Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D01287g6.26ON34534518280.0
Kwal_56.224436.26ON2802177549e-99
SAKL0E01408g6.26ON3072097516e-98
KLTH0C11110g6.26ON2802327322e-95
ACR001C6.26ON3462307373e-95
Ecym_30296.26ON3512277365e-95
TDEL0G044306.26ON3472417182e-92
Kpol_1037.306.26ON3672637037e-90
CAGL0E02541g6.26ON3422186903e-88
ZYRO0C07634g6.26ON3822326847e-87
TBLA0A071606.26ON2682216651e-85
TPHA0J003806.26ON3562366722e-85
KNAG0I017506.26ON3242576614e-84
YOL001W (PHO80)6.26ON2932406523e-83
Suva_15.1746.26ON2952596499e-83
Skud_15.1616.26ON2932456499e-83
Smik_15.1696.26ON2912226393e-81
NCAS0D021506.26ON3692165569e-68
NDAI0C026406.26ON4272275131e-60
Smik_9.1407.240ON2851792164e-19
Suva_9.1497.240ON2861792051e-17
Skud_9.1197.240ON2851602042e-17
YIL050W (PCL7)7.240ON2851572023e-17
Kwal_23.58077.240ON4651261904e-15
KLTH0A04268g7.240ON5801141905e-15
KNAG0D016307.240ON4381331852e-14
Ecym_43367.240ON3851251823e-14
ADL075W7.240ON2071161737e-14
CAGL0M12342g7.240ON4571261772e-13
SAKL0F08602g7.240ON4741211753e-13
NCAS0A134807.240ON4481571744e-13
NCAS0E032207.240ON3411771709e-13
KAFR0I018407.240ON3251181672e-12
TPHA0C010907.240ON3852131673e-12
KLLA0C08305g7.240ON4091371673e-12
NDAI0A025607.240ON5031111674e-12
KAFR0L008807.240ON3131091628e-12
KNAG0L014707.240ON3541371566e-11
TDEL0H020207.240ON3631811452e-09
ZYRO0C08118g7.240ON4051381363e-08
TBLA0D040707.240ON661601283e-07
YER059W (PCL6)7.240ON420591273e-07
Smik_5.1897.240ON415521264e-07
Suva_5.1677.240ON424521264e-07
Skud_5.1737.240ON420601256e-07
Kpol_1033.137.240ON250601211e-06
Kpol_2000.147.289ON3101091165e-06
TBLA0C048507.289ON368971122e-05
TPHA0P008107.289ON2471151102e-05
NDAI0E047707.240ON303501094e-05
YDL127W (PCL2)7.289ON3081131077e-05
Smik_7.1386.236ON4371371087e-05
Kwal_56.241516.236ON4801401061e-04
SAKL0F09856g7.289ON3351381051e-04
Suva_4.1187.289ON3091461051e-04
Smik_4.1107.289ON3081131042e-04
TBLA0J006507.289ON3631301052e-04
NCAS0A137707.289ON3121261032e-04
Suva_14.503.70ON2791011023e-04
CAGL0E02233g3.70ON2661391014e-04
Kpol_1020.87.289ON2961121006e-04
Skud_7.1396.236ON4341061007e-04
CAGL0J09328g7.289ON297103997e-04
ZYRO0C09284g7.289ON311113980.001
Skud_4.1287.289ON308111970.001
AFR159C7.289ON308130960.002
Smik_14.423.70ON279104950.002
KNAG0B029307.289ON31280950.002
Skud_14.483.70ON279106950.002
YNL289W (PCL1)3.70ON279104940.003
SAKL0C12100g3.70ON314125940.003
YGL134W (PCL10)6.236ON433108940.004
KNAG0F018706.236ON48394940.004
TBLA0A078903.70ON361106930.005
NCAS0D040706.236ON473109930.005
NDAI0A022707.289ON330104920.006
TDEL0H015507.289ON309153920.006
Suva_7.1306.236ON442108920.006
NDAI0I008606.236ON543120920.007
YDL179W (PCL9)7.289ON30487910.008
Ecym_35353.70ON370128900.009
Kwal_23.60067.289ON30493900.009
KLLA0B02024g6.236ON527102910.010
ZYRO0E07326g6.236ON428119900.010
TBLA0A021006.236ON57496910.010
Suva_4.687.289ON305106890.011
KLTH0A05346g7.289ON301118890.012
Ecym_80387.289ON314115880.015
KLLA0E13223g3.70ON282125880.015
Skud_4.797.289ON309127880.016
TPHA0A005803.70ON289113880.018
KNAG0A014903.70ON26288860.026
KAFR0A082803.70ON24198840.037
KAFR0K023856.236ON40895850.045
SAKL0A03938g6.236ON50191840.067
ZYRO0C02068g3.70ON330106830.068
Kpol_1020.163.70ON28292820.096
KAFR0C015603.70ON26784800.15
NCAS0A098703.70ON29483800.15
CAGL0H08998g6.236ON547101810.15
TPHA0E027506.236ON605104810.16
AEL195W3.70ON237108790.19
TDEL0E007903.70ON25497790.21
Smik_4.607.289ON30586780.25
KLLA0F05654g7.289ON311125770.40
NDAI0F014806.236ON490107770.51
NDAI0A060503.70ON28683750.68
Skud_10.2275.229ON70077750.77
NCAS0E023707.46ON897108750.91
Skud_16.606.236ON500160741.00
NDAI0C043005.347ON240103731.0
Kpol_1005.175.347ON319103741.0
TDEL0E028005.347ON19990711.6
CAGL0E05918g6.236ON48192712.2
KLTH0B05368g2.143ON931133722.3
YJR005W (APL1)5.229ON70074712.6
TPHA0A032507.289ON28955667.4
AFL115W6.236ON38693677.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D01287g
         (345 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D01287g Chr4 (112866..113903) [1038 bp, 345 aa] {ON} simila...   708   0.0  
Kwal_56.22443 s56 (131419..132261) [843 bp, 280 aa] {ON} YOL001W...   295   9e-99
SAKL0E01408g Chr5 (106229..107152) [924 bp, 307 aa] {ON} similar...   293   6e-98
KLTH0C11110g Chr3 complement(914257..915099) [843 bp, 280 aa] {O...   286   2e-95
ACR001C Chr3 complement(357962..359002) [1041 bp, 346 aa] {ON} S...   288   3e-95
Ecym_3029 Chr3 (56667..57722) [1056 bp, 351 aa] {ON} similar to ...   288   5e-95
TDEL0G04430 Chr7 (804428..805471) [1044 bp, 347 aa] {ON} Anc_6.2...   281   2e-92
Kpol_1037.30 s1037 complement(72024..73127) [1104 bp, 367 aa] {O...   275   7e-90
CAGL0E02541g Chr5 (244814..245842) [1029 bp, 342 aa] {ON} simila...   270   3e-88
ZYRO0C07634g Chr3 (580486..581634) [1149 bp, 382 aa] {ON} simila...   268   7e-87
TBLA0A07160 Chr1 (1782941..1783747) [807 bp, 268 aa] {ON} Anc_6....   260   1e-85
TPHA0J00380 Chr10 complement(84485..85555) [1071 bp, 356 aa] {ON...   263   2e-85
KNAG0I01750 Chr9 (344381..345355) [975 bp, 324 aa] {ON} Anc_6.26...   259   4e-84
YOL001W Chr15 (325249..326130) [882 bp, 293 aa] {ON}  PHO80Cycli...   255   3e-83
Suva_15.174 Chr15 (299761..300648) [888 bp, 295 aa] {ON} YOL001W...   254   9e-83
Skud_15.161 Chr15 (284851..285732) [882 bp, 293 aa] {ON} YOL001W...   254   9e-83
Smik_15.169 Chr15 (292553..293428) [876 bp, 291 aa] {ON} YOL001W...   250   3e-81
NCAS0D02150 Chr4 (400750..401859) [1110 bp, 369 aa] {ON} Anc_6.26     218   9e-68
NDAI0C02640 Chr3 complement(611899..613182) [1284 bp, 427 aa] {O...   202   1e-60
Smik_9.140 Chr9 (233007..233864) [858 bp, 285 aa] {ON} YIL050W (...    88   4e-19
Suva_9.149 Chr9 (247583..248443) [861 bp, 286 aa] {ON} YIL050W (...    84   1e-17
Skud_9.119 Chr9 (227792..228649) [858 bp, 285 aa] {ON} YIL050W (...    83   2e-17
YIL050W Chr9 (258913..259770) [858 bp, 285 aa] {ON}  PCL7Pho85p ...    82   3e-17
Kwal_23.5807 s23 (1326104..1327501) [1398 bp, 465 aa] {ON} YIL05...    78   4e-15
KLTH0A04268g Chr1 (358035..359777) [1743 bp, 580 aa] {ON} simila...    78   5e-15
KNAG0D01630 Chr4 (274260..275576) [1317 bp, 438 aa] {ON} Anc_7.2...    76   2e-14
Ecym_4336 Chr4 complement(720123..721280) [1158 bp, 385 aa] {ON}...    75   3e-14
ADL075W Chr4 (550941..551564) [624 bp, 207 aa] {ON} Syntenic hom...    71   7e-14
CAGL0M12342g Chr13 complement(1234192..1235565) [1374 bp, 457 aa...    73   2e-13
SAKL0F08602g Chr6 (657898..659322) [1425 bp, 474 aa] {ON} simila...    72   3e-13
NCAS0A13480 Chr1 complement(2653843..2655189) [1347 bp, 448 aa] ...    72   4e-13
NCAS0E03220 Chr5 complement(639650..640675) [1026 bp, 341 aa] {O...    70   9e-13
KAFR0I01840 Chr9 (376802..377779) [978 bp, 325 aa] {ON} Anc_7.24...    69   2e-12
TPHA0C01090 Chr3 complement(247987..249144) [1158 bp, 385 aa] {O...    69   3e-12
KLLA0C08305g Chr3 complement(728996..730225) [1230 bp, 409 aa] {...    69   3e-12
NDAI0A02560 Chr1 (571529..573040) [1512 bp, 503 aa] {ON} Anc_7.2...    69   4e-12
KAFR0L00880 Chr12 (163476..164417) [942 bp, 313 aa] {ON} Anc_7.2...    67   8e-12
KNAG0L01470 Chr12 (259883..260947) [1065 bp, 354 aa] {ON} Anc_7....    65   6e-11
TDEL0H02020 Chr8 complement(346307..347398) [1092 bp, 363 aa] {O...    60   2e-09
ZYRO0C08118g Chr3 (621320..622537) [1218 bp, 405 aa] {ON} simila...    57   3e-08
TBLA0D04070 Chr4 complement(1012284..1014269) [1986 bp, 661 aa] ...    54   3e-07
YER059W Chr5 (272624..273886) [1263 bp, 420 aa] {ON}  PCL6Pho85p...    54   3e-07
Smik_5.189 Chr5 (276775..278022) [1248 bp, 415 aa] {ON} YER059W ...    53   4e-07
Suva_5.167 Chr5 (248778..250052) [1275 bp, 424 aa] {ON} YER059W ...    53   4e-07
Skud_5.173 Chr5 (268792..270054) [1263 bp, 420 aa] {ON} YER059W ...    53   6e-07
Kpol_1033.13 s1033 (30454..31206) [753 bp, 250 aa] {ON} (30454.....    51   1e-06
Kpol_2000.14 s2000 (24019..24951) [933 bp, 310 aa] {ON} (24019.....    49   5e-06
TBLA0C04850 Chr3 complement(1175677..1176783) [1107 bp, 368 aa] ...    48   2e-05
TPHA0P00810 Chr16 complement(165632..166375) [744 bp, 247 aa] {O...    47   2e-05
NDAI0E04770 Chr5 (1073112..1074023) [912 bp, 303 aa] {ON} Anc_7....    47   4e-05
YDL127W Chr4 (234927..235853) [927 bp, 308 aa] {ON}  PCL2Cyclin,...    46   7e-05
Smik_7.138 Chr7 (249640..250953) [1314 bp, 437 aa] {ON} YGL134W ...    46   7e-05
Kwal_56.24151 s56 complement(874353..875795) [1443 bp, 480 aa] {...    45   1e-04
SAKL0F09856g Chr6 complement(756909..757916) [1008 bp, 335 aa] {...    45   1e-04
Suva_4.118 Chr4 (223497..224426) [930 bp, 309 aa] {ON} YDL127W (...    45   1e-04
Smik_4.110 Chr4 (211556..212482) [927 bp, 308 aa] {ON} YDL127W (...    45   2e-04
TBLA0J00650 Chr10 complement(152884..153975) [1092 bp, 363 aa] {...    45   2e-04
NCAS0A13770 Chr1 complement(2704299..2705237) [939 bp, 312 aa] {...    44   2e-04
Suva_14.50 Chr14 (84601..85440) [840 bp, 279 aa] {ON} YNL289W (R...    44   3e-04
CAGL0E02233g Chr5 (215934..216734) [801 bp, 266 aa] {ON} similar...    44   4e-04
Kpol_1020.8 s1020 (18215..19105) [891 bp, 296 aa] {ON} (18215..1...    43   6e-04
Skud_7.139 Chr7 (260060..261364) [1305 bp, 434 aa] {ON} YGL134W ...    43   7e-04
CAGL0J09328g Chr10 (920703..921596) [894 bp, 297 aa] {ON} simila...    43   7e-04
ZYRO0C09284g Chr3 complement(706160..707095) [936 bp, 311 aa] {O...    42   0.001
Skud_4.128 Chr4 (230632..231558) [927 bp, 308 aa] {ON} YDL127W (...    42   0.001
AFR159C Chr6 complement(723082..724008) [927 bp, 308 aa] {ON} Sy...    42   0.002
Smik_14.42 Chr14 (72224..73063) [840 bp, 279 aa] {ON} YNL289W (R...    41   0.002
KNAG0B02930 Chr2 (563319..564257) [939 bp, 312 aa] {ON} Anc_7.28...    41   0.002
Skud_14.48 Chr14 (81435..82274) [840 bp, 279 aa] {ON} YNL289W (R...    41   0.002
YNL289W Chr14 (87897..88736) [840 bp, 279 aa] {ON}  PCL1Cyclin, ...    41   0.003
SAKL0C12100g Chr3 complement(1083684..1084628) [945 bp, 314 aa] ...    41   0.003
YGL134W Chr7 (255663..256964) [1302 bp, 433 aa] {ON}  PCL10Pho85...    41   0.004
KNAG0F01870 Chr6 (356849..358300) [1452 bp, 483 aa] {ON} Anc_6.2...    41   0.004
TBLA0A07890 Chr1 (1943543..1944628) [1086 bp, 361 aa] {ON} Anc_3...    40   0.005
NCAS0D04070 Chr4 (764711..766132) [1422 bp, 473 aa] {ON} Anc_6.236     40   0.005
NDAI0A02270 Chr1 (511135..512127) [993 bp, 330 aa] {ON} Anc_7.289      40   0.006
TDEL0H01550 Chr8 (266510..267439) [930 bp, 309 aa] {ON} Anc_7.28...    40   0.006
Suva_7.130 Chr7 (251870..253198) [1329 bp, 442 aa] {ON} YGL134W ...    40   0.006
NDAI0I00860 Chr9 complement(197860..199491) [1632 bp, 543 aa] {O...    40   0.007
YDL179W Chr4 (138291..139205) [915 bp, 304 aa] {ON}  PCL9Cyclin,...    40   0.008
Ecym_3535 Chr3 (1015509..1016621) [1113 bp, 370 aa] {ON} similar...    39   0.009
Kwal_23.6006 s23 complement(1411337..1412251) [915 bp, 304 aa] {...    39   0.009
KLLA0B02024g Chr2 (176585..178168) [1584 bp, 527 aa] {ON} some s...    40   0.010
ZYRO0E07326g Chr5 complement(560064..561350) [1287 bp, 428 aa] {...    39   0.010
TBLA0A02100 Chr1 complement(508272..509996) [1725 bp, 574 aa] {O...    40   0.010
Suva_4.68 Chr4 (125518..126435) [918 bp, 305 aa] {ON} YDL179W (R...    39   0.011
KLTH0A05346g Chr1 complement(445174..446079) [906 bp, 301 aa] {O...    39   0.012
Ecym_8038 Chr8 complement(87401..88345) [945 bp, 314 aa] {ON} si...    39   0.015
KLLA0E13223g Chr5 (1170139..1170987) [849 bp, 282 aa] {ON} simil...    39   0.015
Skud_4.79 Chr4 (134241..135170) [930 bp, 309 aa] {ON} YDL179W (R...    39   0.016
TPHA0A00580 Chr1 (101866..102735) [870 bp, 289 aa] {ON} Anc_3.70...    39   0.018
KNAG0A01490 Chr1 (62182..62970) [789 bp, 262 aa] {ON} Anc_3.70 Y...    38   0.026
KAFR0A08280 Chr1 complement(1661106..1661831) [726 bp, 241 aa] {...    37   0.037
KAFR0K02385 Chr11 complement(491679..492905) [1227 bp, 408 aa] {...    37   0.045
SAKL0A03938g Chr1 (367076..368581) [1506 bp, 501 aa] {ON} weakly...    37   0.067
ZYRO0C02068g Chr3 complement(163475..164467) [993 bp, 330 aa] {O...    37   0.068
Kpol_1020.16 s1020 complement(33477..34325) [849 bp, 282 aa] {ON...    36   0.096
KAFR0C01560 Chr3 complement(320148..320951) [804 bp, 267 aa] {ON...    35   0.15 
NCAS0A09870 Chr1 complement(1974028..1974912) [885 bp, 294 aa] {...    35   0.15 
CAGL0H08998g Chr8 (877952..879595) [1644 bp, 547 aa] {ON} weakly...    36   0.15 
TPHA0E02750 Chr5 (574999..576816) [1818 bp, 605 aa] {ON} Anc_6.2...    36   0.16 
AEL195W Chr5 (266347..267060) [714 bp, 237 aa] {ON} Syntenic hom...    35   0.19 
TDEL0E00790 Chr5 (163333..164097) [765 bp, 254 aa] {ON} Anc_3.70...    35   0.21 
Smik_4.60 Chr4 (115068..115985) [918 bp, 305 aa] {ON} YDL179W (R...    35   0.25 
KLLA0F05654g Chr6 (552056..552991) [936 bp, 311 aa] {ON} weakly ...    34   0.40 
NDAI0F01480 Chr6 (365467..366939) [1473 bp, 490 aa] {ON} Anc_6.2...    34   0.51 
NDAI0A06050 Chr1 complement(1372672..1373532) [861 bp, 286 aa] {...    33   0.68 
Skud_10.227 Chr10 (413450..415552) [2103 bp, 700 aa] {ON} YJR005...    33   0.77 
NCAS0E02370 Chr5 (464339..467032) [2694 bp, 897 aa] {ON} Anc_7.4...    33   0.91 
Skud_16.60 Chr16 (110205..111707) [1503 bp, 500 aa] {ON} YPL219W...    33   1.00 
NDAI0C04300 Chr3 (981107..981829) [723 bp, 240 aa] {ON}                33   1.0  
Kpol_1005.17 s1005 (29070..30029) [960 bp, 319 aa] {ON} (29070.....    33   1.0  
TDEL0E02800 Chr5 complement(539086..539685) [600 bp, 199 aa] {ON...    32   1.6  
CAGL0E05918g Chr5 complement(585960..587405) [1446 bp, 481 aa] {...    32   2.2  
KLTH0B05368g Chr2 complement(446569..449364) [2796 bp, 931 aa] {...    32   2.3  
YJR005W Chr10 (445923..448025) [2103 bp, 700 aa] {ON}  APL1Beta-...    32   2.6  
TPHA0A03250 Chr1 (717085..717954) [870 bp, 289 aa] {ON} Anc_7.28...    30   7.4  
AFL115W Chr6 (221235..222395) [1161 bp, 386 aa] {ON} Syntenic ho...    30   7.6  

