Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D01265g6.24ON20720710151e-142
SAKL0E01386g6.24ON2082069251e-128
Ecym_30286.24ON2082069101e-126
ACR003C6.24ON2082069091e-125
TDEL0G044506.24ON2082069091e-125
KLTH0C11132g6.24ON2082069031e-125
Kpol_1037.286.24ON2082069021e-124
ZYRO0C07700g6.24ON2072068971e-124
NDAI0D008406.24ON2082068951e-123
Kwal_56.224406.24ON2082068931e-123
KNAG0M012206.24ON2072058791e-121
TBLA0A071806.24ON2082068781e-121
Smik_13.1586.24ON2082068751e-120
YML001W (YPT7)6.24ON2082068711e-120
Suva_13.1616.24ON2082068711e-120
Skud_13.1536.24ON2082068711e-120
CAGL0E02607g6.24ON2082078671e-119
KAFR0G026706.24ON2082068601e-118
NCAS0H008506.24ON2082068571e-118
TPHA0J003606.24ON2092078541e-117
KNAG0D026508.70ON2112093342e-38
Kwal_23.50588.70ON2132023221e-36
AGL021W8.70ON2122023203e-36
KLTH0A02662g8.70ON2132023203e-36
Ecym_15188.25ON2042033142e-35
SAKL0B01012g8.25ON2042053132e-35
NCAS0J006308.70ON2182023124e-35
SAKL0B02332g8.70ON2132013124e-35
ABR220W8.25ON2041673107e-35
KAFR0B016608.70ON2061823063e-34
Kpol_1011.38.70ON2141783064e-34
KAFR0C033308.70ON2101783055e-34
KLLA0E12079g8.70ON2141933012e-33
NCAS0C040208.70ON2102043012e-33
CAGL0F02123g8.70ON2152053003e-33
KLLA0D05313g8.25ON2042002993e-33
Suva_6.548.70ON2151792994e-33
TBLA0D026508.70ON2171622985e-33
Ecym_73058.70ON2131682986e-33
NDAI0G033408.70ON2071792977e-33
KAFR0C035808.25ON2122112961e-32
YFL005W (SEC4)8.70ON2151792961e-32
TBLA0C004508.25ON2101792951e-32
KNAG0G009308.70ON2131962961e-32
Smik_6.738.70ON2151792951e-32
Kwal_14.11168.25ON2042072951e-32
TDEL0C009808.70ON2151782951e-32
ZYRO0F03872g8.70ON2171782952e-32
KLTH0G18788g8.25ON2042012942e-32
ZYRO0C07062g6.49ON2142062933e-32
Kpol_1023.218.25ON2072062933e-32
TPHA0P003608.70ON2141792933e-32
NDAI0G030508.25ON2102042924e-32
TPHA0D002708.25ON2071952915e-32
Skud_6.668.70ON2151792891e-31
Suva_6.198.25ON2062002881e-31
CAGL0K12672g8.25ON2062082881e-31
KAFR0A052606.49ON2352172892e-31
KLTH0C10384g6.49ON2342052892e-31
KNAG0E031008.25ON2121672872e-31
Suva_10.3596.49ON2152202873e-31
TPHA0F025006.49ON2151922873e-31
ZYRO0F02816g8.25ON2092002863e-31
Kpol_1042.26.49ON2142202854e-31
Skud_6.328.25ON2061972845e-31
Smik_6.408.25ON2061972845e-31
YFL038C (YPT1)8.25ON2061972845e-31
TBLA0E031906.49ON2072032837e-31
Kwal_56.225556.49ON2122082831e-30
YLR262C (YPT6)6.49ON2152202821e-30
CAGL0K06017g6.49ON2191872821e-30
Smik_12.3366.49ON2161862803e-30
NCAS0D025006.49ON2221922803e-30
Skud_12.3416.49ON2161862803e-30
TDEL0C004908.25ON2082042794e-30
TDEL0G042106.49ON2221882785e-30
KLLA0F20471g6.49ON2121762777e-30
NDAI0I023806.49ON2221922771e-29
SAKL0E02090g6.49ON2142062761e-29
NCAS0C037108.25ON2111832761e-29
KNAG0E027206.49ON2311792734e-29
KNAG0C018401.338ON2122082682e-28
AGR257C6.49ON2201662682e-28
Ecym_31376.49ON2212142673e-28
CAGL0G07689g1.289ON2151702646e-28
Smik_14.2342.196ON2202142585e-27
Suva_14.2472.196ON2182092569e-27
CAGL0J08635g2.196ON2082072561e-26
KAFR0C043101.338ON1992052541e-26
KAFR0J018502.196ON2092142541e-26
NCAS0B067202.196ON2122122542e-26
YOR089C (VPS21)2.196ON2102102533e-26
AER434C3.521ON2192052533e-26
KLTH0G01760g3.521ON2181932524e-26
KAFR0A035601.289ON2071742514e-26
Smik_5.1543.521ON2231752525e-26
Suva_7.513.521ON2211052516e-26
Skud_5.1403.521ON2231752516e-26
Skud_14.2382.196ON2202132517e-26
KLLA0D02376g1.289ON2071072507e-26
SAKL0E09922g2.196ON2132112507e-26
KLTH0G08206g2.196ON2122122499e-26
TPHA0P009502.196ON2131642499e-26
Ecym_53622.196ON2092092491e-25
KLLA0C13728g2.196ON2082082481e-25
YER031C (YPT31)3.521ON2231752491e-25
Suva_5.1283.521ON2231752491e-25
Kpol_1016.241.289ON2111002481e-25
Kwal_23.29782.196ON2112142472e-25
TPHA0D034303.521ON2231742482e-25
CAGL0K09394g3.521ON2211892472e-25
YGL210W (YPT32)3.521ON2221052472e-25
Skud_7.583.521ON2221052472e-25
Smik_7.533.521ON2221052472e-25
YNL093W (YPT53)2.196ON220992473e-25
AAL176C1.289ON2052032453e-25
SAKL0F01914g3.521ON2211862463e-25
Smik_15.2692.196ON2101642454e-25
Suva_8.1422.196ON2091642454e-25
TBLA0C027801.289ON220992454e-25
Kpol_423.123.521ON2201742454e-25
TPHA0I027801.289ON2082082445e-25
