVITSDP------SQE 654
           ++ R   ++  L+    +     I  P  ED    +++ +   N + T +P      + +
Sbjct: 625 MIARHIRLSEGLKGLSANNSF--IYQPPVEDIKSIEITTE---NPIPTLEPKSTQKKTTK 679

Query: 655 EIEENKDEVITLRK--RQSQSNNKRKTISPPASHEIMDYAAGSDLLNSTKNNTNSQKHKK 712
           EI E+ +E+I L+K  R+ Q   K K  +   S  ++DY+    +        N    K+
Sbjct: 680 EINEDNEEIIVLKKVNRKYQ---KGKKDADKDSTVVVDYSKAKKIFQKKDETINGNSKKR 736

Query: 713 RRFDPYSVEHVG---PQPIXXXXXXXXXXNVSFKR 744
           + FDPY+ +      P+ +          N+S+KR
Sbjct: 737 KSFDPYNNDGDTDKVPRALKKRQTNTRGKNISYKR 771

>Skud_15.162 Chr15 (286822..289026) [2205 bp, 734 aa] {ON} YOR001W
           (REAL)
          Length = 734

 Score =  653 bits (1684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/751 (47%), Positives = 476/751 (63%), Gaps = 24/751 (3%)

Query: 1   MSSEDKDTLLSSLVQTVRSSSALAAQDIDFYKSLDSNINASLEDTXXXXXXXXXXXXXXX 60
           M SE+ D L S +V+ VR++S+LA+QD+DFYK+L+   +  L+                 
Sbjct: 1   MPSENPDVLFSKIVKVVRAASSLASQDVDFYKNLEREFSNVLKSKSDKLTDMVNEIILSI 60

Query: 61  XXXXXVIQQGKDSFVDSWKSISNIMDNLFEKSDHALDNIRXXXXXXXXXPSLKYLNDDDR 120
                  +  +D     WK   NIMDNL E SDH+LD +            L+YL D   
Sbjct: 61  DEHHESFELKEDEISGLWKDFGNIMDNLLEMSDHSLDKLNHTANSKVSGAELQYLGDFSG 120

Query: 121 SNNKPSKRIEKPQLSFKTPVDNTELHPFKPLLEYKPHSLQPFEISLKMVPEEESIPSHYP 180
            ++  +KR+EKPQL FK  +DN+E HPF PLL+ KP++L+P   SL++   EE+ PSHY 
Sbjct: 121 KDSLSTKRLEKPQLKFKKSIDNSESHPFIPLLKEKPNALKPLSESLRLAEAEENNPSHYL 180

Query: 181 HPYEYEIDHQKYNDSILVATEPIPSKDWDETEAIWVDTVEGLNKMKDELSKATELAIDLE 240
           HPY YEIDHQ+Y+  +L   + IPSK WD++E IW+DT   L  M ++L  A+E+A+DLE
Sbjct: 181 HPYAYEIDHQEYSSDVLQIKKEIPSKSWDDSEPIWIDTKTKLGLMLEDLKNASEIAVDLE 240

Query: 241 HHDYRSYYGIVCLMQISDREHDWIVDTIALREELYILNDIFTDPNVTKVLHGAFMDIIWL 300
           HHDYRSYYGIVCLMQ+S RE D++VDTI LR+ L+ILN++FTDP + KV HGAFMDIIWL
Sbjct: 241 HHDYRSYYGIVCLMQVSTRERDYLVDTIELRDALHILNEVFTDPLIVKVFHGAFMDIIWL 300

Query: 301 QRDLGLYIVGLFDTYHASRMLGFPKHSLAYLLERFANFKTSKKYQLADWRIRPLTKPMLA 360
           QRDLGLY+VGLFDTYHAS+ +G P+HSLAYLLE FANFKTSKKYQLADWR RPL+KPM A
Sbjct: 301 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRARPLSKPMTA 360

Query: 361 YARADTHFLLNIFDKLRNSLLEQNKMSDVLHESRKVAKRRFEYSSFRPKVPSSAVFSPIE 420
           YARADTHFLLNI+D+LRN L+E NK++ VL+ESR VAKRRFEYS  RP+ PSS V+SPIE
Sbjct: 361 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKHRPRTPSSEVYSPIE 420

Query: 421 KDEPWKNIMFQYNIPASKELLLRRLYEWRDTIARRDDESPRYVMPNQLLVSLVAGAPTEP 480
           K+ PW+ +M+QYNI + KE L++ LY WRD IARRDDESPR+VMPNQLL +LVA AP + 
Sbjct: 421 KENPWRVLMYQYNITSEKEELVKDLYLWRDFIARRDDESPRFVMPNQLLAALVAYAPIDV 480

Query: 481 INVLSVSSYVSEHLRTNSKVIANLIKRTLEDLK-GNSNSSAIPLLESAESNGTDLANIIT 539
           I V+S+++ V+EH+R N+KV+ANLI+  L ++K  N  +++I   ES + +G  L  +IT
Sbjct: 481 IGVVSLTNGVTEHVRQNAKVLANLIENALGNIKDTNKKTTSITSSES-KPDGISL-EVIT 538

Query: 540 TSQIKSIQNIFHSLASEINSQKLNNE---QNSEKSVLFNGISNLDVNTAVRYTPK-TRTL 595
            SQI+ I   F  L+   NS  +NN     +S  S+L       +    + Y  K T   
Sbjct: 539 ISQIRDIMERFSLLS---NSGVINNRTKTGDSTSSILLGKTLPFE-ECGISYGKKGTPNK 594

Query: 596 IPQHELLKRQHEITRTLEQEYTDRQAQSIVLPSNEDEAPTQVSNDENRNEV--ITSDPSQ 653
           +   ++  R  +    L         ++I+    E E P  V     + E   I S P  
Sbjct: 595 VKVEDIKARAQKFNSALA------GLENIMF---ELEKPVTVPASVEKGEAVEIESAPEL 645

Query: 654 EEIEENKDEVITLRKRQSQSNNKRKTISPPASHEIMDYAAGSDLLNSTKNNTNSQKHKKR 713
               E+ D++I L+K++       K        E +DY+    +L S+K   N ++ +KR
Sbjct: 646 PSKAESFDDIIVLKKKKMHKKQPAKG-KDMTVKEAVDYSKMPSVL-SSKPGQNRKQQRKR 703

Query: 714 RFDPYSVEHVGPQPIXXXXXXXXXXNVSFKR 744
           RFDP S +  GP+            N+SFKR
Sbjct: 704 RFDPSSNDSEGPRAAKKKRPAPRGKNMSFKR 734

>SAKL0H25168g Chr8 complement(2188094..2196112) [8019 bp, 2672 aa]
            {ON} similar to uniprot|P33892 Saccharomyces cerevisiae
            YGL195W GCN1 Positive regulator of the Gcn2p kinase
            activity forms a complex with Gcn20p proposed to
            stimulate Gcn2p activation by an uncharged tRNA
          Length = 2672

 Score = 32.7 bits (73), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 51/114 (44%), Gaps = 11/114 (9%)

Query: 431  QYNIPASKELLLRRLYEWRDTI------ARRDDESPRYVMPNQLLVSLVAGAPTEPINVL 484
            +YN   SK+++     E RD I       R D           +  +LV   P     +L
Sbjct: 1811 EYNGEISKQMVTVLGQERRDRILSALFACRSDTSGIVRATTVDIWKALVPNTPRTIKEIL 1870

Query: 485  -SVSSYVSEHLRTNSKVIANLIKRTLEDL----KGNSNSSAIPLLESAESNGTD 533
             +++S +  HL ++S+ +  +  +TL DL     GN+ S  +P LE +  N TD
Sbjct: 1871 PTLTSIIVVHLASSSRALRTIAAQTLGDLVRRVGGNALSQLLPTLEESLENSTD 1924

>KAFR0G00420 Chr7 (122124..123248) [1125 bp, 374 aa] {ON} Anc_8.860
          Length = 374

 Score = 31.6 bits (70), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 22/49 (44%)

Query: 325 KHSLAYLLERFANFKTSKKYQLADWRIRPLTKPMLAYARADTHFLLNIF 373
           K  L  L     NF  + +YQ+A W+ R   +    +   D HF  NIF
Sbjct: 114 KGDLMNLFSEDTNFIENSRYQVALWKYRKRNRQSSCFGLNDIHFCRNIF 162

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.130    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 82,263,106
Number of extensions: 3919618
Number of successful extensions: 18233
Number of sequences better than 10.0: 461
Number of HSP's gapped: 19242
Number of HSP's successfully gapped: 481
Length of query: 744
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 627
Effective length of database: 40,065,477
Effective search space: 25121054079
Effective search space used: 25121054079
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 70 (31.6 bits)