>KLLA0D01287g Chr4 (112866..113903) [1038 bp, 345 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 345

 Score =  708 bits (1828), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/345 (100%), Positives = 345/345 (100%)

Query: 1   MESMNTIDPQKGSNIGQIIPLPEEYLRCSRTHLVVIISRMLSFLIQINDANNAGNQTMEL 60
           MESMNTIDPQKGSNIGQIIPLPEEYLRCSRTHLVVIISRMLSFLIQINDANNAGNQTMEL
Sbjct: 1   MESMNTIDPQKGSNIGQIIPLPEEYLRCSRTHLVVIISRMLSFLIQINDANNAGNQTMEL 60

Query: 61  TRFHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLNSLTVHRFLL 120
           TRFHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLNSLTVHRFLL
Sbjct: 61  TRFHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLNSLTVHRFLL 120

Query: 121 TATTIASKGLCDSFCTNTHYSKVGGVQCSELNILENEFLERVRYRIIPRDDNIENCKIEQ 180
           TATTIASKGLCDSFCTNTHYSKVGGVQCSELNILENEFLERVRYRIIPRDDNIENCKIEQ
Sbjct: 121 TATTIASKGLCDSFCTNTHYSKVGGVQCSELNILENEFLERVRYRIIPRDDNIENCKIEQ 180

Query: 181 KLGSNMLIPMKNASQRGPDNGFNVLQNYYRKIVQLVGNPLNSPDKTSTYFFKMVDPMNPG 240
           KLGSNMLIPMKNASQRGPDNGFNVLQNYYRKIVQLVGNPLNSPDKTSTYFFKMVDPMNPG
Sbjct: 181 KLGSNMLIPMKNASQRGPDNGFNVLQNYYRKIVQLVGNPLNSPDKTSTYFFKMVDPMNPG 240

Query: 241 IGGTLVPPSTTIKNNLKDKGNGRLNTNIISTTGRIVSPSITEGDSFNLSEHRKTRSRETS 300
           IGGTLVPPSTTIKNNLKDKGNGRLNTNIISTTGRIVSPSITEGDSFNLSEHRKTRSRETS
Sbjct: 241 IGGTLVPPSTTIKNNLKDKGNGRLNTNIISTTGRIVSPSITEGDSFNLSEHRKTRSRETS 300

Query: 301 VNENSDSPPITIPQKRNMKEDDPTNMDRKSTLLRNGKKLSSHFNS 345
           VNENSDSPPITIPQKRNMKEDDPTNMDRKSTLLRNGKKLSSHFNS
Sbjct: 301 VNENSDSPPITIPQKRNMKEDDPTNMDRKSTLLRNGKKLSSHFNS 345

>Kwal_56.22443 s56 (131419..132261) [843 bp, 280 aa] {ON} YOL001W
           (PHO80) - The Pho80p Cyclin [contig 185] FULL
          Length = 280

 Score =  295 bits (754), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 138/217 (63%), Positives = 179/217 (82%), Gaps = 2/217 (0%)

Query: 19  IPLPEEYLRCSRTHLVVIISRMLSFLIQINDANNAGNQTMELTRFHSKAAPSITVYQYLI 78
           + LPE++ +CSRT LV++ISRMLSFL +IND+    +   ELTRFHS+  P I+VY Y++
Sbjct: 32  VALPEDFSQCSRTDLVILISRMLSFLTRINDSV-PKDDAKELTRFHSRVPPQISVYDYMM 90

Query: 79  RLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLNSLTVHRFLLTATTIASKGLCDSFCTNT 138
           RLT+YSSLE +VL+++VYYIDLLSA+YP F+LNSLTVHRFLLTATT+ASKGLCDSFCTN+
Sbjct: 91  RLTRYSSLEPAVLVASVYYIDLLSAMYPSFSLNSLTVHRFLLTATTVASKGLCDSFCTNS 150

Query: 139 HYSKVGGVQCSELNILENEFLERVRYRIIPRDDNIENCKIEQKLGSNMLIPMKNASQRGP 198
           HY+KVGGVQCSEL++LE+EFL++V YRI+PRDDNI NCK E+K G   + P  + S RGP
Sbjct: 151 HYAKVGGVQCSELHVLESEFLKKVNYRILPRDDNISNCKAEKKAGL-FVTPTYSKSCRGP 209

Query: 199 DNGFNVLQNYYRKIVQLVGNPLNSPDKTSTYFFKMVD 235
           +NGFNVL  YYRKI+++VG+  +SPDKT    + M++
Sbjct: 210 NNGFNVLDTYYRKIIEIVGSFDSSPDKTKRAHYVMIN 246

>SAKL0E01408g Chr5 (106229..107152) [924 bp, 307 aa] {ON} similar to
           uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 307

 Score =  293 bits (751), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 143/209 (68%), Positives = 173/209 (82%), Gaps = 2/209 (0%)

Query: 19  IPLPEEYLRCSRTHLVVIISRMLSFLIQINDANNAGNQTMELTRFHSKAAPSITVYQYLI 78
           I LP+E+L+CSRT LVV+ISRMLS LIQ+ND+    ++ ++LTRFHS+  P I+VY YLI
Sbjct: 47  IMLPDEFLKCSRTALVVLISRMLSSLIQMNDSM-CKDKNLKLTRFHSRVPPGISVYNYLI 105

Query: 79  RLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLNSLTVHRFLLTATTIASKGLCDSFCTNT 138
           RL KYSSLE +VL++AVYYIDLLS+VYP FTLNSLTVHRFLLTATT+ASKGL DSFCTN 
Sbjct: 106 RLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLNSLTVHRFLLTATTVASKGLSDSFCTNV 165

Query: 139 HYSKVGGVQCSELNILENEFLERVRYRIIPRDDNIENCKIEQKLGSNMLIPMKNASQRGP 198
           HY+KVGGVQCSELN+LE EFL+RV YRIIPRDDNI NCK E + G  +  P+ +   +GP
Sbjct: 166 HYAKVGGVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKEEYQQGVFITFPLADKI-KGP 224

Query: 199 DNGFNVLQNYYRKIVQLVGNPLNSPDKTS 227
           +NGFNVL  YY+K++QLVG   +SPDKTS
Sbjct: 225 NNGFNVLDTYYKKMIQLVGPSNSSPDKTS 253

>KLTH0C11110g Chr3 complement(914257..915099) [843 bp, 280 aa] {ON}
           similar to uniprot|P20052 Saccharomyces cerevisiae
           YOL001W PHO80 Cyclin negatively regulates phosphate
           metabolism Pho80p-Pho85p (cyclin-CDK complex)
           phosphorylates Pho4p and Swi5p deletion of PHO80 leads
           to aminoglycoside supersensitivity truncated form of
           PHO80 affects vacuole inheritance
          Length = 280

 Score =  286 bits (732), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 139/232 (59%), Positives = 180/232 (77%), Gaps = 4/232 (1%)

Query: 9   PQKGSNIGQIIPLPEEYLRCSRTHLVVIISRMLSFLIQINDANNAGNQTMELTRFHSKAA 68
           P  G +    + LP ++ +C RT LV++ISRMLSFLI+IND+    N + ELTRFHS+  
Sbjct: 22  PDTGEDPVPEVALPNDFSQCPRTDLVILISRMLSFLIRINDSIPKDNSS-ELTRFHSRVP 80

Query: 69  PSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLNSLTVHRFLLTATTIASK 128
           P I+VY YL+RLT+YSSLE +VL+++VYYIDLLSA+Y  F+LNSLTVHRFLLTATT+ SK
Sbjct: 81  PQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYTAFSLNSLTVHRFLLTATTVGSK 140

Query: 129 GLCDSFCTNTHYSKVGGVQCSELNILENEFLERVRYRIIPRDDNIENCKIEQKLGSNMLI 188
           GLCDSFCTN+HY+KVGGVQCSEL++LE+EFL+RV YRI+PRDDNI NCK E++ G  + +
Sbjct: 141 GLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRVNYRILPRDDNILNCKAERREG--LFV 198

Query: 189 PMKNASQ-RGPDNGFNVLQNYYRKIVQLVGNPLNSPDKTSTYFFKMVDPMNP 239
               A + RGP+NGFNVL  YY+KI+++VG+  +SPDKT    + M  P  P
Sbjct: 199 TATYAKENRGPNNGFNVLDTYYQKIIEIVGSYDSSPDKTKRAHYVMKTPPAP 250

>ACR001C Chr3 complement(357962..359002) [1041 bp, 346 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL001W
           (PHO80)
          Length = 346

 Score =  288 bits (737), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 140/230 (60%), Positives = 179/230 (77%), Gaps = 3/230 (1%)

Query: 19  IPLPEEYLRCSRTHLVVIISRMLSFLIQINDANNAGNQTMELTRFHSKAAPSITVYQYLI 78
           + LP ++L CSRT+LVV+ISRML+ LI +NDA    ++ ++LTRFHS+  P+I+VY YLI
Sbjct: 16  MELPRQFLSCSRTYLVVLISRMLTSLIGMNDAQGDKSKPIKLTRFHSRVPPAISVYNYLI 75

Query: 79  RLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLNSLTVHRFLLTATTIASKGLCDSFCTNT 138
           RLTKYSSLEH VLL++VYYIDLL+ VYPEF L+SLTVHRFLLTATT+ASKGLCDSFCTNT
Sbjct: 76  RLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSLTVHRFLLTATTVASKGLCDSFCTNT 135

Query: 139 HYSKVGGVQCSELNILENEFLERVRYRIIPRDDNIENCKIE--QKLGSNMLIPM-KNASQ 195
           HY+KVGGVQCSELN+LENEFLERV YRI+PRDDNI  C +E  +++ S   IPM K+ + 
Sbjct: 136 HYAKVGGVQCSELNVLENEFLERVNYRILPRDDNIRRCSLERQERIFSYSNIPMDKDCAL 195

Query: 196 RGPDNGFNVLQNYYRKIVQLVGNPLNSPDKTSTYFFKMVDPMNPGIGGTL 245
           +  +NGF VL+ YY +++ L+G+   SPDK+    F + +     I  TL
Sbjct: 196 QDRNNGFGVLEKYYHRMIHLIGDFNMSPDKSCNLSFTLAESPTNSIQKTL 245

>Ecym_3029 Chr3 (56667..57722) [1056 bp, 351 aa] {ON} similar to
           Ashbya gossypii ACR001C
          Length = 351

 Score =  288 bits (736), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 142/227 (62%), Positives = 177/227 (77%), Gaps = 7/227 (3%)

Query: 16  GQIIP---LPEEYLRCSRTHLVVIISRMLSFLIQINDANNAGNQTMELTRFHSKAAPSIT 72
            Q +P   LP ++L CSRTHLVV+ISRMLS LI++NDA    N T++LTRFHS+  PSI+
Sbjct: 17  AQPVPEFRLPRKFLDCSRTHLVVLISRMLSSLIRLNDAYTESN-TLQLTRFHSRVPPSIS 75

Query: 73  VYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLNSLTVHRFLLTATTIASKGLCD 132
           VY YLIRLTKYSSLEH VLL++VYYIDLLS+V+PEF L+SLTVHRFLLTATT+ASKGLCD
Sbjct: 76  VYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLDSLTVHRFLLTATTVASKGLCD 135

Query: 133 SFCTNTHYSKVGGVQCSELNILENEFLERVRYRIIPRDDNIENCKIEQKLGSNML--IPM 190
           SFCTNTHY+KVGGVQC+ELN+LENEFL RV YRI+PRD+NI+ C  E + G+     IP 
Sbjct: 136 SFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRDENIKRCSREHQEGTFSFANIPA 195

Query: 191 -KNASQRGPDNGFNVLQNYYRKIVQLVGNPLNSPDKTSTYFFKMVDP 236
                Q+  +N F+VL+NYY +++ L+GN   SPDK+    F + +P
Sbjct: 196 DAEQDQKSEENRFDVLENYYHRMIHLIGNLDASPDKSYDLNFTLEEP 242

>TDEL0G04430 Chr7 (804428..805471) [1044 bp, 347 aa] {ON} Anc_6.26
           YOL001W
          Length = 347

 Score =  281 bits (718), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 147/241 (60%), Positives = 175/241 (72%), Gaps = 10/241 (4%)

Query: 10  QKGSNIGQIIPLPEEYLRCSRTHLVVIISRMLSFLIQIND--ANNAGNQTMELTRFHSKA 67
           ++G++    I LP ++ +CSRT L V+ISRML+FLIQIND  A +       LTRFHS+ 
Sbjct: 24  KEGTDEISTIYLPRKFSKCSRTDLAVLISRMLTFLIQINDSLALSKPENARGLTRFHSRV 83

Query: 68  APSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLNSLTVHRFLLTATTIAS 127
            P I+VY YLIRLTKYSSLEH VLL+AVYYIDLLS+VYP FTL+SLTVHRFLLTATT+AS
Sbjct: 84  PPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYPVFTLSSLTVHRFLLTATTVAS 143

Query: 128 KGLCDSFCTNTHYSKVGGVQCSELNILENEFLERVRYRIIPRDDNIENCKIEQKLGSNML 187
           KGLCDSFCTNTHY+KVGGV  SELNILE EFL+RV YRI+PRDDNI+ CK+E KL    L
Sbjct: 144 KGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRILPRDDNIDWCKLETKLQKFTL 203

Query: 188 IPMKNASQRG-PDN-----GFNVLQNYYRKIVQLVGNPLNSPDKTST--YFFKMVDPMNP 239
                  Q   P N     G+NVL  Y+RKIVQLVG+  +SPDK+    Y  +   P+  
Sbjct: 204 YEEPEMGQNSRPQNSLKNSGYNVLDAYFRKIVQLVGSYASSPDKSKVVNYVLRPSSPIKD 263

Query: 240 G 240
           G
Sbjct: 264 G 264

>Kpol_1037.30 s1037 complement(72024..73127) [1104 bp, 367 aa] {ON}
           complement(72024..73127) [1104 nt, 368 aa]
          Length = 367

 Score =  275 bits (703), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 145/263 (55%), Positives = 180/263 (68%), Gaps = 24/263 (9%)

Query: 17  QIIPLPEEYLRCSRTHLVVIISRMLSFLIQINDANNAGN----------QTMELTRFHSK 66
           + I LP +++ CSR+ LV +I+RMLSFLI++ND + A              M LTRFHS+
Sbjct: 44  ETITLPPKFIDCSRSDLVALIARMLSFLIEMNDNDPANTNYLNEEPNNRSVMNLTRFHSR 103

Query: 67  AAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLNSLTVHRFLLTATTIA 126
             P+I+VY YLIRLTKYSSLEH VLLS VYYIDLLS+VYPEF +NSLTVHRFLLTATTIA
Sbjct: 104 VPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKINSLTVHRFLLTATTIA 163

Query: 127 SKGLCDSFCTNTHYSKVGGVQCSELNILENEFLERVRYRIIPRDDNIENCKIEQKLG--- 183
           SKGLCDSFCTN+HYSKVGGV CSELNILE EFL RV YRIIPRDDNI+ CKIE +     
Sbjct: 164 SKGLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRIIPRDDNIKLCKIEHQQNKFT 223

Query: 184 ---SNMLIPMKNASQRGPDNGFNVLQNYYRKIVQLVGNPLNSPDKTSTYFFKMVDPMNPG 240
              S++ +          ++GFN+L  YY KIVQLVG+   S DK+    + ++      
Sbjct: 224 MDFSDLSMVGMTVQSNHQNSGFNILDIYYHKIVQLVGSFSASSDKSRKANYTLL------ 277

Query: 241 IGGTLVPPSTTIKNNLKDKGNGR 263
           + G  +     + NN+K+  NG+
Sbjct: 278 LSGNNMEKE--VSNNIKENSNGQ 298

>CAGL0E02541g Chr5 (244814..245842) [1029 bp, 342 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001w PHO80
           cyclin
          Length = 342

 Score =  270 bits (690), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 164/218 (75%), Gaps = 10/218 (4%)

Query: 19  IPLPEEYLRCSRTHLVVIISRMLSFLIQINDANNAGNQ-TMELTRFHSKAAPSITVYQYL 77
           I LP ++L+C +  LV++I+RML F+IQIND+N   N+    LTRFHSK AP+I+V+ Y 
Sbjct: 17  IKLPRDFLKCPKGDLVILIARMLQFIIQINDSNIKENERKYGLTRFHSKIAPNISVFNYF 76

Query: 78  IRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLNSLTVHRFLLTATTIASKGLCDSFCTN 137
            RLTKYS LEHSVLLSAVYYIDLLS VYP F LNSLT HRFLLTATTIASKGLCDSFCTN
Sbjct: 77  TRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFNLNSLTAHRFLLTATTIASKGLCDSFCTN 136

Query: 138 THYSKVGGVQCSELNILENEFLERVRYRIIPRDDNIENCKIE---------QKLGSNMLI 188
           THYSKVGGVQC+ELN+LENEFL +V YRIIPRD+NI  CK+E         + + S++  
Sbjct: 137 THYSKVGGVQCNELNVLENEFLRKVNYRIIPRDNNITFCKMEVQKNFFILPESIESDLAP 196

Query: 189 PMKNASQRGPDNGFNVLQNYYRKIVQLVGNPLNSPDKT 226
            ++       + G+NVL  YY KI+++VG   +SPDKT
Sbjct: 197 SLRQGYSSISNAGYNVLTRYYYKIIEVVGKYSSSPDKT 234

>ZYRO0C07634g Chr3 (580486..581634) [1149 bp, 382 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 382

 Score =  268 bits (684), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 132/232 (56%), Positives = 169/232 (72%), Gaps = 11/232 (4%)

Query: 19  IPLPEEYLRCSRTHLVVIISRMLSFLIQINDANN--AGNQTMELTRFHSKAAPSITVYQY 76
           + LP+ +  CSRT LV++ISRML+FLIQ+ND+++  A +    LT+FHSK  P I+VY Y
Sbjct: 45  VILPKRFSECSRTDLVILISRMLTFLIQMNDSSSTSALDSVTNLTKFHSKVPPGISVYNY 104