Ecym_12073.521ON2171052446e-25
KNAG0I010802.196ON2531792458e-25
TBLA0B018202.196ON2122102421e-24
Skud_15.2532.196ON2091862421e-24
SAKL0D05940g1.289ON2071012411e-24
Ecym_63281.289ON2051012402e-24
TBLA0C049103.521ON2311052422e-24
TDEL0D015701.289ON2172152412e-24
CAGL0C02453g3.521ON2181752402e-24
NCAS0B073601.338ON2251692402e-24
ZYRO0E08492g3.521ON2181052403e-24
NDAI0I029103.521ON2191742403e-24
Smik_11.2711.289ON2341062403e-24
Skud_11.2471.289ON2341062404e-24
YKR014C (YPT52)1.289ON2341062404e-24
KNAG0B005803.521ON2251052394e-24
NCAS0B076301.289ON2161042385e-24
ZYRO0B09152g1.338ON2232032385e-24
KNAG0C016001.289ON2141032375e-24
ACL084C2.196ON207992375e-24
Kwal_14.23941.289ON2071012376e-24
NCAS0E006003.521ON2191002376e-24
TDEL0C046602.196ON211992368e-24
Suva_11.2461.289ON2361082379e-24
Kpol_1029.162.196ON211992351e-23
NDAI0B049801.289ON2271042361e-23
KAFR0F041603.521ON2451742362e-23
KLLA0B00671g3.521ON2191002342e-23
KLTH0H09768g1.289ON2291012342e-23
TDEL0D058903.521ON2291062342e-23
ZYRO0C15554g2.196ON211992314e-23
ZYRO0G21384g1.289ON2181042315e-23
TPHA0I025901.338ON2251712282e-22
AEL187C1.338ON2081092262e-22
Suva_4.5261.338ON1981002235e-22
Smik_2.4081.338ON1992052192e-21
CAGL0I09306g1.338ON2061212202e-21
TDEL0D020601.338ON2021682192e-21
SAKL0D06490g1.338ON2181132175e-21
YBR264C (YPT10)1.338ON1992052149e-21
NDAI0B046801.338ON2232132133e-20
Ecym_63091.338ON2081292097e-20
Skud_2.3971.338ON1991002043e-19
KLTH0H10274g1.338ON2011022043e-19
KLLA0A04499gsingletonON2141822011e-18
KLLA0C05126g6.90ON2141822011e-18
Kpol_1066.111.338ON2421242021e-18
ZYRO0D14784g6.90ON2141801983e-18
SAKL0A07744g6.90ON2141801983e-18
Ecym_30976.90ON2141821983e-18
AGR294C6.90ON2141821983e-18
CAGL0I00594g6.90ON2141801975e-18
Suva_10.3896.90ON2191731967e-18
Skud_12.3756.90ON2191731967e-18
Smik_12.3716.90ON2191731967e-18
YLR293C (GSP1)6.90ON2191731967e-18
KLTH0G14850g6.90ON2141821957e-18
Kwal_56.233616.90ON2141821958e-18
YOR185C (GSP2)6.90ON2201731958e-18
Suva_8.2416.90ON2201731958e-18
Skud_15.3526.90ON2201731958e-18
Smik_15.3706.90ON2201731959e-18
TDEL0G038106.90ON2221731941e-17
TPHA0K010606.90ON2131731922e-17
Kpol_1009.96.90ON2131731913e-17
NCAS0F004406.90ON2191731914e-17
KAFR0A048006.90ON2191731906e-17
NDAI0D026706.90ON2201671896e-17
TBLA0E009806.90ON2211731897e-17
KNAG0F031806.90ON2941661928e-17
Kwal_14.24841.338ON2031691871e-16
KLLA0F01232g1.338ON2101041843e-16
Kwal_47.190553.521ON1791791772e-15
Kpol_1029.82.182ON3051901804e-15
CAGL0J05632g2.200ON1881811745e-15
NCAS0G027302.200ON1871801721e-14
KAFR0D020402.182ON2741641751e-14
Kpol_520.364.326ON2251601731e-14
KAFR0J012402.200ON1871791684e-14
Ecym_53652.200ON1891731651e-13
KNAG0M018302.200ON1861791641e-13
Suva_14.2502.200ON1921851642e-13
NCAS0A060704.326ON2251651643e-13
KLTH0G08294g2.200ON1871721623e-13
NCAS0G019102.75ON2911271663e-13
CAGL0B04521g2.182ON3391541664e-13
NDAI0B054001.215ON2951791654e-13
YNL090W (RHO2)2.200ON1921851615e-13
Kwal_47.169834.326ON2231641625e-13
Smik_14.2372.200ON1921081615e-13
Kwal_33.144522.75ON2601171627e-13
CAGL0L11242g4.326ON2541641619e-13
Kwal_26.83872.182ON2921571621e-12
ACL087C2.200ON1871711581e-12
KLTH0D16236g4.326ON2251641601e-12
KAFR0F036704.73ON2631691611e-12
NCAS0B080901.215ON2891891621e-12
KLLA0B05038g4.326ON2231001591e-12
KLLA0C13816g2.200ON1871721571e-12
KNAG0C012601.215ON299991611e-12
TBLA0B01750singletonON3731541622e-12
KLTH0B06996g2.75ON2591171592e-12
Skud_14.2412.200ON1921891572e-12
YML064C (TEM1)4.326ON2451641592e-12
TPHA0B017204.326ON2961711602e-12
TBLA0B018002.200ON1961721562e-12
TPHA0P009202.200ON1881001562e-12
NDAI0B041802.182ON3291541602e-12
YOR101W (RAS1)2.182ON3091541602e-12
SAKL0C06424g1.215ON287991592e-12
Suva_13.934.326ON2451641583e-12
Smik_9.512.249ON2311031573e-12
Ecym_32862.249ON2242051573e-12
YIL118W (RHO3)2.249ON2311031573e-12
Suva_9.762.249ON2321031573e-12
NDAI0D038204.73ON2681691583e-12
Skud_9.532.249ON2311031563e-12
TDEL0B056001.443ON2011821553e-12
KLLA0A05643g1.215ON2181721564e-12
NCAS0A018904.73ON2711691574e-12
Smik_13.804.326ON2451641564e-12