Query: 77  LIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLNSLTVHRFLLTATTIASKGLCDSFCT 136
           L+RLTKYSSL+H VL++AVYYIDL+S+VYP FTLNSLTVHRFLLTATT+ASKGLCDSFCT
Sbjct: 105 LMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLNSLTVHRFLLTATTVASKGLCDSFCT 164

Query: 137 NTHYSKVGGVQCSELNILENEFLERVRYRIIPRDDNIENCKIEQKL---------GSNML 187
           NTHY+KVGGV CSELN+LE E L R+ YRIIPRDDNI  C +E +          G +  
Sbjct: 165 NTHYAKVGGVHCSELNVLECELLRRINYRIIPRDDNIAWCNLESQHRHFVLDTQDGDDWT 224

Query: 188 IPMKNASQRGPDNGFNVLQNYYRKIVQLVGNPLNSPDKTSTYFFKMVDPMNP 239
             + N S    ++G+NVL  YY KIVQLVG+  ++ DK+    +   + + P
Sbjct: 225 PILSNLSGNRNNSGYNVLDTYYNKIVQLVGSLKSTQDKSKLVNYTFANTLKP 276

>TBLA0A07160 Chr1 (1782941..1783747) [807 bp, 268 aa] {ON} Anc_6.26
           YOL001W
          Length = 268

 Score =  260 bits (665), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 133/221 (60%), Positives = 167/221 (75%), Gaps = 15/221 (6%)

Query: 9   PQKGSNIGQIIPLPEEYLRCSRTHLVVIISRMLSFLIQINDANNA-GNQT------MELT 61
           P  G    Q++ L + +++CS+  L+ +ISRMLSF I IND++N  GN T      + LT
Sbjct: 3   PSSGEE-AQLVVLDQNFMKCSKIDLITLISRMLSFFIDINDSHNIHGNVTNNRLSPLFLT 61

Query: 62  RFHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLNSLTVHRFLLT 121
           RFHSK  P+I+++ YLIRLTKYSSLE SVL+++VYYIDLLS VYPEF+LNSLTVHR+LLT
Sbjct: 62  RFHSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLNSLTVHRYLLT 121

Query: 122 ATTIASKGLCDSFCTNTHYSKVGGVQCSELNILENEFLERVRYRIIPRDDNIENCKIEQK 181
           ATTIASKGLCDSFCTN+HY+KVGG++C+ELN+LE EFLERVRYR+IPRD+ I+ CK+E K
Sbjct: 122 ATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFLERVRYRVIPRDNTIKLCKLEYK 181

Query: 182 LGSNMLIPMKNASQRGPD----NGFNVLQNYYRKIVQLVGN 218
                 I   N     PD    +G+NVL  YY K+VQLVGN
Sbjct: 182 YSP---IEDINNDIHIPDELQNSGYNVLSTYYNKMVQLVGN 219

>TPHA0J00380 Chr10 complement(84485..85555) [1071 bp, 356 aa] {ON}
           Anc_6.26 YOL001W
          Length = 356

 Score =  263 bits (672), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 139/236 (58%), Positives = 170/236 (72%), Gaps = 27/236 (11%)

Query: 17  QIIPLPEEYLRCSRTHLVVIISRMLSFLIQINDANN---AGNQTM--------------- 58
           + I LP  +L+CSR+ LVV+ISRML+FLIQIND N      N  M               
Sbjct: 33  ETIMLPTSFLKCSRSDLVVLISRMLTFLIQINDRNEILTENNSAMIPTQTDVNNKNNNNM 92

Query: 59  -ELTRFHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLNSLTVHR 117
             LTRFHS+  P+I+V  YLIRLTKY+SLEHSVLLS++YYIDLLS+VYPEF +NSLTVHR
Sbjct: 93  INLTRFHSRVPPNISVNNYLIRLTKYASLEHSVLLSSLYYIDLLSSVYPEFKINSLTVHR 152

Query: 118 FLLTATTIASKGLCDSFCTNTHYSKVGGVQCSELNILENEFLERVRYRIIPRDDNIENCK 177
           FLL ATT+ASKGL DSFCTN+HY+KVGGV+CSELNILE +FL R+ YRIIPRDDNI+ CK
Sbjct: 153 FLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRIIPRDDNIKLCK 212

Query: 178 IEQK-------LGSNMLIPMKNASQRGPDNGFNVLQNYYRKIVQLVGNPLNSPDKT 226
           +E+K       LG ++L          P++G+NVL  YYRK+VQ+VG   NS DK+
Sbjct: 213 LEKKSSQFTLDLG-DLLAANIQPELTHPNSGYNVLNIYYRKMVQIVGLLKNSTDKS 267

>KNAG0I01750 Chr9 (344381..345355) [975 bp, 324 aa] {ON} Anc_6.26
           YOL001W
          Length = 324

 Score =  259 bits (661), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 136/257 (52%), Positives = 170/257 (66%), Gaps = 32/257 (12%)

Query: 17  QIIPLPEEYLRCSRTHLVVIISRMLSFLIQIND--------------------ANNAGNQ 56
           Q + LP  +  CSR  L+ +ISRML FLIQIND                    A+  G+ 
Sbjct: 22  QTVSLPSNFSLCSRYDLIALISRMLVFLIQINDDAAQKKTGLADSGKGEATDAADTDGSS 81

Query: 57  TMELTRFHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLNSLTVH 116
             +LTRFHS   P I+VY YLIRLTKYS+LE SVLL+++YYIDLLS+VYP FT+NSLTVH
Sbjct: 82  ETKLTRFHSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAFTINSLTVH 141

Query: 117 RFLLTATTIASKGLCDSFCTNTHYSKVGGVQCSELNILENEFLERVRYRIIPRDDNIENC 176
           RFLLTATT+ASKGLCDSFCTN HY+KVGGVQ SELNILE+EFL+++ YR++PRDDNI  C
Sbjct: 142 RFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVLPRDDNITWC 201

Query: 177 KIEQK------LGSNMLIPMKNASQRGPDNGFNVLQNYYRKIVQLVGNPLNSPDKT--ST 228
           K E +           L  +   +    ++G+NVLQ YY KI+QLVG   +S DK+  + 
Sbjct: 202 KYEHRAHEFTIYNKAALTNVSKPTHTQRNSGYNVLQMYYHKIIQLVGKFSSSLDKSKKAN 261

Query: 229 YFFKMVDPMNPGIGGTL 245
           Y F+ V    PG+   L
Sbjct: 262 YVFENV----PGMSSAL 274

>YOL001W Chr15 (325249..326130) [882 bp, 293 aa] {ON}  PHO80Cyclin,
           interacts with cyclin-dependent kinase Pho85p; regulates
           the response to nutrient levels and environmental
           conditions, including the response to phosphate
           limitation and stress-dependent calcium signaling
          Length = 293

 Score =  255 bits (652), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 136/240 (56%), Positives = 170/240 (70%), Gaps = 19/240 (7%)

Query: 4   MNTIDPQKGSNI--GQIIP---LPEEYLRCSRTHLVVIISRMLSFLIQIND--ANNAGNQ 56
           M +   ++  NI   Q IP   LP ++ +CSRT LVV+ISRML  LI IN+  A    + 
Sbjct: 1   MESTSGERSENIHEDQGIPKVILPADFNKCSRTDLVVLISRMLVSLIAINENSATKKSDD 60

Query: 57  TMELTRFHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLNSLTVH 116
            + LTR+HSK  P+I+++ Y IRLTK+SSLEH VL++++YYIDLL  VYP+FTLNSLT H
Sbjct: 61  QITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTAH 120

Query: 117 RFLLTATTIASKGLCDSFCTNTHYSKVGGVQCSELNILENEFLERVRYRIIPRDDNIENC 176
           RFLLTATT+A+KGLCDSF TN HY+KVGGV+C ELNILEN+FL+RV YRIIPRD NI  C
Sbjct: 121 RFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLC 180

Query: 177 KIEQK----------LGSNMLIPMKNASQRGPDNGFNVLQNYYRKIVQLVGNPLNSPDKT 226
            IEQK          LGS  L      ++  P +G+NVL  YYR+IVQLVG+   SPDK+
Sbjct: 181 SIEQKQKKFVIDKNALGSLDLDSYSYVNR--PKSGYNVLDKYYRRIVQLVGSFNASPDKS 238

>Suva_15.174 Chr15 (299761..300648) [888 bp, 295 aa] {ON} YOL001W
           (REAL)
          Length = 295

 Score =  254 bits (649), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 138/259 (53%), Positives = 177/259 (68%), Gaps = 18/259 (6%)

Query: 8   DPQKGSNIGQIIPLPEEYLRCSRTHLVVIISRMLSFLIQINDANNAG--NQTMELTRFHS 65
           D Q+  +I +II LP E+ +CSRT LVV+ISRML  LI IN+ ++    +  + LTR+HS
Sbjct: 11  DTQEDQSIPKII-LPSEFKKCSRTDLVVLISRMLVSLIAINENSSTKRPDDQITLTRYHS 69

Query: 66  KAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLNSLTVHRFLLTATTI 125
           K  P+I+++ Y IRLTK+SSLEH VL++++YYIDLL   YP+FTLNSLT HRFLLTATT+
Sbjct: 70  KIPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTV 129

Query: 126 ASKGLCDSFCTNTHYSKVGGVQCSELNILENEFLERVRYRIIPRDDNIENCKIEQK---- 181
           A+KGLCDSF TN HYSKVGGV+C ELNILEN+FL+RV YRI+PRD NI  C IEQK    
Sbjct: 130 AAKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNITLCSIEQKQKTF 189

Query: 182 ------LGSNMLIPMKNASQRGPDNGFNVLQNYYRKIVQLVGNPLNSPDKTSTYFFKM-- 233
                 LGS  L     A++    +G+NVL  YY++IVQLVG+   SPDK+    + +  
Sbjct: 190 VIDKNALGSVDLGSYSYANRSK--SGYNVLDKYYQRIVQLVGSFDASPDKSRRVNYALPS 247

Query: 234 -VDPMNPGIGGTLVPPSTT 251
             D  N G      P + T
Sbjct: 248 NFDEDNEGSARLQQPKAAT 266

>Skud_15.161 Chr15 (284851..285732) [882 bp, 293 aa] {ON} YOL001W
           (REAL)
          Length = 293

 Score =  254 bits (649), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 136/245 (55%), Positives = 169/245 (68%), Gaps = 22/245 (8%)

Query: 11  KGSNIGQIIP---LPEEYLRCSRTHLVVIISRMLSFLIQINDANNAG--NQTMELTRFHS 65
           +G +  Q IP   LP E+ +CSRT LVV+ISRML  LI IN+ +     +  + LTR+HS
Sbjct: 10  EGIHEHQGIPKVILPAEFYKCSRTDLVVLISRMLVSLIAINENSTTKKPDDQITLTRYHS 69

Query: 66  KAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLNSLTVHRFLLTATTI 125
           K  P+I+++ Y IRLTK+SSLEH VL++++YYIDLL   YP+FTLNSLT HRFLLTATT+
Sbjct: 70  KVPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTV 129

Query: 126 ASKGLCDSFCTNTHYSKVGGVQCSELNILENEFLERVRYRIIPRDDNIENCKIEQKLGSN 185
           A+KGLCDSF TN HY+KVGGV+C ELNILEN+FL+RV YRIIPRD NI  C IEQK    
Sbjct: 130 AAKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQK--QK 187

Query: 186 MLIPMKNASQ----------RGPDNGFNVLQNYYRKIVQLVGNPLNSPDKTSTYFFKMVD 235
             +  KNA              P +G+NVL  YYR+IVQLVG+   SPDK+     K VD
Sbjct: 188 KFVADKNAPGSFDLDSYSYVSRPKSGYNVLDKYYRRIVQLVGSFNASPDKS-----KKVD 242

Query: 236 PMNPG 240
            + P 
Sbjct: 243 YVLPS 247

>Smik_15.169 Chr15 (292553..293428) [876 bp, 291 aa] {ON} YOL001W
           (REAL)
          Length = 291

 Score =  250 bits (639), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 130/222 (58%), Positives = 160/222 (72%), Gaps = 14/222 (6%)

Query: 17  QIIPLPEEYLRCSRTHLVVIISRMLSFLIQIND--ANNAGNQTMELTRFHSKAAPSITVY 74
           Q + LP ++ +CSRT LVV+ISRML  LI IN+   +      + LTR+HSK  P+I+++
Sbjct: 19  QKVILPTDFNKCSRTDLVVLISRMLVSLIAINENSVSKIPENQITLTRYHSKIPPNISIF 78

Query: 75  QYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLNSLTVHRFLLTATTIASKGLCDSF 134
            Y IRLTK+SSLEH VL++++YYIDLL   YP+FTLNSLT HRFLLTATTIA+KGLCDSF
Sbjct: 79  NYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTIATKGLCDSF 138

Query: 135 CTNTHYSKVGGVQCSELNILENEFLERVRYRIIPRDDNIENCKIEQK----------LGS 184
            TN HY+KVGGV+C ELNILEN+FL+RV YRIIPRD NI  C IEQK          LGS
Sbjct: 139 STNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNIMLCSIEQKQKKFVIDKNALGS 198

Query: 185 NMLIPMKNASQRGPDNGFNVLQNYYRKIVQLVGNPLNSPDKT 226
             L       +  P +G+NVL  YYR+IVQLVG+   SPDK+
Sbjct: 199 FDLDSYSYTDR--PKSGYNVLDKYYRRIVQLVGSFNASPDKS 238

>NCAS0D02150 Chr4 (400750..401859) [1110 bp, 369 aa] {ON} Anc_6.26
          Length = 369

 Score =  218 bits (556), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 113/216 (52%), Positives = 148/216 (68%), Gaps = 17/216 (7%)

Query: 17  QIIPLPEEYLRCSRTHLVVIISRMLSFLIQIND-----ANNAGNQTMELTRFHSKAAPSI 71
           Q+I +P EY++CSR+ LVV++SRML  LIQ ND     +N++ +  M LTRFHS+  P+I
Sbjct: 27  QVIEVPYEYIKCSRSDLVVLVSRMLVLLIQSNDMTSNTSNSSSDSNMHLTRFHSRIPPNI 86

Query: 72  TVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLNSLTVHRFLLTATTIASKGLC 131
           +++ YL RLTKY  +EH VLLS +YYIDL +A YP FT NSLT HRFLLTA T+A KGLC
Sbjct: 87  SIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAYPTFTFNSLTAHRFLLTAITVAGKGLC 146

Query: 132 DSFCTNTHYSKVGGVQCSELNILENEFLERVRYRIIPRDDNIENCKIEQKLGSNML---- 187
           DSFCT   Y+K+GGVQ  ELNILE  FL  V YRIIPR  N+   K+E+  G+ +     
Sbjct: 147 DSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRIIPRSSNVTLIKLER--GNQVFTLDH 204

Query: 188 IPMKN------ASQRGPDNGFNVLQNYYRKIVQLVG 217
           + MK+      +    PDNG++VL  YY+ IV++ G
Sbjct: 205 LDMKDPKLSFLSYDYLPDNGYSVLNIYYQNIVRITG 240

>NDAI0C02640 Chr3 complement(611899..613182) [1284 bp, 427 aa] {ON}
           Anc_6.26 YOL001W
          Length = 427

 Score =  202 bits (513), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 109/227 (48%), Positives = 151/227 (66%), Gaps = 12/227 (5%)

Query: 19  IPLPEEYLRCSRTHLVVIISRMLSFLIQIND--ANNAGNQTMELTRFHSKAAPSITVYQY 76
           I LP +++ C R  LVV+ISRML  LI+IND  AN+    +   TRFHS+  P I++  Y
Sbjct: 57  ITLPIKFMECPRRDLVVLISRMLVTLIKINDTKANDNNLPSNYATRFHSRVIPGISIGNY 116

Query: 77  LIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLNSLTVHRFLLTATTIASKGLCDSFCT 136
           L+RLTK+  L+ SVLL+AVYYIDLLSAV+P F+ NSLT HRF+LTA  +ASK LCDS  +
Sbjct: 117 LLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFNSLTAHRFILTAVIVASKSLCDSCLS 176

Query: 137 NTHYSKVGGVQCSELNILENEFLERVRYRIIPRDDNIENCKIEQKLGSNML----IPMKN 192
            THY+K GGVQ +EL +LE  FL+ ++YR++PRD N + C +E    +  L    I    
Sbjct: 177 ITHYAKYGGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLCSMEYHFDTFALNDGQIKESG 236

Query: 193 AS---QRGPDNGFNVLQNYYRKIVQLVG--NPLN-SPDKTSTYFFKM 233
            S   ++ P +G+NVL  YYR+I+ ++G   P++ SPD  +  +F M
Sbjct: 237 TSFSYRQLPHSGYNVLHMYYRRIIDIIGVQRPISPSPDAVTVDYFLM 283

>Smik_9.140 Chr9 (233007..233864) [858 bp, 285 aa] {ON} YIL050W
           (REAL)
          Length = 285

 Score = 87.8 bits (216), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 55/179 (30%), Positives = 90/179 (50%), Gaps = 28/179 (15%)

Query: 10  QKGSNIGQIIPLPEEYLRCSRTHLVVIISRMLSFLIQINDANNAGNQTME---------- 59
           +   N+  I+  P +        L++++S +L+ +I +NDA    +Q +           
Sbjct: 94  ESSENVLNIVDFPTD-------ELIIMVSALLNKIITVNDATTDISQQVPGDTEEKFLTP 146

Query: 60  LTRFHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVY---PE--------F 108
           +  F+ K  P I V QYL R+ KY    + + LS + Y D +S  Y   PE        F
Sbjct: 147 ILAFYGKNVPEIDVVQYLERIQKYCPTTNDIFLSLLVYFDRISKNYGHSPEENGHSKQLF 206

Query: 109 TLNSLTVHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCSELNILENEFLERVRYRII 167
            ++S  +HR L+T  TI +K L D F +N+ Y+KVGG+   ELN LE +FL    ++++
Sbjct: 207 VMDSGNIHRLLITGITICTKFLSDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKLL 265

>Suva_9.149 Chr9 (247583..248443) [861 bp, 286 aa] {ON} YIL050W
           (REAL)
          Length = 286

 Score = 83.6 bits (205), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 52/179 (29%), Positives = 91/179 (50%), Gaps = 28/179 (15%)

Query: 10  QKGSNIGQIIPLPEEYLRCSRTHLVVIISRMLSFLIQIND-ANNAGNQTME--------- 59
           + G ++  I+  P +        L++++S +L+ +++ ND   +   Q +E         
Sbjct: 95  EDGESVLNIVDFPTD-------ELILMVSALLNKIVKANDETTDPSQQVVEDGEDELLAP 147

Query: 60  LTRFHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVY---PE--------F 108
           +  F+ K  P I V QYL R+ KY    + + LS + Y D +S  Y   P+        F
Sbjct: 148 VLAFYGKNVPEIAVVQYLERIQKYCPTTNDIFLSLLVYFDRISKNYGSSPDRNGHVRQIF 207

Query: 109 TLNSLTVHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCSELNILENEFLERVRYRII 167
            ++S  +HR L+T  TI +K + D F +N+ Y+KVGG+   ELN LE +FL    ++++
Sbjct: 208 VMDSGNIHRLLITGITICTKFMSDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKLL 266

>Skud_9.119 Chr9 (227792..228649) [858 bp, 285 aa] {ON} YIL050W
           (REAL)
          Length = 285

 Score = 83.2 bits (204), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 81/160 (50%), Gaps = 21/160 (13%)

Query: 29  SRTHLVVIISRMLSFLIQINDA----------NNAGNQTMELTRFHSKAAPSITVYQYLI 78
           S   L+ +IS +L+ ++  ND           +N       +  F+ K+ P I+V QYL 
Sbjct: 106 STDELIQMISALLNRIVTANDEYAEISQQVSKDNQDELLAPILAFYGKSVPEISVVQYLE 165

Query: 79  RLTKYSSLEHSVLLSAVYYIDLLSAVYPEFT-----------LNSLTVHRFLLTATTIAS 127
           R+ KY    + + LS + Y D +S  Y  F+           ++S  +HR L+T  TI +
Sbjct: 166 RIQKYCPTTNDIFLSLLVYFDRISKKYGHFSDRNAHTKQMFGMDSGNIHRLLITGITICT 225

Query: 128 KGLCDSFCTNTHYSKVGGVQCSELNILENEFLERVRYRII 167
           K L D F +N+ Y+KVGG+   ELN LE +FL    ++++
Sbjct: 226 KFLSDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKLL 265

>YIL050W Chr9 (258913..259770) [858 bp, 285 aa] {ON}  PCL7Pho85p
           cyclin of the Pho80p subfamily, forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p; involved in glycogen
           metabolism, expression is cell-cycle regulated
          Length = 285

 Score = 82.4 bits (202), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 50/157 (31%), Positives = 79/157 (50%), Gaps = 21/157 (13%)

Query: 32  HLVVIISRMLSFLIQINDANNAGNQTME----------LTRFHSKAAPSITVYQYLIRLT 81
            L+++IS +L+ +I  ND     +Q +           +  F+ K  P I V QYL R+ 
Sbjct: 109 ELILMISALLNRIITANDETTDVSQQVSDETEDELLTPILAFYGKNVPEIAVVQYLERIQ 168

Query: 82  KYSSLEHSVLLSAVYYIDLLSAVYPE-----------FTLNSLTVHRFLLTATTIASKGL 130
           KY    + + LS + Y D +S  Y             F ++S  +HR L+T  TI +K L
Sbjct: 169 KYCPTTNDIFLSLLVYFDRISKNYGHSSERNGCAKQLFVMDSGNIHRLLITGVTICTKFL 228

Query: 131 CDSFCTNTHYSKVGGVQCSELNILENEFLERVRYRII 167
            D F +N+ Y+KVGG+   ELN LE +FL    ++++
Sbjct: 229 SDFFYSNSRYAKVGGISLQELNHLELQFLILCDFKLL 265

>Kwal_23.5807 s23 (1326104..1327501) [1398 bp, 465 aa] {ON} YIL050W
           (PCL7) - PHO85 cyclin [contig 11] FULL
          Length = 465

 Score = 77.8 bits (190), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 68/126 (53%), Gaps = 7/126 (5%)

Query: 49  DANNAG--NQTMELTRFHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYP 106
           DA+N    N   E+  F  K  P+IT+ QY  R+ KY    + V LS + Y D ++    
Sbjct: 308 DADNDTRPNIASEILSFRGKHVPAITLQQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCN 367

Query: 107 E-----FTLNSLTVHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCSELNILENEFLER 161
                 F ++S  +HR +++A T+++K   D F +N+ Y++VGG+   ELN LE +FL  
Sbjct: 368 HGKEQLFVMDSYNIHRLIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVL 427

Query: 162 VRYRII 167
             + +I
Sbjct: 428 CDFELI 433

>KLTH0A04268g Chr1 (358035..359777) [1743 bp, 580 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 580

 Score = 77.8 bits (190), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 65/114 (57%), Gaps = 5/114 (4%)

Query: 59  ELTRFHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLS-----AVYPEFTLNSL 113
           E+  F  K  P+IT++QY  R+ KY    + V LS + Y D ++     A    F ++S 
Sbjct: 431 EILSFRGKHVPAITLHQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHAKEQLFVMDSY 490

Query: 114 TVHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCSELNILENEFLERVRYRII 167
            +HR +++A T+++K   D F +N+ Y++VGG+   ELN LE +FL    + +I
Sbjct: 491 NIHRLIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCDFELI 544

>KNAG0D01630 Chr4 (274260..275576) [1317 bp, 438 aa] {ON} Anc_7.240
           YIL050W
          Length = 438

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 68/133 (51%), Gaps = 21/133 (15%)

Query: 60  LTRFHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLS----------------- 102
           +T F+ K  P IT+ QYL+R+ KY    + + LS + + D +S                 
Sbjct: 283 ITSFYGKHVPQITIEQYLLRIQKYCPTTNDIFLSLLVFFDRISKKFNIHQQKQQSNVSDS 342

Query: 103 ---AVYPEFTLNSLTVHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCSELNILENEFL 159
              A +  F ++S  +HR L+   T+++K   D F +N  Y++VGG+   E+N LE +FL
Sbjct: 343 DEQAPHQTFVMDSYNIHRLLIAGVTVSTKFFSDFFYSNARYARVGGISLQEMNHLELQFL 402

Query: 160 ERVRYR-IIPRDD 171
               ++ +IP D+
Sbjct: 403 ILCDFKLLIPIDE 415

>Ecym_4336 Chr4 complement(720123..721280) [1158 bp, 385 aa] {ON}
           similar to Ashbya gossypii ADL075W
          Length = 385

 Score = 74.7 bits (182), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 70/125 (56%), Gaps = 7/125 (5%)

Query: 39  RMLSFLIQINDANNAGNQTMELTRFHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYI 98
           R+ SF  + +D N+       +  F  K  P+IT+  Y  R+ KY  + + V LS + Y 
Sbjct: 212 RLKSFEQEKHDINS--KYVAHVLSFRGKHIPAITLGDYFARIQKYCPITNDVFLSLLVYF 269

Query: 99  DLLS----AVYPE-FTLNSLTVHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCSELNI 153
           D ++    A+ P+ F ++S  +HR ++ A T+++K   D F +N+ Y++VGG+   ELN 
Sbjct: 270 DRIAKRCNAMDPQLFVMDSYNIHRLIIAAVTVSTKFFSDFFYSNSRYARVGGISLHELNR 329

Query: 154 LENEF 158
           LE +F
Sbjct: 330 LELQF 334

>ADL075W Chr4 (550941..551564) [624 bp, 207 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL050W (PCL7) and
           YER059W (PCL6)
          Length = 207

 Score = 71.2 bits (173), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 39/116 (33%), Positives = 65/116 (56%), Gaps = 7/116 (6%)

Query: 48  NDANNAGNQTMELTRFHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLS----A 103
           +D NN       +  F  K  P+IT+  Y  R+ KY  + + V LS + Y D ++    A
Sbjct: 52  HDINN--KYVAHVLSFRGKHIPTITLGDYFARIQKYCPITNDVFLSLLVYFDRIAKRCNA 109

Query: 104 VYPE-FTLNSLTVHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCSELNILENEF 158
           + P+ F ++S  +HR ++ A T+++K   D F +N+ Y++VGG+   ELN LE +F
Sbjct: 110 LDPQLFVMDSYNIHRLIIAAVTVSTKFFSDFFYSNSRYARVGGISLEELNRLELQF 165

>CAGL0M12342g Chr13 complement(1234192..1235565) [1374 bp, 457 aa]
           {ON} weakly similar to uniprot|P40038 Saccharomyces
           cerevisiae YER059w PCL6 cyclin like protein interacting
           with PHO85P
          Length = 457

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 63/126 (50%), Gaps = 14/126 (11%)

Query: 63  FHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSA-----------VYPE---F 108
           F  K  P IT+YQY  R+ KY    + V LS + Y D +S              P    F
Sbjct: 305 FKGKHVPQITLYQYFQRIQKYCPTTNDVFLSLLVYFDRISKKCNSSDSESADTSPADQLF 364

Query: 109 TLNSLTVHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCSELNILENEFLERVRYRIIP 168
            ++S  +HR ++   T+ +K   D F +N+ Y++VGG+  SELN LE +FL    + ++ 
Sbjct: 365 VMDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLELQFLVLCDFELLI 424

Query: 169 RDDNIE 174
             D ++
Sbjct: 425 SVDKLQ 430

>SAKL0F08602g Chr6 (657898..659322) [1425 bp, 474 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 474

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 65/121 (53%), Gaps = 10/121 (8%)

Query: 57  TMELTRFHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSA---VYPE------ 107
           T ++  F  K  P+I++ QY  R+ KY    + V LS + Y D ++    +  E      
Sbjct: 331 TSQVLSFRGKHVPAISLDQYFQRIQKYCPTTNDVFLSLLVYFDRIAKRCNINEEGEDGQQ 390

Query: 108 -FTLNSLTVHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCSELNILENEFLERVRYRI 166
            F ++S  +HR ++ A T+++K   D F +N+ Y++VGG+   ELN LE +FL    + +
Sbjct: 391 LFVMDSYNIHRLIIAAVTVSTKFFSDFFYSNSRYARVGGISLQELNRLELQFLILCDFEL 450

Query: 167 I 167
           I
Sbjct: 451 I 451

>NCAS0A13480 Chr1 complement(2653843..2655189) [1347 bp, 448 aa]
           {ON} Anc_7.240
          Length = 448

 Score = 71.6 bits (174), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 76/157 (48%), Gaps = 16/157 (10%)

Query: 63  FHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLS-----AVYPE---------- 107
           F  K  P I+++QY  R+ KY    + V LS + Y D +S     +V  +          
Sbjct: 283 FRGKHVPQISLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNNSVTSQGDSPTNKSQL 342

Query: 108 FTLNSLTVHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCSELNILENEFLERVRYRI- 166
           F ++S  +HR ++   T+ +K   D F +N+ Y++VGGV   ELN LE +FL    + + 
Sbjct: 343 FVMDSYNIHRLIIAGVTVCTKFFSDFFYSNSRYARVGGVSLQELNHLELQFLVLCDFELM 402

Query: 167 IPRDDNIENCKIEQKLGSNMLIPMKNASQRGPDNGFN 203
           IP ++      +  +  S   +P +  ++   D+G N
Sbjct: 403 IPTEELQRYADLLSRFWSTQPLPEEEDTKVLQDSGSN 439

>NCAS0E03220 Chr5 complement(639650..640675) [1026 bp, 341 aa] {ON}
           Anc_7.240
          Length = 341

 Score = 70.1 bits (170), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 51/177 (28%), Positives = 79/177 (44%), Gaps = 44/177 (24%)

Query: 27  RCSRTHLVVIISRMLSFLIQINDANNAGNQTM-------------ELTR----FHSKAAP 69
           + S   L+ +IS +L  LI+ ND     N+T              +L R    F  K  P
Sbjct: 131 KLSTKKLIKMISTILEKLIKSNDELRERNETSLNDRTDDDNSDESKLVRSIKSFRGKHIP 190

Query: 70  SITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVY------------------------ 105
            I + QY  R+ KY    + VLL+ + Y D +S V                         
Sbjct: 191 PIKLEQYFHRIQKYCPTNNLVLLAILIYFDRISKVLNGSKENESDPNISTHHHLLRNYDC 250

Query: 106 ---PEFTLNSLTVHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCSELNILENEFL 159
               +F L+S  +HR +++A T+++K   D F +N+ Y+KVGG+   E+N LE +FL
Sbjct: 251 KIEDKFLLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGISLDEMNYLELQFL 307

>KAFR0I01840 Chr9 (376802..377779) [978 bp, 325 aa] {ON} Anc_7.240
           YIL050W
          Length = 325

 Score = 68.9 bits (167), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 60/118 (50%), Gaps = 10/118 (8%)

Query: 60  LTRFHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSA----------VYPEFT 109
           L  FH K  P IT+ +Y  R+ KY    + V L  +   D ++               F 
Sbjct: 178 LLCFHGKHVPDITIEKYFNRIQKYCPTTNDVFLLLLIAFDRIAKRCNTDSFGNKSQQLFV 237

Query: 110 LNSLTVHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCSELNILENEFLERVRYRII 167
           ++S  +HRF++   T+ +K L D F +N+ Y+KVGG+   E+N LE +FL    +++I
Sbjct: 238 MDSYNIHRFIIAGVTVCTKFLSDFFYSNSRYAKVGGISVHEMNNLELQFLVLCDFKLI 295

>TPHA0C01090 Chr3 complement(247987..249144) [1158 bp, 385 aa] {ON}
           Anc_7.240 YIL050W
          Length = 385

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 50/213 (23%), Positives = 94/213 (44%), Gaps = 54/213 (25%)

Query: 9   PQKGSNIGQIIPL------PEEYLRCSRTHLVVIISRMLSFLI------QINDANNAGNQ 56
           P+K +   +++ L      PE         L+ ++S +L  ++       IN  +N  ++
Sbjct: 136 PEKNTQDKKVVALADFAATPENIAEFQTDKLLDMLSTLLDKIVLSNDRLHINTMDNTIDE 195

Query: 57  TME------LTRFHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSA------- 103
            ++      ++ F  K  P I++ QY  R+ KY  + + V LS + Y D +S        
Sbjct: 196 HIDSTIIKPVSCFRGKHVPQISLEQYFQRIQKYCPITNDVFLSLLVYFDRISKKCNNINL 255

Query: 104 ----------------------------VYPE-FTLNSLTVHRFLLTATTIASKGLCDSF 134
                                       V P+ F ++S  +HR ++TA T+++K   D F
Sbjct: 256 EKENVISNDADESQNNVKQMKDENNSSIVKPQVFVMDSFNIHRLIITAVTVSTKFFSDLF 315

Query: 135 CTNTHYSKVGGVQCSELNILENEFLERVRYRII 167
            +N+ Y++VGG+   ELN LE +FL    ++++
Sbjct: 316 YSNSRYARVGGISLQELNHLELQFLILCDFQLM 348

>KLLA0C08305g Chr3 complement(728996..730225) [1230 bp, 409 aa] {ON}
           similar to uniprot|P40186 Saccharomyces cerevisiae
           YIL050W PCL7 Pho85p cyclin of the Pho80p subfamily forms
           a functional kinase complex with Pho85p which
           phosphorylates Mmr1p and is regulated by Pho81p involved
           in glycogen metabolism expression is cell-cycle
           regulated and weakly similar to YER059W uniprot|P40038
           Saccharomyces cerevisiae YER059W PCL6 Pho85p cyclin of
           the Pho80p subfamily forms the major Glc8p kinase
           together with Pcl7p and Pho85p involved in the control
           of glycogen storage by Pho85p stabilized by Elongin C
           binding
          Length = 409

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 67/137 (48%), Gaps = 28/137 (20%)

Query: 59  ELTRFHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLS----AVYPE------- 107
           E+  F  K  P IT+ QY  R+ KY    + VLLS + + D ++    A+  E       
Sbjct: 236 EILSFRGKQVPGITLKQYFQRIQKYCPTTNDVLLSLLVHFDRIAKKCNAIAQEYMVSVVS 295

Query: 108 -----------------FTLNSLTVHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCSE 150
                            F ++S  +HR ++ A T+++K + D F +N+ Y++VGG+   E
Sbjct: 296 TPDKTTASLAHQSSPQLFVMDSHNIHRLIIAAITVSTKFISDFFYSNSRYARVGGISLQE 355

Query: 151 LNILENEFLERVRYRII 167
           LN LE +FL    +R+I
Sbjct: 356 LNHLELQFLILCDFRLI 372

>NDAI0A02560 Chr1 (571529..573040) [1512 bp, 503 aa] {ON} Anc_7.240
           YER059W
          Length = 503

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 55/111 (49%), Gaps = 14/111 (12%)

Query: 63  FHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPE--------------F 108
           F  K  P IT++QY  R+ KY    + V LS + Y D +S                   F
Sbjct: 352 FKGKHVPQITLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNSTPTTNSINDNNSQMF 411

Query: 109 TLNSLTVHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCSELNILENEFL 159
            ++S  +HR ++   T+ +K   D F +N+ Y++VGG+   ELN LE +FL
Sbjct: 412 VMDSYNIHRLIIAGITVCTKFFSDFFYSNSRYARVGGISLQELNHLELQFL 462

>KAFR0L00880 Chr12 (163476..164417) [942 bp, 313 aa] {ON} Anc_7.240
           YIL050W
          Length = 313

 Score = 67.0 bits (162), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 56/109 (51%), Gaps = 12/109 (11%)

Query: 63  FHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLL-----------SAVYPE-FTL 110
           F  K  P I + QY  R+ KY    + V LS + Y D +               P+ F +
Sbjct: 175 FKGKHIPQINLEQYFKRIQKYCPTTNDVFLSLLIYFDRIFNKCNSKFDNYGHDNPQIFVM 234

Query: 111 NSLTVHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCSELNILENEFL 159
           +S  +HR ++   T+++K L D F +N+ Y+KVGG+   ELN LE +FL
Sbjct: 235 DSYNIHRLIIAGVTVSTKFLSDFFYSNSRYAKVGGISLKELNYLELQFL 283

>KNAG0L01470 Chr12 (259883..260947) [1065 bp, 354 aa] {ON} Anc_7.240
           YIL050W
          Length = 354

 Score = 64.7 bits (156), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 63/137 (45%), Gaps = 21/137 (15%)

Query: 44  LIQINDANNAGNQTME-----LTRFHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYI 98
           L+++ND     +   E     +  F  K  P IT+ QY  R+ KY    + V LS + Y 
Sbjct: 187 LLKVNDDARDTDGYYESAVNAILSFKGKHIPQITLEQYFHRIQKYCPTTNDVFLSLLIYF 246

Query: 99  DLLSA---VYPE-------------FTLNSLTVHRFLLTATTIASKGLCDSFCTNTHYSK 142
           D +S      P              F +NS  +HR ++    +++K   D F +N  Y+K
Sbjct: 247 DRISEKCNSIPRGGDDDKVQDDTLLFVMNSYNIHRLIIAGVAVSTKFSSDFFYSNARYAK 306

Query: 143 VGGVQCSELNILENEFL 159
           VGG+   E+N LE +FL
Sbjct: 307 VGGISLREMNYLELQFL 323

>TDEL0H02020 Chr8 complement(346307..347398) [1092 bp, 363 aa] {ON}
           Anc_7.240 YIL050W
          Length = 363