TDEL0F027704.73ON2381791564e-12
Skud_14.2322.182ON3231541584e-12
ZYRO0C15466g2.200ON1891821535e-12
KAFR0J016002.249ON2222041555e-12
YNL098C (RAS2)2.182ON3221541575e-12
ZYRO0E03608g1.443ON2001891545e-12
TDEL0C046302.200ON1911841535e-12
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D01265g
         (207 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D01265g Chr4 (110784..111407) [624 bp, 207 aa] {ON} highly ...   395   e-142
SAKL0E01386g Chr5 (105246..105872) [627 bp, 208 aa] {ON} highly ...   360   e-128
Ecym_3028 Chr3 (54759..55385) [627 bp, 208 aa] {ON} similar to A...   355   e-126
ACR003C Chr3 complement(359762..360388) [627 bp, 208 aa] {ON} Sy...   354   e-125
TDEL0G04450 Chr7 complement(808210..808836) [627 bp, 208 aa] {ON...   354   e-125
KLTH0C11132g Chr3 complement(915337..915963) [627 bp, 208 aa] {O...   352   e-125
Kpol_1037.28 s1037 (68071..68697) [627 bp, 208 aa] {ON} (68071.....   352   e-124
ZYRO0C07700g Chr3 complement(584547..585170) [624 bp, 207 aa] {O...   350   e-124
NDAI0D00840 Chr4 (189925..190551) [627 bp, 208 aa] {ON} Anc_6.24      349   e-123
Kwal_56.22440 s56 (130574..131200) [627 bp, 208 aa] {ON} YML001W...   348   e-123
KNAG0M01220 Chr13 (222591..223214) [624 bp, 207 aa] {ON} Anc_6.2...   343   e-121
TBLA0A07180 Chr1 complement(1787774..1788400) [627 bp, 208 aa] {...   342   e-121
Smik_13.158 Chr13 (258333..258959) [627 bp, 208 aa] {ON} YML001W...   341   e-120
YML001W Chr13 (267174..267800) [627 bp, 208 aa] {ON}  YPT7Rab fa...   340   e-120
Suva_13.161 Chr13 (257150..257776) [627 bp, 208 aa] {ON} YML001W...   340   e-120
Skud_13.153 Chr13 (253075..253701) [627 bp, 208 aa] {ON} YML001W...   340   e-120
CAGL0E02607g Chr5 complement(248998..249624) [627 bp, 208 aa] {O...   338   e-119
KAFR0G02670 Chr7 complement(552130..552756) [627 bp, 208 aa] {ON...   335   e-118
NCAS0H00850 Chr8 (155266..155892) [627 bp, 208 aa] {ON} Anc_6.24      334   e-118
TPHA0J00360 Chr10 (80553..81182) [630 bp, 209 aa] {ON} Anc_6.24 ...   333   e-117
KNAG0D02650 Chr4 (474662..475297) [636 bp, 211 aa] {ON} Anc_8.70...   133   2e-38
Kwal_23.5058 s23 (989533..990174) [642 bp, 213 aa] {ON} YFL005W ...   128   1e-36
AGL021W Chr7 (681754..682392) [639 bp, 212 aa] {ON} Syntenic hom...   127   3e-36
KLTH0A02662g Chr1 complement(226313..226954) [642 bp, 213 aa] {O...   127   3e-36
Ecym_1518 Chr1 (1069582..1070196) [615 bp, 204 aa] {ON} similar ...   125   2e-35
SAKL0B01012g Chr2 complement(92466..93080) [615 bp, 204 aa] {ON}...   125   2e-35
NCAS0J00630 Chr10 complement(95335..95991) [657 bp, 218 aa] {ON}...   124   4e-35
SAKL0B02332g Chr2 (227078..227719) [642 bp, 213 aa] {ON} highly ...   124   4e-35
ABR220W Chr2 (817292..817906) [615 bp, 204 aa] {ON} Syntenic hom...   124   7e-35
KAFR0B01660 Chr2 complement(318959..319579) [621 bp, 206 aa] {ON...   122   3e-34
Kpol_1011.3 s1011 complement(4828..5472) [645 bp, 214 aa] {ON} c...   122   4e-34
KAFR0C03330 Chr3 (679443..680075) [633 bp, 210 aa] {ON} Anc_8.70...   122   5e-34
KLLA0E12079g Chr5 (1075299..1075943) [645 bp, 214 aa] {ON} highl...   120   2e-33
NCAS0C04020 Chr3 (817944..818576) [633 bp, 210 aa] {ON} Anc_1.21...   120   2e-33
CAGL0F02123g Chr6 (212117..212764) [648 bp, 215 aa] {ON} highly ...   120   3e-33
KLLA0D05313g Chr4 (459496..460110) [615 bp, 204 aa] {ON} highly ...   119   3e-33
Suva_6.54 Chr6 (102191..102838) [648 bp, 215 aa] {ON} YFL005W (R...   119   4e-33
TBLA0D02650 Chr4 (655924..656577) [654 bp, 217 aa] {ON} Anc_8.70...   119   5e-33
Ecym_7305 Chr7 (650045..650686) [642 bp, 213 aa] {ON} similar to...   119   6e-33
NDAI0G03340 Chr7 (792718..793341) [624 bp, 207 aa] {ON} Anc_8.70      119   7e-33
KAFR0C03580 Chr3 (733658..734296) [639 bp, 212 aa] {ON} Anc_8.25...   118   1e-32
YFL005W Chr6 (130334..130981) [648 bp, 215 aa] {ON}  SEC4Rab fam...   118   1e-32
TBLA0C00450 Chr3 complement(84352..84984) [633 bp, 210 aa] {ON} ...   118   1e-32
KNAG0G00930 Chr7 (183672..184313) [642 bp, 213 aa] {ON} Anc_8.70...   118   1e-32
Smik_6.73 Chr6 (143556..144203) [648 bp, 215 aa] {ON} YFL005W (R...   118   1e-32
Kwal_14.1116 s14 complement(202534..203148) [615 bp, 204 aa] {ON...   118   1e-32
TDEL0C00980 Chr3 (164219..164866) [648 bp, 215 aa] {ON} Anc_8.70...   118   1e-32
ZYRO0F03872g Chr6 (329213..329866) [654 bp, 217 aa] {ON} highly ...   118   2e-32
KLTH0G18788g Chr7 (1624218..1624832) [615 bp, 204 aa] {ON} highl...   117   2e-32
ZYRO0C07062g Chr3 (532175..532819) [645 bp, 214 aa] {ON} highly ...   117   3e-32
Kpol_1023.21 s1023 complement(39597..40220) [624 bp, 207 aa] {ON...   117   3e-32
TPHA0P00360 Chr16 (76379..77023) [645 bp, 214 aa] {ON} Anc_8.70 ...   117   3e-32
NDAI0G03050 Chr7 complement(711396..712028) [633 bp, 210 aa] {ON...   117   4e-32
TPHA0D00270 Chr4 complement(37369..37992) [624 bp, 207 aa] {ON} ...   116   5e-32
Skud_6.66 Chr6 (132521..133168) [648 bp, 215 aa] {ON} YFL005W (R...   115   1e-31
Suva_6.19 Chr6 complement(28872..29492) [621 bp, 206 aa] {ON} YF...   115   1e-31
CAGL0K12672g Chr11 (1256370..1256990) [621 bp, 206 aa] {ON} high...   115   1e-31
KAFR0A05260 Chr1 complement(1040753..1041460) [708 bp, 235 aa] {...   115   2e-31
KLTH0C10384g Chr3 (861122..861826) [705 bp, 234 aa] {ON} highly ...   115   2e-31
KNAG0E03100 Chr5 complement(618438..619076) [639 bp, 212 aa] {ON...   115   2e-31
Suva_10.359 Chr10 complement(629445..630092) [648 bp, 215 aa] {O...   115   3e-31
TPHA0F02500 Chr6 complement(551815..552462) [648 bp, 215 aa] {ON...   115   3e-31
ZYRO0F02816g Chr6 complement(237904..238533) [630 bp, 209 aa] {O...   114   3e-31
Kpol_1042.2 s1042 complement(4659..5303) [645 bp, 214 aa] {ON} c...   114   4e-31
Skud_6.32 Chr6 complement(58531..59151) [621 bp, 206 aa] {ON} YF...   114   5e-31
Smik_6.40 Chr6 complement(70749..71369) [621 bp, 206 aa] {ON} YF...   114   5e-31
YFL038C Chr6 complement(55366..55986) [621 bp, 206 aa] {ON}  YPT...   114   5e-31
TBLA0E03190 Chr5 complement(803935..804558) [624 bp, 207 aa] {ON...   113   7e-31
Kwal_56.22555 s56 complement(178575..179213) [639 bp, 212 aa] {O...   113   1e-30
YLR262C Chr12 complement(668244..668891) [648 bp, 215 aa] {ON}  ...   113   1e-30
CAGL0K06017g Chr11 complement(586922..587581) [660 bp, 219 aa] {...   113   1e-30
Smik_12.336 Chr12 complement(606255..606905) [651 bp, 216 aa] {O...   112   3e-30
NCAS0D02500 Chr4 (474037..474705) [669 bp, 222 aa] {ON} Anc_6.49      112   3e-30
Skud_12.341 Chr12 complement(609187..609837) [651 bp, 216 aa] {O...   112   3e-30
TDEL0C00490 Chr3 complement(75792..76418) [627 bp, 208 aa] {ON} ...   112   4e-30
TDEL0G04210 Chr7 (764766..765434) [669 bp, 222 aa] {ON} Anc_6.49...   111   5e-30
KLLA0F20471g Chr6 (1901749..1902387) [639 bp, 212 aa] {ON} highl...   111   7e-30
NDAI0I02380 Chr9 complement(542975..543643) [669 bp, 222 aa] {ON}     111   1e-29
SAKL0E02090g Chr5 complement(160194..160838) [645 bp, 214 aa] {O...   110   1e-29
NCAS0C03710 Chr3 complement(747168..747803) [636 bp, 211 aa] {ON...   110   1e-29
KNAG0E02720 Chr5 (541478..542173) [696 bp, 231 aa] {ON}               109   4e-29
KNAG0C01840 Chr3 (363258..363896) [639 bp, 212 aa] {ON} Anc_1.33...   107   2e-28
AGR257C Chr7 complement(1225880..1226542) [663 bp, 220 aa] {ON} ...   107   2e-28
Ecym_3137 Chr3 (254058..254723) [666 bp, 221 aa] {ON} similar to...   107   3e-28
CAGL0G07689g Chr7 complement(729919..730566) [648 bp, 215 aa] {O...   106   6e-28
Smik_14.234 Chr14 (430086..430748) [663 bp, 220 aa] {ON} YNL093W...   103   5e-27
Suva_14.247 Chr14 (448490..449146) [657 bp, 218 aa] {ON} YNL093W...   103   9e-27
CAGL0J08635g Chr10 complement(856102..856728) [627 bp, 208 aa] {...   103   1e-26
KAFR0C04310 Chr3 (855871..856470) [600 bp, 199 aa] {ON} Anc_1.33...   102   1e-26
KAFR0J01850 Chr10 complement(356911..357540) [630 bp, 209 aa] {O...   102   1e-26
NCAS0B06720 Chr2 complement(1278798..1279436) [639 bp, 212 aa] {...   102   2e-26
YOR089C Chr15 complement(490196..490828) [633 bp, 210 aa] {ON}  ...   102   3e-26
AER434C Chr5 complement(1466442..1467052,1467106..1467154) [660 ...   102   3e-26
KLTH0G01760g Chr7 (132121..132166,132307..132917) [657 bp, 218 a...   101   4e-26