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 74/181 (40%), Gaps = 46/181 (25%)

Query: 33  LVVIISRMLSFLIQINDANNAGNQTMELTR---------------FHSKAAPSITVYQYL 77
           L+ +++ +L  +I+ ND   + N T+   R               F  K  P I++  Y 
Sbjct: 151 LLEMLTALLDKIIKSNDRLASSNPTLNQERELMNNNNVYLNSVLSFRGKHIPQISLEHYF 210

Query: 78  IRLTKYSSLEHSVLLSAVYYIDLLS-------------------------------AVYP 106
            R+ KY    + V LS + Y D +S                                   
Sbjct: 211 QRIQKYCPTTNDVFLSLLVYFDRISKRCNSNNNDTTNDNDLQYDMPAKQQQQTQQTQQQQ 270

Query: 107 EFTLNSLTVHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCSELNILENEFLERVRYRI 166
            F ++S  +HR L+   T+++K   D F +N+ Y++VGG+   ELN LE +FL    + +
Sbjct: 271 AFVMDSHNIHRLLIAGVTVSTKFFSDFFYSNSRYARVGGISLQELNHLELQFLVLCDFEL 330

Query: 167 I 167
           +
Sbjct: 331 L 331

>ZYRO0C08118g Chr3 (621320..622537) [1218 bp, 405 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 405

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 57/138 (41%), Gaps = 41/138 (29%)

Query: 63  FHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLS-------------------- 102
           F  K  P I++  Y  R+ KY    + V LS + Y D +S                    
Sbjct: 234 FRGKHIPQISLEHYFQRIQKYCPTSNDVFLSLLVYFDRISRKCNSSSRLHHENTSANDAG 293

Query: 103 ---------------------AVYPEFTLNSLTVHRFLLTATTIASKGLCDSFCTNTHYS 141
                                A   +F ++S  +HR ++  TT+++K   D F +N+ Y+
Sbjct: 294 NNNNGHDNVKQQVHNNQQPIPAPQQQFVMDSHNIHRLIIAGTTVSTKFFSDFFYSNSRYA 353

Query: 142 KVGGVQCSELNILENEFL 159
           +VGG+   ELN LE +FL
Sbjct: 354 RVGGISLQELNYLELQFL 371

>TBLA0D04070 Chr4 complement(1012284..1014269) [1986 bp, 661 aa]
           {ON} Anc_7.240 YIL050W
          Length = 661

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 37/60 (61%)

Query: 108 FTLNSLTVHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCSELNILENEFLERVRYRII 167
           F ++S  +HR ++   T+A+K   D F +N  Y+KVGG+   ELN LE +FL    ++++
Sbjct: 578 FVMDSYNIHRLIIAGVTVATKFFSDYFYSNARYAKVGGITLQELNHLELQFLLLCDFKLL 637

 Score = 37.7 bits (86), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 23/40 (57%)

Query: 63  FHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLS 102
           F  K  P IT++QY  R+ KY  + + V LS + Y D +S
Sbjct: 444 FRGKHIPQITLFQYFQRIQKYCPISNDVFLSLLVYFDRIS 483

>YER059W Chr5 (272624..273886) [1263 bp, 420 aa] {ON}  PCL6Pho85p
           cyclin of the Pho80p subfamily; forms the major Glc8p
           kinase together with Pcl7p and Pho85p; involved in the
           control of glycogen storage by Pho85p; stabilized by
           Elongin C binding
          Length = 420

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 39/59 (66%), Gaps = 1/59 (1%)

Query: 102 SAVYPE-FTLNSLTVHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCSELNILENEFL 159
           S  +P+ F ++S  +HR ++   T+++K L D F +N+ YS+VGG+   ELN LE +FL
Sbjct: 323 SRAHPQMFVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFL 381

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 20/40 (50%)

Query: 63  FHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLS 102
           F  K  P I + QY  R+ KY    + V LS + Y D +S
Sbjct: 223 FRGKHVPQIGLDQYFQRIQKYCPTTNDVFLSLLVYFDRIS 262

>Smik_5.189 Chr5 (276775..278022) [1248 bp, 415 aa] {ON} YER059W
           (REAL)
          Length = 415

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 35/52 (67%)

Query: 108 FTLNSLTVHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCSELNILENEFL 159
           F ++S  +HR ++   T+++K L D F +N+ YS+VGG+   ELN LE +FL
Sbjct: 325 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFL 376

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 20/40 (50%)

Query: 63  FHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLS 102
           F  K  P I + QY  R+ KY    + V LS + Y D +S
Sbjct: 218 FRGKHVPQIGLDQYFQRIQKYCPTTNDVFLSLLVYFDRIS 257

>Suva_5.167 Chr5 (248778..250052) [1275 bp, 424 aa] {ON} YER059W
           (REAL)
          Length = 424

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 35/52 (67%)

Query: 108 FTLNSLTVHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCSELNILENEFL 159
           F ++S  +HR ++   T+++K L D F +N+ YS+VGG+   ELN LE +FL
Sbjct: 334 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFL 385

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 20/40 (50%)

Query: 63  FHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLS 102
           F  K  P I + QY  R+ KY    + V LS + Y D +S
Sbjct: 227 FRGKHVPQIGLDQYFQRIQKYCPTTNDVFLSLLVYFDRIS 266

>Skud_5.173 Chr5 (268792..270054) [1263 bp, 420 aa] {ON} YER059W
           (REAL)
          Length = 420

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 38/60 (63%)

Query: 108 FTLNSLTVHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCSELNILENEFLERVRYRII 167
           F ++S  +HR ++   T+++K L D F +N+ YS+VGG+   ELN LE +FL    + ++
Sbjct: 330 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 389

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 20/40 (50%)

Query: 63  FHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLS 102
           F  K  P I + QY  R+ KY    + V LS + Y D +S
Sbjct: 223 FRGKHVPQIGLDQYFQRIQKYCPTTNDVFLSLLVYFDRIS 262

>Kpol_1033.13 s1033 (30454..31206) [753 bp, 250 aa] {ON}
           (30454..31206) [753 nt, 251 aa]
          Length = 250

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 37/60 (61%)

Query: 108 FTLNSLTVHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCSELNILENEFLERVRYRII 167
           F ++S  +HR ++   T+++K   D F +N+ Y++VGG+   ELN LE +FL    + ++
Sbjct: 163 FVMDSYNIHRLIIAGVTVSTKFFSDLFYSNSRYARVGGISLQELNNLELQFLLMCDFHLL 222

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 22/40 (55%)

Query: 63  FHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLS 102
           F  K  P I++ QY  R+ KY  + + V +S + Y D +S
Sbjct: 42  FRGKHIPQISLEQYFQRIQKYCPITNDVFISLLVYFDRIS 81

>Kpol_2000.14 s2000 (24019..24951) [933 bp, 310 aa] {ON}
           (24019..24951) [933 nt, 311 aa]
          Length = 310

 Score = 49.3 bits (116), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 61/109 (55%), Gaps = 5/109 (4%)

Query: 72  TVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPE--FTLNSLTVHRFLLTATTIASKG 129
           ++++++  L K+S+++ S L+++  Y+  L ++ P   + + S T HR  L    +A+K 
Sbjct: 44  SIFEFIKGLIKHSNVQTSTLMASTVYLTKLRSILPANVYGIES-TKHRIFLGCLILAAKS 102

Query: 130 LCDSFCTNTHYSKV--GGVQCSELNILENEFLERVRYRIIPRDDNIENC 176
           L DS   N H++K   G +  +++N +E E L  + +  I + +++  C
Sbjct: 103 LNDSSPLNKHWTKYTNGLLNLADVNTIERELLAYLNWDTIIKQEDLIGC 151

>TBLA0C04850 Chr3 complement(1175677..1176783) [1107 bp, 368 aa]
           {ON} Anc_7.289 YDL179W
          Length = 368

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 49/97 (50%), Gaps = 3/97 (3%)

Query: 73  VYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLN-SLTVHRFLLTATTIASKGLC 131
           +Y ++  L  +S+++   L++ V Y+  L A+ P        T HR  L    IA+K L 
Sbjct: 53  LYTFIKNLVAHSNVQTPTLMTTVVYLKKLKAIIPSNVYGIETTRHRMFLGCLIIAAKTLN 112

Query: 132 DSFCTNTHYSKV--GGVQCSELNILENEFLERVRYRI 166
           DS   N H++K   G +Q  E+N +E E L   ++ +
Sbjct: 113 DSSPLNKHWAKYTNGLLQLREVNTIEREILTYFKWDL 149

>TPHA0P00810 Chr16 complement(165632..166375) [744 bp, 247 aa] {ON}
           Anc_7.289 YDL179W
          Length = 247

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 59/115 (51%), Gaps = 6/115 (5%)

Query: 65  SKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLNSLTV-HRFLLTAT 123
           S A PS+T   ++  + KYS ++   L+++  +++ L  + P +     T  HR  L   
Sbjct: 39  SLAIPSLT--SFICDVVKYSKVKTPTLMASTVFLNRLRCIIPGYVEGIATATHRLFLGCL 96

Query: 124 TIASKGLCDSFCTNTHYSKV--GGVQCSELNILENEFLERVRYRI-IPRDDNIEN 175
            +ASK L DS   N H+ K   G +   E+N +E E LE + + + I  +D I++
Sbjct: 97  ILASKTLNDSSPFNKHWEKYCRGLLSLMEINTIERELLEYMSWNVRISTEDLIDS 151

>NDAI0E04770 Chr5 (1073112..1074023) [912 bp, 303 aa] {ON} Anc_7.240
           YER059W
          Length = 303

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 31/50 (62%)

Query: 110 LNSLTVHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCSELNILENEFL 159
           +NS TVHR +L   T++SK L D   +N  Y++  G+   ELN LE +FL
Sbjct: 227 VNSCTVHRLILAGITVSSKFLSDFTYSNKRYAQASGLTLEELNYLEFQFL 276

>YDL127W Chr4 (234927..235853) [927 bp, 308 aa] {ON}  PCL2Cyclin,
           interacts with cyclin-dependent kinase Pho85p; member of
           the Pcl1,2-like subfamily, involved in the regulation of
           polarized growth and morphogenesis and progression
           through the cell cycle; localizes to sites of polarized
           cell growth
          Length = 308

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 56/113 (49%), Gaps = 3/113 (2%)

Query: 67  AAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLN-SLTVHRFLLTATTI 125
           A P+  + +++ RL K+S+++   L++   Y+  L ++ P        T HR  L    +
Sbjct: 43  ALPAPPLTKFINRLIKHSNVQTPTLMATSVYLAKLRSIIPSNVYGIETTRHRIFLGCLIL 102

Query: 126 ASKGLCDSFCTNTHYSKV--GGVQCSELNILENEFLERVRYRIIPRDDNIENC 176
           A+K L DS   N H+++   G +   E+N +E E LE   + +    D++  C
Sbjct: 103 AAKTLNDSSPLNKHWAEYTDGLLILREVNTIERELLEYFDWDVTISTDDLITC 155

>Smik_7.138 Chr7 (249640..250953) [1314 bp, 437 aa] {ON} YGL134W
           (REAL)
          Length = 437

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 66/137 (48%), Gaps = 14/137 (10%)

Query: 37  ISRMLSFLIQIND-----ANNAGNQTMELTRFHSKAAPSITVYQYLIRLTKYSSLEHSVL 91
           + R +  L+++++      +N+G +  E   F+ K+ PS++   +L R+      E +V 
Sbjct: 271 LKRTIDLLLKLSNNKSCIGSNSGMEKKEYANFYMKSKPSLSSVDFLKRIQDKCKYEPTVY 330

Query: 92  LSAVYYIDLL---------SAVYPEFTLNSLTVHRFLLTATTIASKGLCDSFCTNTHYSK 142
           L A++ I++L           +  +  L    VHR ++ A  +++K L D   ++ ++SK
Sbjct: 331 LVAMFLIEMLFLTRNKNGDDGLQLKRKLKEKEVHRVIIAAVRLSTKLLEDYVHSHEYFSK 390

Query: 143 VGGVQCSELNILENEFL 159
           V G+    L  LE   L
Sbjct: 391 VCGISKRLLTKLEVSLL 407

>Kwal_56.24151 s56 complement(874353..875795) [1443 bp, 480 aa] {ON}
           YPL219W (PCL8) - cyclin (Pho85p) [contig 165] FULL
          Length = 480

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 69/140 (49%), Gaps = 8/140 (5%)

Query: 34  VVIISRMLSFLIQINDANNA--GNQTMELTRFHSKAAPSITVYQYLIRLTKYSSLEHSVL 91
           + I +  ++FL+ ++   N   GN   +L  F+  + P++   +YL RL    S    V 
Sbjct: 317 LTIYTTTVAFLLVLSKNANVPLGNPPPQLATFNMDSTPTLAYEEYLQRLHCKFSFAPIVY 376

Query: 92  LSAVYYIDLL------SAVYPEFTLNSLTVHRFLLTATTIASKGLCDSFCTNTHYSKVGG 145
           L+A + +  L      + +  ++ L++  VHR ++ +  +A+K L D   ++T +S++ G
Sbjct: 377 LTAAHLLQSLFLTRKDNKLCCKYHLDNCQVHRLIIASIRLATKLLEDCVHSHTCFSRICG 436

Query: 146 VQCSELNILENEFLERVRYR 165
           +    L  LE  FL  + + 
Sbjct: 437 ISKKLLTKLEIAFLNCINFE 456

>SAKL0F09856g Chr6 complement(756909..757916) [1008 bp, 335 aa] {ON}
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p cyclin-
           dependent kinase (Cdk) to contribute to entry into the
           mitotic cell cycle essential for cell morphogenesis
           localizes to sites of polarized cell growth
          Length = 335

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 65/138 (47%), Gaps = 11/138 (7%)

Query: 67  AAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLN-SLTVHRFLLTATTI 125
           A   +++  ++  L  +S+++   L+S V Y+  L ++ P        T HR  L    +
Sbjct: 38  AGSVVSLVDFIKGLITHSNVQTPTLMSTVVYLTRLRSIIPATVYGIETTRHRIFLGCLIL 97

Query: 126 ASKGLCDSFCTNTHYSKV--GGVQCSELNILENEFLERVRYRIIPRDDNIENCKIEQKLG 183
           A+K L DS   N H+S+   G +   E+N +E E LE   +++     ++  C       
Sbjct: 98  AAKNLNDSSPLNKHWSRYTNGLLDIREVNTIERELLEYFDWKLRIDTQDLITCL------ 151

Query: 184 SNMLIPMKNAS--QRGPD 199
           S+ L P+K+ +  QR  D
Sbjct: 152 SSFLKPIKDQTTYQRQQD 169

>Suva_4.118 Chr4 (223497..224426) [930 bp, 309 aa] {ON} YDL127W
           (REAL)
          Length = 309

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 68/146 (46%), Gaps = 11/146 (7%)

Query: 67  AAPSITVYQYLIRLTKYSSLEHSVLLS-AVYYIDLLSAVYPEFTLNSLTVHRFLLTATTI 125
           A P+  + +++ RL K+S+++   L++ +VY + L S +         T HR  L    +
Sbjct: 43  ALPAPPLVKFINRLIKHSNVQTPTLMATSVYLVKLRSIIPSNVYGIETTRHRIFLGCLIL 102

Query: 126 ASKGLCDSFCTNTHYSKV--GGVQCSELNILENEFLERVRYRI-IPRDDNIENCKIEQKL 182
           A+K L DS   N H+++   G +   E+N +E E L    + + I  DD I +       
Sbjct: 103 AAKTLNDSSPLNKHWAEYTDGLLLLREVNTIERELLGYFDWDVTISTDDLITSL------ 156

Query: 183 GSNMLIPMKNASQRGPDNGFNVLQNY 208
            S  L PMK  S   P    ++  N+
Sbjct: 157 -SPFLQPMKEESVHKPQQERHISNNF 181

>Smik_4.110 Chr4 (211556..212482) [927 bp, 308 aa] {ON} YDL127W
           (REAL)
          Length = 308

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 56/113 (49%), Gaps = 3/113 (2%)

Query: 67  AAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLN-SLTVHRFLLTATTI 125
           A P+  + +++ RL K+S+++   L++   Y+  L ++ P        T HR  L    +
Sbjct: 43  ALPAPPLTEFINRLIKHSNVQTPTLMATSVYLAKLRSLIPSKVYGIETTRHRIFLGCLIL 102

Query: 126 ASKGLCDSFCTNTHYSKV--GGVQCSELNILENEFLERVRYRIIPRDDNIENC 176
           A+K L DS   N H+++   G +   E+N +E E LE   + +    +++  C
Sbjct: 103 AAKTLNDSSPLNKHWAEYTDGLLLLREVNTIERELLEYFDWDVTISTEDLITC 155

>TBLA0J00650 Chr10 complement(152884..153975) [1092 bp, 363 aa] {ON}
           Anc_7.289 YDL179W
          Length = 363

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 62/130 (47%), Gaps = 8/130 (6%)

Query: 40  MLSFLIQINDANNAGNQTMELTRFHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYID 99
           M+ FL+      N+  Q    T   S+  PS+ ++  + RL  +S+++   L+S + Y+ 
Sbjct: 19  MIDFLV---STTNSIIQIESETSSTSQQIPSLALF--IKRLIVHSNVQTPTLMSTLVYLT 73

Query: 100 LLSAVYPEFTLN-SLTVHRFLLTATTIASKGLCDSFCTNTHYSKV--GGVQCSELNILEN 156
            L  + P   +    T HR  +    +A+K L DS   N H+++   G  +  E+N +E 
Sbjct: 74  KLREIIPSDVVGIETTRHRIFIGCLILAAKSLNDSSPLNRHWTQYTNGLFKIQEINTIER 133

Query: 157 EFLERVRYRI 166
           E LE   + +
Sbjct: 134 ELLEYFNWDV 143

>NCAS0A13770 Chr1 complement(2704299..2705237) [939 bp, 312 aa] {ON}
           Anc_7.289
          Length = 312

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 59/126 (46%), Gaps = 10/126 (7%)

Query: 72  TVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLN-SLTVHRFLLTATTIASKGL 130
           T+  ++  L K+S+++   L++   Y+  L ++ P        T HR  L    +A+K L
Sbjct: 49  TLSNFIKALIKHSNVQTPTLMATTVYLSKLKSIIPCNVYGIETTRHRIFLGCLILAAKTL 108

Query: 131 CDSFCTNTHYSKV--GGVQCSELNILENEFLERVRYRIIPRDDNIENCK-------IEQK 181
            DS   N H+++   G +Q  E+N +E E LE   + +  +  ++  C        IEQ 
Sbjct: 109 NDSSPMNKHWAQYTDGLLQIREVNTIERELLEYFDWDVTIKTKDLIICLSPLLQPIIEQS 168