KAFR0A03560 Chr1 (729254..729877) [624 bp, 207 aa] {ON} Anc_1.28...   101   4e-26
Smik_5.154 Chr5 complement(218975..219646) [672 bp, 223 aa] {ON}...   101   5e-26
Suva_7.51 Chr7 (90232..90897) [666 bp, 221 aa] {ON} YGL210W (REAL)    101   6e-26
Skud_5.140 Chr5 complement(211975..212646) [672 bp, 223 aa] {ON}...   101   6e-26
Skud_14.238 Chr14 (440139..440801) [663 bp, 220 aa] {ON} YNL093W...   101   7e-26
KLLA0D02376g Chr4 (201512..202135) [624 bp, 207 aa] {ON} similar...   100   7e-26
SAKL0E09922g Chr5 complement(829249..829890) [642 bp, 213 aa] {O...   100   7e-26
KLTH0G08206g Chr7 (666127..666765) [639 bp, 212 aa] {ON} highly ...   100   9e-26
TPHA0P00950 Chr16 complement(193256..193897) [642 bp, 213 aa] {O...   100   9e-26
Ecym_5362 Chr5 (735204..735833) [630 bp, 209 aa] {ON} similar to...   100   1e-25
KLLA0C13728g Chr3 (1173329..1173955) [627 bp, 208 aa] {ON} highl...   100   1e-25
YER031C Chr5 complement(214076..214747) [672 bp, 223 aa] {ON}  Y...   100   1e-25
Suva_5.128 Chr5 complement(190103..190774) [672 bp, 223 aa] {ON}...   100   1e-25
Kpol_1016.24 s1016 (61782..62417) [636 bp, 211 aa] {ON} (61782.....   100   1e-25
Kwal_23.2978 s23 (97956..98591) [636 bp, 211 aa] {ON} YOR089C (V...   100   2e-25
TPHA0D03430 Chr4 complement(719751..720422) [672 bp, 223 aa] {ON...   100   2e-25
CAGL0K09394g Chr11 complement(930063..930728) [666 bp, 221 aa] {...   100   2e-25
YGL210W Chr7 (93792..94460) [669 bp, 222 aa] {ON}  YPT32Rab fami...   100   2e-25
Skud_7.58 Chr7 (99129..99797) [669 bp, 222 aa] {ON} YGL210W (REAL)    100   2e-25
Smik_7.53 Chr7 (88592..89260) [669 bp, 222 aa] {ON} YGL210W (REAL)    100   2e-25
YNL093W Chr14 (449868..450530) [663 bp, 220 aa] {ON}  YPT53Rab f...   100   3e-25
AAL176C Chr1 complement(31588..32205) [618 bp, 205 aa] {ON} Synt...    99   3e-25
SAKL0F01914g Chr6 (162387..162432,162627..163246) [666 bp, 221 a...    99   3e-25
Smik_15.269 Chr15 complement(451402..452034) [633 bp, 210 aa] {O...    99   4e-25
Suva_8.142 Chr8 complement(247554..248183) [630 bp, 209 aa] {ON}...    99   4e-25
TBLA0C02780 Chr3 complement(668605..669267) [663 bp, 220 aa] {ON...    99   4e-25
Kpol_423.12 s423 (26761..27423) [663 bp, 220 aa] {ON} (26761..27...    99   4e-25
TPHA0I02780 Chr9 complement(614605..615231) [627 bp, 208 aa] {ON...    99   5e-25
Ecym_1207 Chr1 (420728..420773,421159..421766) [654 bp, 217 aa] ...    99   6e-25
KNAG0I01080 Chr9 (207327..208088) [762 bp, 253 aa] {ON} Anc_2.19...    99   8e-25
TBLA0B01820 Chr2 complement(415800..416438) [639 bp, 212 aa] {ON...    98   1e-24
Skud_15.253 Chr15 complement(446672..447301) [630 bp, 209 aa] {O...    98   1e-24
SAKL0D05940g Chr4 (485575..486198) [624 bp, 207 aa] {ON} highly ...    97   1e-24
Ecym_6328 Chr6 complement(629586..630203) [618 bp, 205 aa] {ON} ...    97   2e-24
TBLA0C04910 Chr3 complement(1193590..1194285) [696 bp, 231 aa] {...    98   2e-24
TDEL0D01570 Chr4 (310454..311107) [654 bp, 217 aa] {ON} Anc_1.28...    97   2e-24
CAGL0C02453g Chr3 (247493..248149) [657 bp, 218 aa] {ON} highly ...    97   2e-24
NCAS0B07360 Chr2 complement(1389230..1389907) [678 bp, 225 aa] {...    97   2e-24
ZYRO0E08492g Chr5 complement(676074..676684,676766..676811) [657...    97   3e-24
NDAI0I02910 Chr9 complement(688721..689380) [660 bp, 219 aa] {ON...    97   3e-24
Smik_11.271 Chr11 complement(452840..453544) [705 bp, 234 aa] {O...    97   3e-24
Skud_11.247 Chr11 complement(445982..446686) [705 bp, 234 aa] {O...    97   4e-24
YKR014C Chr11 complement(465367..466071) [705 bp, 234 aa] {ON}  ...    97   4e-24
KNAG0B00580 Chr2 (94797..95474) [678 bp, 225 aa] {ON} Anc_3.521 ...    97   4e-24
NCAS0B07630 Chr2 complement(1443664..1444314) [651 bp, 216 aa] {...    96   5e-24
ZYRO0B09152g Chr2 complement(714608..715279) [672 bp, 223 aa] {O...    96   5e-24
KNAG0C01600 Chr3 (317298..317942) [645 bp, 214 aa] {ON} Anc_1.28...    96   5e-24
ACL084C Chr3 complement(199020..199643) [624 bp, 207 aa] {ON} Sy...    96   5e-24
Kwal_14.2394 s14 (738645..739268) [624 bp, 207 aa] {ON} YKR014C ...    96   6e-24
NCAS0E00600 Chr5 (102956..103615) [660 bp, 219 aa] {ON} Anc_3.521      96   6e-24
TDEL0C04660 Chr3 complement(845203..845838) [636 bp, 211 aa] {ON...    96   8e-24
Suva_11.246 Chr11 complement(449412..450122) [711 bp, 236 aa] {O...    96   9e-24
Kpol_1029.16 s1029 (30724..31359) [636 bp, 211 aa] {ON} (30724.....    95   1e-23
NDAI0B04980 Chr2 complement(1216833..1217516) [684 bp, 227 aa] {...    96   1e-23
KAFR0F04160 Chr6 complement(819022..819759) [738 bp, 245 aa] {ON...    96   2e-23
KLLA0B00671g Chr2 complement(50393..51006,51417..51462) [660 bp,...    95   2e-23
KLTH0H09768g Chr8 (840625..841314) [690 bp, 229 aa] {ON} similar...    95   2e-23
TDEL0D05890 Chr4 complement(1067167..1067856) [690 bp, 229 aa] {...    95   2e-23
ZYRO0C15554g Chr3 complement(1218190..1218825) [636 bp, 211 aa] ...    94   4e-23
ZYRO0G21384g Chr7 complement(1763055..1763711) [657 bp, 218 aa] ...    94   5e-23
TPHA0I02590 Chr9 complement(571327..572004) [678 bp, 225 aa] {ON...    92   2e-22
AEL187C Chr5 complement(284984..285610) [627 bp, 208 aa] {ON} Sy...    92   2e-22
Suva_4.526 Chr4 complement(909423..910019) [597 bp, 198 aa] {ON}...    91   5e-22
Smik_2.408 Chr2 complement(723817..724416) [600 bp, 199 aa] {ON}...    89   2e-21
CAGL0I09306g Chr9 complement(897357..897977) [621 bp, 206 aa] {O...    89   2e-21
TDEL0D02060 Chr4 (403098..403706) [609 bp, 202 aa] {ON} Anc_1.33...    89   2e-21
SAKL0D06490g Chr4 complement(531028..531684) [657 bp, 218 aa] {O...    88   5e-21
YBR264C Chr2 complement(737770..738369) [600 bp, 199 aa] {ON}  Y...    87   9e-21
NDAI0B04680 Chr2 complement(1157279..1157950) [672 bp, 223 aa] {...    87   3e-20
Ecym_6309 Chr6 (585998..586624) [627 bp, 208 aa] {ON} similar to...    85   7e-20
Skud_2.397 Chr2 complement(706771..707370) [600 bp, 199 aa] {ON}...    83   3e-19
KLTH0H10274g Chr8 complement(882443..883048) [606 bp, 201 aa] {O...    83   3e-19
KLLA0A04499g Chr1 complement(404732..405376) [645 bp, 214 aa] {O...    82   1e-18
KLLA0C05126g Chr3 complement(463657..464301) [645 bp, 214 aa] {O...    82   1e-18
Kpol_1066.11 s1066 complement(18137..18865) [729 bp, 242 aa] {ON...    82   1e-18
ZYRO0D14784g Chr4 complement(1247520..1248164) [645 bp, 214 aa] ...    81   3e-18
SAKL0A07744g Chr1 (688406..689050) [645 bp, 214 aa] {ON} highly ...    81   3e-18
Ecym_3097 Chr3 (181482..182126) [645 bp, 214 aa] {ON} similar to...    81   3e-18
AGR294C Chr7 complement(1287036..1287680) [645 bp, 214 aa] {ON} ...    81   3e-18
CAGL0I00594g Chr9 (44835..45479) [645 bp, 214 aa] {ON} highly si...    80   5e-18
Suva_10.389 Chr10 complement(681930..682589) [660 bp, 219 aa] {O...    80   7e-18
Skud_12.375 Chr12 complement(661797..662456) [660 bp, 219 aa] {O...    80   7e-18
Smik_12.371 Chr12 complement(658971..659630) [660 bp, 219 aa] {O...    80   7e-18
YLR293C Chr12 complement(720771..721430) [660 bp, 219 aa] {ON}  ...    80   7e-18
KLTH0G14850g Chr7 (1304240..1304884) [645 bp, 214 aa] {ON} highl...    80   7e-18
Kwal_56.23361 s56 complement(508046..508690) [645 bp, 214 aa] {O...    80   8e-18
YOR185C Chr15 complement(681444..682106) [663 bp, 220 aa] {ON}  ...    80   8e-18
Suva_8.241 Chr8 complement(432445..433107) [663 bp, 220 aa] {ON}...    80   8e-18
Skud_15.352 Chr15 complement(632241..632903) [663 bp, 220 aa] {O...    80   8e-18
Smik_15.370 Chr15 complement(637457..638119) [663 bp, 220 aa] {O...    80   9e-18
TDEL0G03810 Chr7 (699414..700082) [669 bp, 222 aa] {ON} Anc_6.90...    79   1e-17
TPHA0K01060 Chr11 (219078..219719) [642 bp, 213 aa] {ON} Anc_6.9...    79   2e-17
Kpol_1009.9 s1009 complement(23990..24631) [642 bp, 213 aa] {ON}...    78   3e-17
NCAS0F00440 Chr6 complement(79004..79663) [660 bp, 219 aa] {ON} ...    78   4e-17
KAFR0A04800 Chr1 (954630..955289) [660 bp, 219 aa] {ON} Anc_6.90...    78   6e-17
NDAI0D02670 Chr4 (618909..619571) [663 bp, 220 aa] {ON} Anc_6.90       77   6e-17
TBLA0E00980 Chr5 (224289..224954) [666 bp, 221 aa] {ON} Anc_6.90...    77   7e-17