Query: 182 LGSNML 187
           L  N +
Sbjct: 169 LRKNQM 174

>Suva_14.50 Chr14 (84601..85440) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 54/101 (53%), Gaps = 3/101 (2%)

Query: 67  AAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYP-EFTLNSLTVHRFLLTATTI 125
           AA   ++  ++ RL +Y+++    LL+AV Y++ L  + P + T    T+HR  L    +
Sbjct: 49  AARLPSLMTFITRLVRYTNVYTPTLLTAVCYLNKLKRILPKDATGLPSTIHRIFLACLIL 108

Query: 126 ASKGLCDSFCTNTHYSKV--GGVQCSELNILENEFLERVRY 164
           ++K   DS   N H++K   G     ++N++E + L+ + +
Sbjct: 109 SAKFHNDSSPLNKHWAKYTDGLFTLEDINLMERQLLQLLNW 149

>CAGL0E02233g Chr5 (215934..216734) [801 bp, 266 aa] {ON} similar to
           uniprot|P24867 Saccharomyces cerevisiae YNL289w PCL1
           cyclin
          Length = 266

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 69/139 (49%), Gaps = 14/139 (10%)

Query: 64  HSKAA-PSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYP-EFTLNSLTVHRFLLT 121
           HSK   PS+  +  + RL +Y+++    LL+ V Y++ L  + P + T    T+HR  L 
Sbjct: 47  HSKEHLPSLMTF--ITRLVRYTNVYTPTLLATVCYLNKLKRILPKDATGLPSTIHRLFLA 104

Query: 122 ATTIASKGLCDSFCTNTHYSKV--GGVQCSELNILENEFLERVRYRI-IPRDDNIENCKI 178
              ++SK   DS   N H+++   G     ++N++E + L+ + + I +  DD I + + 
Sbjct: 105 CLILSSKCHNDSSPKNVHWARYTDGLFSLEDINLMERQLLQLLNWDINVSEDDLILDLR- 163

Query: 179 EQKLGSNMLIPMKNASQRG 197
                  +L P+K   QR 
Sbjct: 164 ------PLLEPIKEDLQRS 176

>Kpol_1020.8 s1020 (18215..19105) [891 bp, 296 aa] {ON}
           (18215..19105) [891 nt, 297 aa]
          Length = 296

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 55/112 (49%), Gaps = 6/112 (5%)

Query: 65  SKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPE--FTLNSLTVHRFLLTA 122
           S A P   + +++  L   S+++   L++   Y+  L  + P   + + S T HR  L  
Sbjct: 41  SIALPPPPLVKFITNLCLKSNVQTPTLMATTVYLKKLKNIIPPNVYGIES-TRHRIFLGC 99

Query: 123 TTIASKGLCDSFCTNTHYSKV--GGVQCSELNILENEFLERVRYRI-IPRDD 171
             +ASK L DS   N H+++   G +Q  E+N +E E LE   + I I  DD
Sbjct: 100 LILASKTLNDSSPLNKHWARYTSGILQLREVNTIERELLEYFDWNIQITTDD 151

>Skud_7.139 Chr7 (260060..261364) [1305 bp, 434 aa] {ON} YGL134W
           (REAL)
          Length = 434

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 52/106 (49%), Gaps = 9/106 (8%)

Query: 59  ELTRFHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLL---------SAVYPEFT 109
           E   F+ K+ PS++   +L R+      E +V L A + +D L         +A+  +  
Sbjct: 296 EYANFYMKSKPSLSSVDFLRRIQDKCEYEPAVYLVATFLMDTLFLTRNERNNNALQLKLK 355

Query: 110 LNSLTVHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCSELNILE 155
           L    VHR ++ +  +++K L D   ++ ++SKV GV    L+ LE
Sbjct: 356 LQEKEVHRVIIASVRLSTKLLEDFVHSHEYFSKVCGVSKRLLSKLE 401

>CAGL0J09328g Chr10 (920703..921596) [894 bp, 297 aa] {ON} similar
           to uniprot|P25693 Saccharomyces cerevisiae YDL127w PCL2
           and similar to uniprot|Q12477 Saccharomyces cerevisiae
           YDL179w PCL9
          Length = 297

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 51/103 (49%), Gaps = 3/103 (2%)

Query: 67  AAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLN-SLTVHRFLLTATTI 125
           A P+  +  ++ +L KYS+++   L++   ++  L ++ P        T HR  L    +
Sbjct: 43  AIPAPKLELFIKKLVKYSNVQTPTLMATTVFLTKLRSIIPANVYGIETTRHRIFLGCLIL 102

Query: 126 ASKGLCDSFCTNTHYSKV--GGVQCSELNILENEFLERVRYRI 166
           ++K L DS   N H+++   G +   E+N +E E LE   + +
Sbjct: 103 SAKTLNDSSPLNKHWAQYTDGLLHLKEVNTIERELLEYFDWNL 145

>ZYRO0C09284g Chr3 complement(706160..707095) [936 bp, 311 aa] {ON}
           some similarities with uniprot|P25693 Saccharomyces
           cerevisiae YDL127W PCL2 G1 cyclin associates with Pho85p
           cyclin-dependent kinase (Cdk) to contribute to entry
           into the mitotic cell cycle essential for cell
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 311

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 55/113 (48%), Gaps = 5/113 (4%)

Query: 68  APSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPE--FTLNSLTVHRFLLTATTI 125
           +P+  + +++  L  YS+++   L++   Y+  L ++ P   F + + T HR  L    +
Sbjct: 42  SPAPPLMRFIKTLISYSNVQTPTLMATTVYLTKLRSIIPANVFGIET-TRHRIFLGCLIL 100

Query: 126 ASKGLCDSFCTNTHYSKV--GGVQCSELNILENEFLERVRYRIIPRDDNIENC 176
           A+K L DS   N H++    G +   E+N +E E LE   + +    + +  C
Sbjct: 101 AAKTLNDSSPLNKHWASYTDGLLHIREVNTIERELLEYFDWNVCITTEELVAC 153

>Skud_4.128 Chr4 (230632..231558) [927 bp, 308 aa] {ON} YDL127W
           (REAL)
          Length = 308

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 55/111 (49%), Gaps = 4/111 (3%)

Query: 67  AAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLN-SLTVHRFLLTATTI 125
           A P+  + +++  L K+S+++   L++   Y+  L ++ P        T HR  L    +
Sbjct: 43  ALPAPPLTKFINGLIKHSNVQTPTLMATSVYLAKLRSIIPSNVYGIETTRHRIFLGCLIL 102

Query: 126 ASKGLCDSFCTNTHYSKV--GGVQCSELNILENEFLERVRYRI-IPRDDNI 173
           A+K L DS   N H+++   G +   E+N +E E LE   + + I  DD I
Sbjct: 103 AAKTLNDSSPLNKHWAEYTDGLLVLREVNTIERELLEYFDWDVTISTDDLI 153

>AFR159C Chr6 complement(723082..724008) [927 bp, 308 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL127W
           (PCL2) and YDL179W (PCL9)
          Length = 308

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 63/130 (48%), Gaps = 9/130 (6%)

Query: 71  ITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLNSLTV-HRFLLTATTIASKG 129
           +++  ++  L K S+++   L+S V Y+  L ++ P       T  HR  L    +A+K 
Sbjct: 43  LSLVDFIKGLVKRSNVQTPTLMSTVVYLARLRSIIPANVYGIETSRHRMFLGCLILAAKN 102

Query: 130 LCDSFCTNTHYSKV--GGVQCSELNILENEFLERVRYRIIPRDDNIENCKIEQKLGSNML 187
           L DS   N H+ +   G +   E+N +E E LE   + +   + ++ +C       S+ L
Sbjct: 103 LNDSSPMNKHWCRYTDGLLSLREVNTIERELLEYFNWNLRITNQDLISCL------SHFL 156

Query: 188 IPMKNASQRG 197
            P++++  RG
Sbjct: 157 NPIRDSFIRG 166

>Smik_14.42 Chr14 (72224..73063) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 53/104 (50%), Gaps = 5/104 (4%)

Query: 64  HSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYP-EFTLNSLTVHRFLLTA 122
           H    PS+  +  + RL +Y+++    LL+A  Y++ L  + P + T    T+HR  L  
Sbjct: 48  HMARLPSLMTF--ITRLVRYTNVYTPTLLTAACYLNKLKRILPKDATGLPSTIHRIFLAC 105

Query: 123 TTIASKGLCDSFCTNTHYSKV--GGVQCSELNILENEFLERVRY 164
             +++K   DS   N H+++   G     ++N++E + L+ + +
Sbjct: 106 LILSAKFHNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>KNAG0B02930 Chr2 (563319..564257) [939 bp, 312 aa] {ON} Anc_7.289
           YDL179W
          Length = 312

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 40/80 (50%), Gaps = 2/80 (2%)

Query: 89  SVLLSAVYYIDLLSAVYPEFTLNSLTVHRFLLTATTIASKGLCDSFCTNTHYSKVGG--V 146
           +++ S VY + L   + P       T HR  L    IA+K L D+   N H+SK     +
Sbjct: 66  TLMASTVYLVRLKDILPPNIIGIETTRHRLFLGCLIIAAKTLNDNSPLNKHWSKHTNNLL 125

Query: 147 QCSELNILENEFLERVRYRI 166
              E+NI+E E L  +R+R+
Sbjct: 126 PNREINIIERELLSYLRWRV 145

>Skud_14.48 Chr14 (81435..82274) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 54/106 (50%), Gaps = 5/106 (4%)

Query: 64  HSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYP-EFTLNSLTVHRFLLTA 122
           H    PS+  +  + RL +Y+++    LL+A  Y++ L  + P + T    T+HR  L  
Sbjct: 48  HVARLPSLMTF--ITRLVRYTNVYTPTLLTAACYLNKLKRILPKDATGLPSTIHRIFLAC 105

Query: 123 TTIASKGLCDSFCTNTHYSKV--GGVQCSELNILENEFLERVRYRI 166
             +++K   DS   N H+++   G     ++N++E + L+ + + +
Sbjct: 106 LILSAKFHNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNWDL 151

>YNL289W Chr14 (87897..88736) [840 bp, 279 aa] {ON}  PCL1Cyclin,
           interacts with cyclin-dependent kinase Pho85p; member of
           the Pcl1,2-like subfamily, involved in the regulation of
           polarized growth and morphogenesis and progression
           through the cell cycle; localizes to sites of polarized
           cell growth
          Length = 279

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 53/104 (50%), Gaps = 5/104 (4%)

Query: 64  HSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYP-EFTLNSLTVHRFLLTA 122
           H    PS+  +  + RL +Y+++    LL+A  Y++ L  + P + T    T+HR  L  
Sbjct: 48  HLTRLPSLMTF--ITRLVRYTNVYTPTLLTAACYLNKLKRILPRDATGLPSTIHRIFLAC 105

Query: 123 TTIASKGLCDSFCTNTHYSKV--GGVQCSELNILENEFLERVRY 164
             +++K   DS   N H+++   G     ++N++E + L+ + +
Sbjct: 106 LILSAKFHNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>SAKL0C12100g Chr3 complement(1083684..1084628) [945 bp, 314 aa]
           {ON} similar to gnl|GLV|CAGL0E02233g Candida glabrata
           CAGL0E02233g and some similarites with YNL289W
           uniprot|P24867 Saccharomyces cerevisiae YNL289W PCL1
           Pho85 cyclin of the Pcl1 2-like subfamily involved in
           entry into the mitotic cell cycle and regulation of
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 314

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 61/125 (48%), Gaps = 9/125 (7%)

Query: 76  YLIRLTKYSSLEHSVLLSAVYYIDLLSAVYP-EFTLNSLTVHRFLLTATTIASKGLCDSF 134
           ++ +L +Y+++  S LL+ V Y+  L  + P + T    T HR  L    +++K   DS 
Sbjct: 59  FITKLVRYTNVYTSTLLTTVCYLSKLKTILPRDATGLPSTTHRIFLACLILSAKFHNDSS 118

Query: 135 CTNTHYSKV--GGVQCSELNILENEFLERVRYRIIPRDDNIENCKIEQKLGSNMLIPMKN 192
             N H+S+   G     ++N++E + L+ + +     D  I    + Q L   +L+P+K 
Sbjct: 119 PLNAHWSRYTDGLFSLEDVNLMERQLLQLLHW-----DLRINQDALAQDL-QWLLLPIKE 172

Query: 193 ASQRG 197
             +R 
Sbjct: 173 DLKRS 177

>YGL134W Chr7 (255663..256964) [1302 bp, 433 aa] {ON}  PCL10Pho85p
           cyclin; recruits, activates, and targets Pho85p
           cyclin-dependent protein kinase to its substrate
          Length = 433

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 52/108 (48%), Gaps = 7/108 (6%)

Query: 59  ELTRFHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLL-------SAVYPEFTLN 111
           E + F+ K+ P+++   +L R+      + +V L A + ID L       + +  +  L 
Sbjct: 296 EYSNFYMKSKPTLSSADFLKRIQDKCEYQPTVYLVATFLIDTLFLTRDGNNILQLKLNLQ 355

Query: 112 SLTVHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCSELNILENEFL 159
              VHR ++ A  +++K L D   ++ ++SKV G+    L  LE   L
Sbjct: 356 EKEVHRMIIAAVRLSTKLLEDFVHSHEYFSKVCGISKRLLTKLEVSLL 403

>KNAG0F01870 Chr6 (356849..358300) [1452 bp, 483 aa] {ON} Anc_6.236
           YGL134W
          Length = 483

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 47/94 (50%), Gaps = 8/94 (8%)

Query: 61  TRFHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLL--------SAVYPEFTLNS 112
           +RF  K  PS++   ++ R+      +  V LSA Y + +L        +++  +F L  
Sbjct: 349 SRFIMKNIPSLSFVDFIKRIHDKCHFDTPVYLSATYLLQILFLERSAESNSLELKFKLQR 408

Query: 113 LTVHRFLLTATTIASKGLCDSFCTNTHYSKVGGV 146
             +HR ++    I++K L D   ++ ++SKV GV
Sbjct: 409 DGLHRLIIALVRISTKLLEDQIHSHDYFSKVCGV 442

>TBLA0A07890 Chr1 (1943543..1944628) [1086 bp, 361 aa] {ON} Anc_3.70
           YNL289W
          Length = 361

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 54/106 (50%), Gaps = 7/106 (6%)

Query: 68  APSI----TVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLN-SLTVHRFLLTA 122
           APSI    ++  ++ R+ +Y++++ S LL  V Y++ L  + P   +    T+HR  L  
Sbjct: 52  APSIPKLPSLMTFITRIVRYTNVQVSTLLMTVCYLNKLKKLLPADAVGIPSTIHRLFLAC 111

Query: 123 TTIASKGLCDSFCTNTHYSKV--GGVQCSELNILENEFLERVRYRI 166
             +++K   DS   N H++    G     ++N++E + L  + + +
Sbjct: 112 LILSAKFHNDSSPLNVHWANYTNGLFSVKDVNLMERQLLSLLDWNL 157

>NCAS0D04070 Chr4 (764711..766132) [1422 bp, 473 aa] {ON} Anc_6.236
          Length = 473

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/109 (23%), Positives = 48/109 (44%), Gaps = 8/109 (7%)

Query: 55  NQTMELTRFHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPE------- 107
           ++ +  + F  K+ PS++   ++ R+      +  V L A Y +  L  +  E       
Sbjct: 332 DEMIAFSNFKMKSPPSLSYADFIQRIQNKCEYDPHVYLIATYLLQTLLLIREEHSRKLKL 391

Query: 108 -FTLNSLTVHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCSELNILE 155
            F      VHR ++    IA+K L D   ++ ++ KV G+    L+ LE
Sbjct: 392 RFKFEKSDVHRLIIATVRIATKLLEDHVHSHEYFCKVSGISKKLLSKLE 440

>NDAI0A02270 Chr1 (511135..512127) [993 bp, 330 aa] {ON} Anc_7.289
          Length = 330

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 47/104 (45%), Gaps = 3/104 (2%)

Query: 76  YLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLN-SLTVHRFLLTATTIASKGLCDSF 134
           ++  L  +S+++   L++   Y+  L  + P+       T HR  L    +A+K L DS 
Sbjct: 56  FIKNLVMHSNVQTPTLMATSVYLSKLRLIIPKNVYGMETTRHRIFLGCLILAAKTLNDSS 115

Query: 135 CTNTHYSKV--GGVQCSELNILENEFLERVRYRIIPRDDNIENC 176
             N H++K   G +   E+N +E E LE   + +      +  C
Sbjct: 116 PLNKHWTKYTDGLLHIREVNTIERELLEYFEWNVTITTSELIKC 159

>TDEL0H01550 Chr8 (266510..267439) [930 bp, 309 aa] {ON} Anc_7.289
           YDL179W
          Length = 309

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 34/153 (22%), Positives = 68/153 (44%), Gaps = 13/153 (8%)

Query: 27  RCSRTHLVVIISRMLSFLIQINDANNAGNQTMELTRFHSKAAPSITVYQYLIRLTKYSSL 86
           R     ++  ++   + +IQ+ ++NN  +  +         APS+T   ++  L  +S++
Sbjct: 13  RAVSAEMIQYLASSTACIIQVKNSNNLVDVGL--------PAPSLT--NFIKGLVLHSNV 62

Query: 87  EHSVLLSAVYYIDLLSAVYPEFTLN-SLTVHRFLLTATTIASKGLCDSFCTNTHYSKV-- 143
           +   L++   Y+  L ++ P        T HR  L    +A+K L DS   N H++    
Sbjct: 63  QTPTLMATAVYLAKLRSIIPGNVYGIETTRHRIFLGCLILAAKTLNDSSPLNKHWALYTD 122

Query: 144 GGVQCSELNILENEFLERVRYRIIPRDDNIENC 176
           G +   E+N +E E LE   + +     ++  C
Sbjct: 123 GLLHIHEVNTIERELLEYFDWNVTVTTKDLITC 155

>Suva_7.130 Chr7 (251870..253198) [1329 bp, 442 aa] {ON} YGL134W
           (REAL)
          Length = 442

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 50/108 (46%), Gaps = 7/108 (6%)

Query: 59  ELTRFHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLL-------SAVYPEFTLN 111
           E   F+ K+ PS++   +L R+      E +V L A + +D +         +  +  L 
Sbjct: 305 EYANFYMKSKPSLSSVDFLKRIQDKCEYESTVYLVATFLMDTIYLTRNDNDVLQLKLKLQ 364

Query: 112 SLTVHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCSELNILENEFL 159
              +HR ++    +++K L D   ++ ++SKV GV    L+ LE   L
Sbjct: 365 EKEIHRMIIATVRLSTKLLEDFVHSHEYFSKVCGVSKRLLSKLEVSLL 412

>NDAI0I00860 Chr9 complement(197860..199491) [1632 bp, 543 aa] {ON}
           Anc_6.236 YGL134W
          Length = 543

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 56/120 (46%), Gaps = 11/120 (9%)

Query: 45  IQINDANNAGNQTM-ELTRFHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLL-- 101
           IQ N+A  A + TM   + F  K+ PS+T   YL R+      +  + L A Y +  L  
Sbjct: 394 IQENEA--ASDSTMIRYSNFKMKSLPSLTFELYLDRIHTKCEYDSHIYLIATYLLQTLFL 451

Query: 102 ------SAVYPEFTLNSLTVHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCSELNILE 155
                 +++  +  L S   HR ++    I++K L D   ++ ++ KV G+    L+ LE
Sbjct: 452 ERDSTSNSLKLKMKLESTETHRLIIATIRISTKLLEDHVHSHEYFCKVCGISKKLLSKLE 511

>YDL179W Chr4 (138291..139205) [915 bp, 304 aa] {ON}  PCL9Cyclin,
           forms a functional kinase complex with Pho85p
           cyclin-dependent kinase (Cdk), expressed in late M/early
           G1 phase, activated by Swi5p
          Length = 304

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 48/87 (55%), Gaps = 5/87 (5%)

Query: 84  SSLEHSVLLSAVYYIDLLSAVYPE--FTLNSLTVHRFLLTATTIASKGLCDSFCTNTHYS 141
           S+++   L++   Y++ L +V P+  + +N+ T HR  L    +A+K L DS   N H++
Sbjct: 60  SNVQTPTLMATSVYLNKLKSVIPKNVYGINT-TRHRIFLGCLILAAKTLNDSSPWNKHWT 118

Query: 142 KV--GGVQCSELNILENEFLERVRYRI 166
               G ++  E+N +E E LE + + +
Sbjct: 119 TYTEGLLRIREVNTIERELLEYLNWDV 145

>Ecym_3535 Chr3 (1015509..1016621) [1113 bp, 370 aa] {ON} similar to
           Ashbya gossypii AEL195W
          Length = 370

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 65/128 (50%), Gaps = 13/128 (10%)

Query: 69  PSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYP-EFTLNSLTVHRFLLTATTIAS 127
           PS+T +  + ++ +Y+++  + LL+ V Y++ L  V P + T    T HR  L    +++
Sbjct: 114 PSLTTF--IAKIVRYTNVYTATLLTTVVYLNKLKKVLPKDATGIPSTSHRIFLACLILSA 171

Query: 128 KGLCDSFCTNTHYSKV--GGVQCSELNILENEFLERVRYRI-IPRDDNIENCKIEQKLGS 184
           K   DS   N H+++   G     ++N++E + L+   + I +   D  EN        S
Sbjct: 172 KFHNDSSPLNKHWTEYTDGLFTIQDVNLMERQLLKLFDWNIRVSEHDLHENL-------S 224

Query: 185 NMLIPMKN 192
           ++L+P+K 
Sbjct: 225 SLLLPIKQ 232

>Kwal_23.6006 s23 complement(1411337..1412251) [915 bp, 304 aa] {ON}
           YDL127W (PCL2) - G1 cyclin [contig 12] FULL
          Length = 304

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 45/93 (48%), Gaps = 3/93 (3%)

Query: 71  ITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLN-SLTVHRFLLTATTIASKG 129
           +++  ++  L   S+++   L+S   Y+  L ++ P   L    T HR  L    IA+K 
Sbjct: 45  VSLENFIKGLVVQSNVQTPTLMSTAVYLAKLRSIIPANVLGIETTRHRMFLGCLIIAAKN 104

Query: 130 LCDSFCTNTHYSKV--GGVQCSELNILENEFLE 160
           L DS   N H++    G +   E+N +E E LE
Sbjct: 105 LNDSSPMNKHWASYTNGLLDTREVNTIERELLE 137

>KLLA0B02024g Chr2 (176585..178168) [1584 bp, 527 aa] {ON} some
           similarities with uniprot|P53124 Saccharomyces
           cerevisiae YGL134W PCL10 Pho85p cyclin recruits
           activates and targets Pho85p cyclin-dependent protein
           kinase to its substrate
          Length = 527

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 53/102 (51%), Gaps = 9/102 (8%)

Query: 63  FHSKAAPSITVYQYLIRLTKYSSLEHSVLLSA----VYYIDL-LSAVYPEFTL-NSLT-- 114
           F  K+AP++++ QYL R+    S    + L+A    V Y D+       +F L N +T  
Sbjct: 392 FQMKSAPTLSISQYLDRIESKCSFPPIIYLTASFLLVTYCDIKFDTGSGKFHLENPITES 451

Query: 115 -VHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCSELNILE 155
             HR L+    +A+K L D   +++++SKV G+    L+ LE
Sbjct: 452 MTHRLLIAFIRLAAKLLEDHVHSHSYFSKVCGISKKLLSKLE 493

>ZYRO0E07326g Chr5 complement(560064..561350) [1287 bp, 428 aa] {ON}
           weakly similar to uniprot|P53124 Saccharomyces
           cerevisiae YGL134W PCL10 Pho85p cyclin recruits
           activates and targets Pho85p cyclin-dependent protein
           kinase to its substrate
          Length = 428

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 25/119 (21%), Positives = 55/119 (46%), Gaps = 9/119 (7%)

Query: 46  QINDANNAGN-QTMELTRFHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAV 104
           Q  D  +  N +  +  +F  K+ P++T  +++ R+    +   +V L++ + +  L  +
Sbjct: 273 QAQDQQDVPNPRDWDFNQFSMKSMPTVTYQEFITRIQTKCTYSPAVFLASAFLLQTLCLM 332

Query: 105 YPE--------FTLNSLTVHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCSELNILE 155
             +          L    +HR ++    IA+K + D   ++ ++SKV G+    L+ LE
Sbjct: 333 RNDNNGELCLRHRLQDSQIHRLVIACVRIATKIMEDHVHSHQYFSKVCGISKRLLSRLE 391

>TBLA0A02100 Chr1 complement(508272..509996) [1725 bp, 574 aa] {ON}
           Anc_6.236 YGL134W
          Length = 574

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 46/96 (47%), Gaps = 8/96 (8%)

Query: 59  ELTRFHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLL--------SAVYPEFTL 110
           E   F  K+ P+++  +++ R+         V LSA Y + +L         A+  +  L
Sbjct: 432 EFNNFKMKSTPTLSFGEFIKRIQSKCMFGPIVYLSASYLLQILLLTRDGENGALKLKIIL 491

Query: 111 NSLTVHRFLLTATTIASKGLCDSFCTNTHYSKVGGV 146
           +   +HR ++    IA+K + DS  ++ + SKV GV
Sbjct: 492 HENEIHRLIIATIRIATKLIEDSVHSHLYMSKVCGV 527

>Suva_4.68 Chr4 (125518..126435) [918 bp, 305 aa] {ON} YDL179W
           (REAL)
          Length = 305

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 52/106 (49%), Gaps = 5/106 (4%)

Query: 64  HSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLN-SLTVHRFLLTA 122
           H    P ++++  + ++   S+++   L++   Y++ L ++ P+       T HR  L  
Sbjct: 41  HGCPPPELSIF--IKKVVVQSNVQTPTLMATTVYLNKLKSIIPKNVYGIETTRHRIFLGC 98

Query: 123 TTIASKGLCDSFCTNTHYSKV--GGVQCSELNILENEFLERVRYRI 166
             +A+K L DS   N H++    G ++  E+N +E E LE   + +
Sbjct: 99  LILAAKTLNDSSPWNKHWTTYTEGLLKVREVNTIERELLEYFNWDV 144

>KLTH0A05346g Chr1 complement(445174..446079) [906 bp, 301 aa] {ON}
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p cyclin-
           dependent kinase (Cdk) to contribute to entry into the
           mitotic cell cycle essential for cell morphogenesis
           localizes to sites of polarized cell growth
          Length = 301

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 52/118 (44%), Gaps = 3/118 (2%)

Query: 62  RFHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLN-SLTVHRFLL 120
           R    +A  +++  ++  L   S+++   L+S   Y+  L ++ P        T HR  L
Sbjct: 34  RTGESSAKVVSLVDFIKGLVVQSNVQTPTLMSTAVYLSKLRSIIPANVHGMETTRHRVFL 93

Query: 121 TATTIASKGLCDSFCTNTHYSKV--GGVQCSELNILENEFLERVRYRIIPRDDNIENC 176
               IA+K L DS   N H++    G +   E+N +E E LE   + +     ++  C
Sbjct: 94  GCLIIAAKNLNDSSPMNKHWASYTNGLLNTREVNTIERELLEYFDWNLRISTQDLVTC 151

>Ecym_8038 Chr8 complement(87401..88345) [945 bp, 314 aa] {ON}
           similar to Ashbya gossypii AFR159C
          Length = 314

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 54/115 (46%), Gaps = 3/115 (2%)

Query: 65  SKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLN-SLTVHRFLLTAT 123
           S + P +++  ++  L   S+++   L+S V Y+  L ++ P        T HR  L   
Sbjct: 37  SSSEPILSLVDFIKGLINKSNVQTPTLMSTVVYLTRLRSIIPPNVHGIETTRHRIFLGCL 96

Query: 124 TIASKGLCDSFCTNTHYSKVGG--VQCSELNILENEFLERVRYRIIPRDDNIENC 176
            +ASK L DS   N H+ +     +   E+N +E E LE   + ++  + ++  C
Sbjct: 97  ILASKNLNDSSPMNKHWCQYTNSLLSLREVNTVERELLEYFNWDLLITNKDLITC 151

>KLLA0E13223g Chr5 (1170139..1170987) [849 bp, 282 aa] {ON} similar
           to uniprot|P24867 Saccharomyces cerevisiae YNL289W PCL1
           Pho85 cyclin of the Pcl1 2-like subfamily involved in
           entry into the mitotic cell cycle and regulation of
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 282

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 61/125 (48%), Gaps = 9/125 (7%)

Query: 76  YLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLN-SLTVHRFLLTATTIASKGLCDSF 134
           ++ RL +Y+++  S LL+ V Y++ L  + P        T HR  L    +++K   DS 
Sbjct: 62  FISRLVRYTNVYTSTLLTTVVYLNRLRELLPSDAAGLPTTCHRIFLACLILSAKYHNDSS 121

Query: 135 CTNTHYSKV--GGVQCSELNILENEFLERVRYRIIPRDDNIENCKIEQKLGSNMLIPMKN 192
             N H++K   G     ++N++E + L+     +   D  +E+ ++   L  ++  P++ 
Sbjct: 122 PLNKHWTKYTDGMFTLRDVNLMERQLLQ-----LFEWDLRVESEELWDNL-YDLANPIRR 175

Query: 193 ASQRG 197
             +RG
Sbjct: 176 DLERG 180

>Skud_4.79 Chr4 (134241..135170) [930 bp, 309 aa] {ON} YDL179W
           (REAL)
          Length = 309

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 58/127 (45%), Gaps = 9/127 (7%)

Query: 73  VYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLN-SLTVHRFLLTATTIASKGLC 131
           ++ ++ ++   S+++   L++   Y++ L  + P        T HR  L    +A+K L 
Sbjct: 48  LFTFIKKVVIQSNVQTPTLMATTVYLNKLKNIIPTNVYGIETTRHRIFLGCLILAAKTLN 107

Query: 132 DSFCTNTHYSKV--GGVQCSELNILENEFLERVRYRIIPRDDNIENCKIEQKLGSNMLIP 189
           DS   N H+S    G ++  E+N +E E LE   + +     ++ N        ++ L+P
Sbjct: 108 DSSPWNKHWSTYTEGLLKVREVNTIERELLEYFNWDVKITSSDLINAL------AHFLVP 161

Query: 190 MKNASQR 196
           +K    R
Sbjct: 162 IKEQLSR 168

>TPHA0A00580 Chr1 (101866..102735) [870 bp, 289 aa] {ON} Anc_3.70
           YNL289W
          Length = 289

 Score = 38.5 bits (88), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 26/113 (23%), Positives = 59/113 (52%), Gaps = 5/113 (4%)

Query: 65  SKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLNSL--TVHRFLLTA 122
           SK +   ++  ++ +L +Y+++  S LL+   Y+  L  + P+   N L  T+HR  L  
Sbjct: 50  SKESKLPSLKTFITKLVRYTNVYTSTLLTTACYLKKLQRILPK-DANGLPSTIHRIFLAC 108

Query: 123 TTIASKGLCDSFCTNTHYSKV--GGVQCSELNILENEFLERVRYRIIPRDDNI 173
             +++K   DS   N H+++   G     ++N++E + L  + + I  +++++
Sbjct: 109 LILSAKFHNDSSPLNKHWAEYTDGLFSLEDVNLMEVQLLALLNWDIRIKEEDL 161

>KNAG0A01490 Chr1 (62182..62970) [789 bp, 262 aa] {ON} Anc_3.70
           YNL289W
          Length = 262

 Score = 37.7 bits (86), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 47/88 (53%), Gaps = 5/88 (5%)

Query: 76  YLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFT--LNSLTVHRFLLTATTIASKGLCDS 133
           ++ +L +Y+++    LL+ V Y++ L  + P+    L S T+HR  L    +++K   DS
Sbjct: 63  FITKLVRYTNVYTPTLLTTVCYLNKLKRILPKDAKGLPS-TIHRLFLACLILSAKYHNDS 121

Query: 134 FCTNTHYSKV--GGVQCSELNILENEFL 159
              N H++K   G     ++N++E + L
Sbjct: 122 SPLNKHWAKYTDGLFSLEDINLMERQLL 149

>KAFR0A08280 Chr1 complement(1661106..1661831) [726 bp, 241 aa] {ON}
           Anc_3.70 YNL289W
          Length = 241

 Score = 37.0 bits (84), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 49/98 (50%), Gaps = 3/98 (3%)

Query: 72  TVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLN-SLTVHRFLLTATTIASKGL 130
           T+ +++ +L +Y+ +    LL  + Y++ L  + P+       T+HR  L    I++K  
Sbjct: 55  TLREFICKLVEYTHVYTPTLLMTISYLNRLRRILPKGAAGIPSTLHRIFLACLIISAKNH 114

Query: 131 CDSFCTNTHYSKV--GGVQCSELNILENEFLERVRYRI 166
            DS   N H++K   G     ++N++E   L+ + + +
Sbjct: 115 NDSSPLNRHWTKYTDGLFTLEDVNLMERHLLDLLNWNL 152

>KAFR0K02385 Chr11 complement(491679..492905) [1227 bp, 408 aa] {ON}
          Length = 408

 Score = 37.4 bits (85), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 49/95 (51%), Gaps = 11/95 (11%)

Query: 58  MELTRFHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLN------ 111
           ME+ + HS   PS+T   +L R+        ++ +++ Y   LL  ++ + + N      
Sbjct: 277 MEVYKMHS--IPSLTYRSFLNRVQSKCEFRSTIYVASCY---LLQQLFLDDSQNLKSKFD 331

Query: 112 SLTVHRFLLTATTIASKGLCDSFCTNTHYSKVGGV 146
            ++VHR ++    ++SK + D   ++ ++SKV G+
Sbjct: 332 EISVHRIIIAVIRLSSKLIEDKVHSHEYFSKVAGI 366

>SAKL0A03938g Chr1 (367076..368581) [1506 bp, 501 aa] {ON} weakly
           similar to uniprot|Q6B153 Saccharomyces cerevisiae
           YPL219W PCL8 Cyclin interacts with Pho85p
           cyclin-dependent kinase (Cdk) to phosphorylate and
           regulate glycogen synthase also activates Pho85p for
           Glc8p phosphorylation
          Length = 501

 Score = 37.0 bits (84), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 45/91 (49%), Gaps = 7/91 (7%)

Query: 63  FHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLL-------SAVYPEFTLNSLTV 115
           F  K++PS++  +YL R+         V L+A Y +  L       S +   F L    +
Sbjct: 368 FIMKSSPSLSYEEYLERIHSKLMFSPVVYLTATYLLHELTLTRQQDSKLALSFPLKITQI 427

Query: 116 HRFLLTATTIASKGLCDSFCTNTHYSKVGGV 146
           HR ++ +  +A+K L D   ++ ++SKV GV
Sbjct: 428 HRIIIASIRLAAKLLEDFVHSHAYFSKVCGV 458

>ZYRO0C02068g Chr3 complement(163475..164467) [993 bp, 330 aa] {ON}
           similar to uniprot|P24867 Saccharomyces cerevisiae
           YNL289W PCL1 Pho85 cyclin of the Pcl1 2-like subfamily
           involved in entry into the mitotic cell cycle and
           regulation of morphogenesis localizes to sites of
           polarized cell growth
          Length = 330

 Score = 36.6 bits (83), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 24/106 (22%), Positives = 56/106 (52%), Gaps = 5/106 (4%)

Query: 72  TVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFT--LNSLTVHRFLLTATTIASKG 129
           ++  ++ RL +++++  S LL    Y++ L  + P+    L S T+HR  L    +++K 
Sbjct: 87  SLMSFISRLVRHTNVYTSTLLVTACYLNRLKCILPKDASGLPS-TIHRMFLACLILSAKF 145

Query: 130 LCDSFCTNTHYSKV--GGVQCSELNILENEFLERVRYRIIPRDDNI 173
             DS   N H++K   G     ++N++E + ++ + + +   +D++
Sbjct: 146 HNDSSPLNKHWAKYTDGLFSVEDVNLMERQLVQLLNWDLRVTNDDL 191

>Kpol_1020.16 s1020 complement(33477..34325) [849 bp, 282 aa] {ON}
           complement(33477..34325) [849 nt, 283 aa]
          Length = 282

 Score = 36.2 bits (82), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 47/92 (51%), Gaps = 3/92 (3%)

Query: 76  YLIRLTKYSSLEHSVLLSAVYYIDLLSAVYP-EFTLNSLTVHRFLLTATTIASKGLCDSF 134
           ++ +L +Y+++  S LL+   Y+  L  + P + T    T+HR  L    I++K   DS 
Sbjct: 58  FITKLVRYTNVYTSTLLTTTCYLKKLQRILPKDATGLPSTIHRMFLACLIISAKYHNDSS 117

Query: 135 CTNTHYSKV--GGVQCSELNILENEFLERVRY 164
             N H+++   G     ++N++E + L  + +
Sbjct: 118 PLNKHWAEYTDGLFSLEDVNLMEMQLLALLNW 149

>KAFR0C01560 Chr3 complement(320148..320951) [804 bp, 267 aa] {ON}
           Anc_3.70 YNL289W
          Length = 267

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 45/84 (53%), Gaps = 5/84 (5%)

Query: 76  YLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFT--LNSLTVHRFLLTATTIASKGLCDS 133
           ++ RL +Y+++    LL+ V Y++ L  + P+    L S T+HR  L    I++K   DS
Sbjct: 63  FITRLVRYTNVYTPTLLTTVCYLNKLKRILPKDAKGLPS-TIHRLFLACLIISAKFHNDS 121