KNAG0F03180 Chr6 complement(598089..598973) [885 bp, 294 aa] {ON...    79   8e-17
Kwal_14.2484 s14 complement(777938..778549) [612 bp, 203 aa] {ON...    77   1e-16
KLLA0F01232g Chr6 complement(114430..115062) [633 bp, 210 aa] {O...    75   3e-16
Kwal_47.19055 s47 complement(1078494..1079033) [540 bp, 179 aa] ...    73   2e-15
Kpol_1029.8 s1029 complement(15899..16816) [918 bp, 305 aa] {ON}...    74   4e-15
CAGL0J05632g Chr10 complement(539466..540032) [567 bp, 188 aa] {...    72   5e-15
NCAS0G02730 Chr7 (491357..491920) [564 bp, 187 aa] {ON}                71   1e-14
KAFR0D02040 Chr4 complement(412576..413382,413464..413481) [825 ...    72   1e-14
Kpol_520.36 s520 complement(90395..91072) [678 bp, 225 aa] {ON} ...    71   1e-14
KAFR0J01240 Chr10 complement(229638..230201) [564 bp, 187 aa] {O...    69   4e-14
Ecym_5365 Chr5 (743477..744046) [570 bp, 189 aa] {ON} similar to...    68   1e-13
KNAG0M01830 Chr13 complement(339904..340464) [561 bp, 186 aa] {O...    68   1e-13
Suva_14.250 Chr14 (455251..455829) [579 bp, 192 aa] {ON} YNL090W...    68   2e-13
NCAS0A06070 Chr1 (1197908..1198585) [678 bp, 225 aa] {ON} Anc_4....    68   3e-13
KLTH0G08294g Chr7 (678358..678921) [564 bp, 187 aa] {ON} highly ...    67   3e-13
NCAS0G01910 Chr7 complement(342761..343636) [876 bp, 291 aa] {ON...    69   3e-13
CAGL0B04521g Chr2 complement(439732..440751) [1020 bp, 339 aa] {...    69   4e-13
NDAI0B05400 Chr2 (1326549..1327436) [888 bp, 295 aa] {ON} Anc_1....    68   4e-13
YNL090W Chr14 (456565..457143) [579 bp, 192 aa] {ON}  RHO2Non-es...    67   5e-13
Kwal_47.16983 s47 complement(197253..197924) [672 bp, 223 aa] {O...    67   5e-13
Smik_14.237 Chr14 (436872..437450) [579 bp, 192 aa] {ON} YNL090W...    67   5e-13
Kwal_33.14452 s33 complement(679084..679866) [783 bp, 260 aa] {O...    67   7e-13
CAGL0L11242g Chr12 (1199371..1200135) [765 bp, 254 aa] {ON} high...    67   9e-13
Kwal_26.8387 s26 (763564..764442) [879 bp, 292 aa] {ON} YNL098C ...    67   1e-12
ACL087C Chr3 complement(191573..192136) [564 bp, 187 aa] {ON} Sy...    65   1e-12
KLTH0D16236g Chr4 (1344371..1345048) [678 bp, 225 aa] {ON} simil...    66   1e-12
KAFR0F03670 Chr6 complement(726736..727527) [792 bp, 263 aa] {ON...    67   1e-12
NCAS0B08090 Chr2 (1545134..1546003) [870 bp, 289 aa] {ON} Anc_1....    67   1e-12
KLLA0B05038g Chr2 complement(457608..458279) [672 bp, 223 aa] {O...    66   1e-12
KLLA0C13816g Chr3 (1183412..1183975) [564 bp, 187 aa] {ON} highl...    65   1e-12
KNAG0C01260 Chr3 complement(243934..244833) [900 bp, 299 aa] {ON...    67   1e-12
TBLA0B01750 Chr2 complement(392769..393890) [1122 bp, 373 aa] {O...    67   2e-12
KLTH0B06996g Chr2 (565363..566142) [780 bp, 259 aa] {ON} weakly ...    66   2e-12
Skud_14.241 Chr14 (446886..447464) [579 bp, 192 aa] {ON} YNL090W...    65   2e-12
YML064C Chr13 complement(145139..145876) [738 bp, 245 aa] {ON}  ...    66   2e-12
TPHA0B01720 Chr2 complement(384530..385420) [891 bp, 296 aa] {ON...    66   2e-12
TBLA0B01800 Chr2 complement(408546..409136) [591 bp, 196 aa] {ON...    65   2e-12
TPHA0P00920 Chr16 complement(185904..186470) [567 bp, 188 aa] {O...    65   2e-12
NDAI0B04180 Chr2 (1055285..1056274) [990 bp, 329 aa] {ON} Anc_2....    66   2e-12
YOR101W Chr15 (515244..516173) [930 bp, 309 aa] {ON}  RAS1GTPase...    66   2e-12
SAKL0C06424g Chr3 complement(591532..592395) [864 bp, 287 aa] {O...    66   2e-12
Suva_13.93 Chr13 complement(147850..148587) [738 bp, 245 aa] {ON...    65   3e-12
Smik_9.51 Chr9 (117526..118221) [696 bp, 231 aa] {ON} YIL118W (R...    65   3e-12
Ecym_3286 Chr3 (542469..543143) [675 bp, 224 aa] {ON} similar to...    65   3e-12
YIL118W Chr9 (139752..140447) [696 bp, 231 aa] {ON}  RHO3Non-ess...    65   3e-12
Suva_9.76 Chr9 (134573..135271) [699 bp, 232 aa] {ON} YIL118W (R...    65   3e-12
NDAI0D03820 Chr4 complement(908209..909015) [807 bp, 268 aa] {ON...    65   3e-12
Skud_9.53 Chr9 (116575..117270) [696 bp, 231 aa] {ON} YIL118W (R...    65   3e-12
TDEL0B05600 Chr2 complement(991741..992346) [606 bp, 201 aa] {ON...    64   3e-12