Query: 134 FCTNTHYSKV--GGVQCSELNILE 155
              N H+++   G     ++N++E
Sbjct: 122 SPLNKHWTRYTDGLFSLEDINLME 145

>NCAS0A09870 Chr1 complement(1974028..1974912) [885 bp, 294 aa] {ON}
           Anc_3.70
          Length = 294

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 43/83 (51%), Gaps = 3/83 (3%)

Query: 76  YLIRLTKYSSLEHSVLLSAVYYIDLLSAVYP-EFTLNSLTVHRFLLTATTIASKGLCDSF 134
           ++ RL +Y+++    LL+ V Y++ L  + P + T    T+HR  L    +++K   DS 
Sbjct: 58  FITRLVRYTNVYTPTLLTTVCYLNKLKRILPKDATGLPSTIHRIFLACLILSAKFHNDSS 117

Query: 135 CTNTHYSKV--GGVQCSELNILE 155
             N H+ K   G     ++N++E
Sbjct: 118 PLNKHWVKYTDGLFTLEDVNLME 140

>CAGL0H08998g Chr8 (877952..879595) [1644 bp, 547 aa] {ON} weakly
           similar to uniprot|Q08966 Saccharomyces cerevisiae
           YPL219w PCL8
          Length = 547

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 47/101 (46%), Gaps = 8/101 (7%)

Query: 63  FHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLL--------SAVYPEFTLNSLT 114
           F  K+ PS++   +L R+         + L+A Y + +L        S +     L    
Sbjct: 414 FTMKSKPSVSAEIFLGRIQNKCEFGPIIYLAAAYLLQILFLTRDNPDSNIRVRLKLRENE 473

Query: 115 VHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCSELNILE 155
           +HR +++   +++K + D   ++ ++SKV GV    L+ LE
Sbjct: 474 IHRLIISTVRVSAKLVEDFVHSHEYFSKVCGVSKKLLSKLE 514

>TPHA0E02750 Chr5 (574999..576816) [1818 bp, 605 aa] {ON} Anc_6.236
           YGL134W
          Length = 605

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 49/104 (47%), Gaps = 14/104 (13%)

Query: 63  FHSKAAPSITVYQYLIRLTKYSSLEHS------VLLSAVYYI-----DLLSAVYPEFTLN 111
           F  K+ P++T   ++ R+      + +      VLL +++ +     +L+   YP   L 
Sbjct: 469 FKMKSTPTVTYQNFIERIQSKCLFDETIYLGTIVLLQSLFLVREKETNLIKLKYP---LE 525

Query: 112 SLTVHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCSELNILE 155
              VHR L+ +  ++SK L D   ++ + SKV GV    L  LE
Sbjct: 526 ESYVHRLLIASIRVSSKVLQDFVHSHEYISKVFGVSKRLLTKLE 569

>AEL195W Chr5 (266347..267060) [714 bp, 237 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL289W (PCL1)
          Length = 237

 Score = 35.0 bits (79), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 54/108 (50%), Gaps = 9/108 (8%)

Query: 72  TVYQYLIRLTKYSSLEHSVLLS-AVYYIDLLSAVYPEFTLNSLTVHRFLLTATTIASKGL 130
           +++ ++ RL +Y+++  + LL+ AVY   L   +  + T    T HR  L    +++K  
Sbjct: 53  SIHMFITRLVRYTNVYTATLLTTAVYLERLRLLLPRDATGIPSTAHRIFLACLILSAKFH 112

Query: 131 CDSFCTNTHYSKV--GGVQCSELNILENEFLE------RVRYRIIPRD 170
            DS   N H++K   G     ++N++E + L       RV +R + RD
Sbjct: 113 NDSSPLNKHWTKYTDGLFTTQDVNLMERQLLRLFDWNVRVGHRDLCRD 160

>TDEL0E00790 Chr5 (163333..164097) [765 bp, 254 aa] {ON} Anc_3.70
           YNL289W
          Length = 254

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 51/97 (52%), Gaps = 5/97 (5%)

Query: 72  TVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFT--LNSLTVHRFLLTATTIASKG 129
           ++  ++ RL +++++  S LL+   Y++ L  + P+    L S TVHR  L    +++K 
Sbjct: 51  SLMSFISRLVRHTNVYTSTLLTTACYLNKLKCILPKDASGLPS-TVHRIFLACLILSAKF 109

Query: 130 LCDSFCTNTHYSKVGG--VQCSELNILENEFLERVRY 164
             DS   N H++K         ++N++E + ++ + +
Sbjct: 110 HNDSSPLNRHWAKYTDELFTLEDINLMERQLIQLLNW 146

>Smik_4.60 Chr4 (115068..115985) [918 bp, 305 aa] {ON} YDL179W
           (REAL)
          Length = 305

 Score = 34.7 bits (78), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 41/86 (47%), Gaps = 3/86 (3%)

Query: 84  SSLEHSVLLSAVYYIDLLSAVYPEFTLN-SLTVHRFLLTATTIASKGLCDSFCTNTHYSK 142
           S+++   L++   Y++ L  + P        T HR  L    +A+K L DS   N H++ 
Sbjct: 61  SNVQTPTLMATSVYLNKLRNIIPRNVYGIETTRHRIFLGCLILAAKTLNDSSPWNKHWTT 120

Query: 143 V--GGVQCSELNILENEFLERVRYRI 166
              G ++  E+N +E E LE   + +
Sbjct: 121 YTEGLLRVREVNTIERELLEYFNWDV 146

>KLLA0F05654g Chr6 (552056..552991) [936 bp, 311 aa] {ON} weakly
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p
           cyclin-dependent kinase (Cdk) to contribute to entry
           into the mitotic cell cycle essential for cell
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 311

 Score = 34.3 bits (77), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 27/125 (21%), Positives = 59/125 (47%), Gaps = 9/125 (7%)

Query: 70  SITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLN-SLTVHRFLLTATTIASK 128
           ++++  ++  L ++S+++   L++   Y+  L ++ P        T HR  +    +A+K
Sbjct: 43  TVSLVDFIKSLIRHSNVQTPTLMATTVYLTKLRSILPHDVCGIETTRHRIFIGCLILAAK 102

Query: 129 GLCDSFCTNTHYSKV--GGVQCSELNILENEFLERVRYRIIPRDDNIENCKIEQKLGSNM 186
            L DS   N H++    G     ++N +E E L    + +     N    ++ Q L S+ 
Sbjct: 103 NLNDSSPLNKHWTNYTDGLFTLEDVNTIERELLSLFSWNL-----NFSMQELVQAL-SHF 156

Query: 187 LIPMK 191
           L+P++
Sbjct: 157 LVPIQ 161

>NDAI0F01480 Chr6 (365467..366939) [1473 bp, 490 aa] {ON} Anc_6.236
           YGL134W
          Length = 490

 Score = 34.3 bits (77), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 24/107 (22%), Positives = 46/107 (42%), Gaps = 8/107 (7%)

Query: 57  TMELTRFHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLL--------SAVYPEF 108
           T +   F  K  PS++   +L R+         + +SA Y   +L          +  + 
Sbjct: 349 TKDYVNFTMKNTPSLSYEDFLKRIQSKCMFGAIIYMSATYLFQILLLNRDDSKGPIKLKN 408

Query: 109 TLNSLTVHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCSELNILE 155
            L  + +HR ++    +A+K + D   ++ ++ KV GV    L+ LE
Sbjct: 409 KLQEVEIHRMIIATIRVATKLVEDFVHSHQYFCKVCGVSKRLLSKLE 455

>NDAI0A06050 Chr1 complement(1372672..1373532) [861 bp, 286 aa] {ON}
           Anc_3.70
          Length = 286

 Score = 33.5 bits (75), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 42/83 (50%), Gaps = 3/83 (3%)

Query: 76  YLIRLTKYSSLEHSVLLSAVYYIDLLSAVYP-EFTLNSLTVHRFLLTATTIASKGLCDSF 134
           ++  L +Y+++    LL+ V Y++ L  + P + T    T+HR  L    +++K   DS 
Sbjct: 58  FITNLVRYTNVYTPTLLTTVCYLNKLKRLLPKDATGLPSTIHRIFLACLILSAKFHNDSS 117

Query: 135 CTNTHYSKV--GGVQCSELNILE 155
             N H+ K   G     ++N++E
Sbjct: 118 PLNKHWVKYTDGLFTLEDVNLME 140

>Skud_10.227 Chr10 (413450..415552) [2103 bp, 700 aa] {ON} YJR005W
           (REAL)
          Length = 700

 Score = 33.5 bits (75), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 40/77 (51%), Gaps = 6/77 (7%)

Query: 264 LNTN--IISTTGRIVSPSITEGDSFNLSEHRKTRSRETSVNENSDSPPITIPQ---KRNM 318
           LNTN  ++       SP+   GD  N      T+SR++++ ++ D P   I Q   KR  
Sbjct: 615 LNTNKALLPVDSSSFSPTGANGDRQNSESQSSTKSRKSAMMDDYDKPAEKIHQLKGKRKS 674

Query: 319 KEDDPTNMDRK-STLLR 334
             ++P+ + RK STLLR
Sbjct: 675 SSNNPSKLSRKPSTLLR 691

>NCAS0E02370 Chr5 (464339..467032) [2694 bp, 897 aa] {ON} Anc_7.46
           YOR346W
          Length = 897

 Score = 33.5 bits (75), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 45/108 (41%), Gaps = 16/108 (14%)

Query: 182 LGSNMLIPMKNASQRG-PDNGFNVLQNYYRKIVQLVGNPLNSPDKTSTYFFKMVDP---M 237
           LG    +P   +S+ G P N   ++    + + +++G P N     S  F K+  P    
Sbjct: 613 LGMGRCVPFNKSSRLGTPTNELGIIATEVKSLYRIIGCPPNEVRGVSIQFNKLCSPSINQ 672

Query: 238 NPGIGGTLV----PPSTTIKNNLKDKGNGRLNTNIIST---TGRIVSP 278
            P +    V    PP     NN++DK N       IS    T R++SP
Sbjct: 673 QPALKLPFVKLNAPP-----NNIQDKTNHEFKKRKISLETPTMRLISP 715

>Skud_16.60 Chr16 (110205..111707) [1503 bp, 500 aa] {ON} YPL219W
           (REAL)
          Length = 500

 Score = 33.1 bits (74), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 35/160 (21%), Positives = 61/160 (38%), Gaps = 9/160 (5%)

Query: 14  NIGQIIPLPEEYLRCS-RTHLVVIISRMLSFLIQINDANNAGNQTMELTRFHSKAAPSIT 72
           +I +I  L +E   C  R ++ +I+         +N    +     +   F  K  PS++
Sbjct: 314 SIPRIPDLSDEEALCKFRENIELILQLSKKIDEDVNTLAVSSEDPQKFVNFIMKNPPSLS 373

Query: 73  VYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEF--------TLNSLTVHRFLLTATT 124
              ++ R+         V L A Y + L+     E          L     HR +++A  
Sbjct: 374 FKDFIDRIQNKCMFGSVVYLGATYLLQLVFLTRDEMNGPVKLKAKLQEDQAHRVIISAIR 433

Query: 125 IASKGLCDSFCTNTHYSKVGGVQCSELNILENEFLERVRY 164
           I +K L D   +  +  KV G+    L  LE  F+  V +
Sbjct: 434 ITTKLLEDFVHSQNYICKVFGISKRLLTKLEISFMASVNF 473

>NDAI0C04300 Chr3 (981107..981829) [723 bp, 240 aa] {ON} 
          Length = 240

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 45/103 (43%), Gaps = 11/103 (10%)

Query: 76  YLIRLTKYSSLEHSVLLSAVYYIDLL--------SAVYPEFTLNSLTVHRFLLTATTIAS 127
           ++  +TK S  + ++LL A YY   L         +  PEF   +    R  LT   IA 
Sbjct: 98  FINEITKRSKSKRNILLLATYYFQKLYTSLSTCPVSTIPEF---AFCAKRSFLTCIIIAH 154

Query: 128 KGLCDSFCTNTHYSKVGGVQCSELNILENEFLERVRYRIIPRD 170
           K L DS  +   +S + G+    L+ +E   L ++ Y +   D
Sbjct: 155 KYLNDSTFSMESWSLISGLNKKALSTIERWCLGKLDYNLFVDD 197

>Kpol_1005.17 s1005 (29070..30029) [960 bp, 319 aa] {ON}
           (29070..30029) [960 nt, 320 aa]
          Length = 319

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 46/103 (44%), Gaps = 8/103 (7%)

Query: 72  TVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLNSLT--------VHRFLLTAT 123
           T+  +++ +   S    +VLL A YY   + ++ P  T NS +          R  L   
Sbjct: 150 TIVPFIVEIIDRSKCNKNVLLLATYYFKQIYSLNPISTKNSKSPLPTFSHCAKRIFLCCL 209

Query: 124 TIASKGLCDSFCTNTHYSKVGGVQCSELNILENEFLERVRYRI 166
            I+ K L D+  T   +  + G+  + L+++E   L R+ Y +
Sbjct: 210 IISHKFLNDNTFTMKSWHCISGLPQTHLSLMERWCLTRLNYNL 252

>TDEL0E02800 Chr5 complement(539086..539685) [600 bp, 199 aa] {ON}
           Anc_5.347 YHR071W
          Length = 199

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 46/90 (51%), Gaps = 5/90 (5%)

Query: 95  VYYIDLLSAVYPEFTLNSLTVHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCSELNIL 154
           +Y   L +   P+F   S    R  L+   +A K L D+  T   ++ + G+  ++L ++
Sbjct: 93  IYDGQLWNGKLPDFARCS---KRIFLSCLILAHKYLNDNSFTMKTWNMISGLSQNDLCLM 149

Query: 155 ENEFLERVRYRIIPRDDNIENCKIEQKLGS 184
           E   LE++ YR++  ++++   K+E  L +
Sbjct: 150 ERWGLEKLDYRLLVAEEDLT--KLEDSLAT 177

>CAGL0E05918g Chr5 complement(585960..587405) [1446 bp, 481 aa] {ON}
           similar to uniprot|Q08966 Saccharomyces cerevisiae
           YPL219w PCL8
          Length = 481

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 41/92 (44%), Gaps = 8/92 (8%)

Query: 63  FHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLL--------SAVYPEFTLNSLT 114
           F  K+APSI+ + ++ R+         + L A Y + +L          +  +  L    
Sbjct: 346 FSMKSAPSISHHDFIQRIQNKCMFGSIIYLGATYLLQILFLTREYNDGPLRLKHKLQQNE 405

Query: 115 VHRFLLTATTIASKGLCDSFCTNTHYSKVGGV 146
           VHR ++    IA+K L D   ++ +  KV G+
Sbjct: 406 VHRVIVGTIRIATKLLEDFVHSHQYICKVCGI 437

>KLTH0B05368g Chr2 complement(446569..449364) [2796 bp, 931 aa] {ON}
           similar to uniprot|P53917 Saccharomyces cerevisiae
           YNL127W FAR11 Protein involved in G1 cell cycle arrest
           in response to pheromone in a pathway different from the
           Far1p-dependent pathway interacts with Far3p Far7p Far8p
           Far9p and Far10p
          Length = 931

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 57/133 (42%), Gaps = 15/133 (11%)

Query: 43  FLIQINDANNAGNQTM-ELTRFHSKAAPSITVYQYLIRLTKYSSL-----------EHSV 90
           FL   N+ NN   +TM  +  F+ K  PS++   Y++  T  S+L           + S 
Sbjct: 613 FLYHYNNENNGEARTMVRIEEFYKKCLPSLSSIAYVLLQTMESNLNNRTYVRDDTKDESS 672

Query: 91  LLSAVYYIDLLSAVYPEFTLNSLTVHRFLLTATTIASKGL-CDSFCTNTHYSKVGGVQCS 149
            L     ++++ +   E  L S     +LL      S  L  + FC   H  K+ G+  S
Sbjct: 673 GLQTAPQLEIIRS--KEIVLKSSCSSLYLLMKWLKLSHILKFEQFCVILHDYKLIGIVTS 730

Query: 150 ELNILENEFLERV 162
            LN   +++ ERV
Sbjct: 731 LLNTYTDKYQERV 743

>YJR005W Chr10 (445923..448025) [2103 bp, 700 aa] {ON}
           APL1Beta-adaptin, large subunit of the clathrin
           associated protein complex (AP-2); involved in vesicle
           mediated transport; similar to mammalian beta-chain of
           the clathrin associated protein complex
          Length = 700

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 37/74 (50%), Gaps = 4/74 (5%)

Query: 265 NTNIISTTGRIVSPSITEGDSFNLSEHRKTRSRETSVNENSDSPPITIPQ---KRNMKED 321
           N +++   G    P+    D  N      T+SR+T++ ++ D P   I Q   KR    +
Sbjct: 618 NKDLLPVVGNSFPPTGANRDRQNSESQSSTKSRKTAMMDDYDKPAEKINQLKGKRKSSSN 677

Query: 322 DPTNMDRK-STLLR 334
           +P+ + RK STLLR
Sbjct: 678 NPSKLSRKPSTLLR 691

>TPHA0A03250 Chr1 (717085..717954) [870 bp, 289 aa] {ON} Anc_7.289
           YDL179W
          Length = 289

 Score = 30.0 bits (66), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 2/55 (3%)

Query: 114 TVHRFLLTATTIASKGLCDSFCTNTHYSKV--GGVQCSELNILENEFLERVRYRI 166
           T HR  L    +++K L DS   N H++K     +   E+N +E E L    + +
Sbjct: 91  TRHRIFLGCLILSAKSLNDSSPLNKHWAKYTESYIHLREVNTIERELLNYFDWNV 145

>AFL115W Chr6 (221235..222395) [1161 bp, 386 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL219W (PCL8) and
           YGL134W (PCL10)
          Length = 386

 Score = 30.4 bits (67), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 42/93 (45%), Gaps = 9/93 (9%)

Query: 63  FHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYP---------EFTLNSL 113
           F  KA  S+T  QYL R+         V  +A   +  L+  +P          + +   
Sbjct: 244 FEMKAPASVTYTQYLDRINAKCMFAPIVYQTAGCLLLRLTLKWPPSETGPVQIRWPIAES 303

Query: 114 TVHRFLLTATTIASKGLCDSFCTNTHYSKVGGV 146
            VHR ++    +++K + D+  ++ ++SKV G+
Sbjct: 304 YVHRLIVALIRVSTKIVEDTVHSHEYFSKVCGI 336

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 38,732,971
Number of extensions: 1787457
Number of successful extensions: 6891
Number of sequences better than 10.0: 190
Number of HSP's gapped: 7135
Number of HSP's successfully gapped: 200
Length of query: 345
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 235
Effective length of database: 40,868,139
Effective search space: 9604012665
Effective search space used: 9604012665
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)