KLLA0A05643g Chr1 (528976..529632) [657 bp, 218 aa] {ON} similar...    65   4e-12
NCAS0A01890 Chr1 complement(364746..365561) [816 bp, 271 aa] {ON...    65   4e-12
Smik_13.80 Chr13 complement(142681..143418) [738 bp, 245 aa] {ON...    65   4e-12
TDEL0F02770 Chr6 complement(507090..507806) [717 bp, 238 aa] {ON...    65   4e-12
Skud_14.232 Chr14 complement(429739..430710) [972 bp, 323 aa] {O...    65   4e-12
ZYRO0C15466g Chr3 complement(1208350..1208919) [570 bp, 189 aa] ...    64   5e-12
KAFR0J01600 Chr10 complement(290538..291206) [669 bp, 222 aa] {O...    64   5e-12
YNL098C Chr14 complement(439602..440570) [969 bp, 322 aa] {ON}  ...    65   5e-12
ZYRO0E03608g Chr5 complement(279670..280272) [603 bp, 200 aa] {O...    64   5e-12
TDEL0C04630 Chr3 complement(837302..837877) [576 bp, 191 aa] {ON...    64   5e-12
Kpol_1039.20 s1039 (65494..66126) [633 bp, 210 aa] {ON} (65494.....    64   5e-12
Skud_15.266 Chr15 (471563..472504) [942 bp, 313 aa] {ON} YOR101W...    65   6e-12
Skud_7.476 Chr7 complement(778308..779126) [819 bp, 272 aa] {ON}...    65   6e-12
Smik_14.227 Chr14 complement(419257..420225) [969 bp, 322 aa] {O...    65   6e-12
Skud_13.80 Chr13 complement(143292..144029) [738 bp, 245 aa] {ON...    64   6e-12
ZYRO0G07018g Chr7 complement(559273..560025) [753 bp, 250 aa] {O...    64   6e-12
NCAS0B06850 Chr2 (1305199..1306173) [975 bp, 324 aa] {ON} Anc_2....    65   7e-12
Suva_14.241 Chr14 complement(437053..438021) [969 bp, 322 aa] {O...    65   7e-12
Smik_6.257 Chr6 complement(414005..414820) [816 bp, 271 aa] {ON}...    64   7e-12
KNAG0E01840 Chr5 (380757..381419) [663 bp, 220 aa] {ON} Anc_2.24...    64   7e-12
Skud_11.291 Chr11 (529726..530601) [876 bp, 291 aa] {ON} YKR055W...    65   7e-12
Suva_7.443 Chr7 complement(764401..765216) [816 bp, 271 aa] {ON}...    64   7e-12
NDAI0F02560 Chr6 complement(629428..630000) [573 bp, 190 aa] {ON}      63   8e-12
SAKL0G17424g Chr7 (1508263..1508913) [651 bp, 216 aa] {ON} simil...    64   8e-12
YGR152C Chr7 complement(794674..795492) [819 bp, 272 aa] {ON}  R...    64   8e-12
Smik_15.281 Chr15 (476294..477232) [939 bp, 312 aa] {ON} YOR101W...    64   9e-12
ZYRO0D01452g Chr4 complement(104471..105133) [663 bp, 220 aa] {O...    64   9e-12
Kpol_1026.12 s1026 complement(27073..28062) [990 bp, 329 aa] {ON...    65   1e-11
Smik_11.317 Chr11 (538087..539016) [930 bp, 309 aa] {ON} YKR055W...    64   1e-11
Kpol_1029.18 s1029 (37197..37763) [567 bp, 188 aa] {ON} (37197.....    63   1e-11
YKR055W Chr11 (548216..549091) [876 bp, 291 aa] {ON}  RHO4Non-es...    64   1e-11
TDEL0D00920 Chr4 complement(167879..168568) [690 bp, 229 aa] {ON...    63   1e-11
KLLA0F03443g Chr6 (324020..324691) [672 bp, 223 aa] {ON} highly ...    63   1e-11
SAKL0E12848g Chr5 (1060050..1060835) [786 bp, 261 aa] {ON} simil...    64   1e-11
Kwal_33.14015 s33 complement(484017..484832) [816 bp, 271 aa] {O...    64   1e-11
KLLA0C13387g Chr3 complement(1142002..1142841,1143162..1143176) ...    64   2e-11
TPHA0B03000 Chr2 complement(683258..684175) [918 bp, 305 aa] {ON...    64   2e-11
KNAG0D03780 Chr4 complement(688854..689768) [915 bp, 304 aa] {ON...    64   2e-11
Suva_11.289 Chr11 (531935..532810) [876 bp, 291 aa] {ON} YKR055W...    64   2e-11
ADL252W Chr4 (258347..259021) [675 bp, 224 aa] {ON} Syntenic hom...    63   2e-11
KLTH0H13970g Chr8 (1217045..1217623) [579 bp, 192 aa] {ON} simil...    62   2e-11
Kwal_23.4875 s23 (904790..905482) [693 bp, 230 aa] {ON} YIL118W ...    63   2e-11
ZYRO0D03146g Chr4 complement(244206..245039) [834 bp, 277 aa] {O...    63   2e-11
Suva_8.155 Chr8 (272370..273320) [951 bp, 316 aa] {ON} YOR101W (...    64   2e-11
ZYRO0B14256g Chr2 (1160536..1161219) [684 bp, 227 aa] {ON} simil...    62   2e-11
KAFR0J01970 Chr10 (379033..379989) [957 bp, 318 aa] {ON} Anc_2.1...    64   2e-11
SAKL0E10252g Chr5 (855721..855735,855900..856691) [807 bp, 268 a...    63   2e-11
Kwal_14.2244 s14 (671441..672175) [735 bp, 244 aa] {ON} YGR152C ...    62   3e-11
CAGL0G08558g Chr7 complement(804969..805652) [684 bp, 227 aa] {O...    62   3e-11
KLTH0G09548g Chr7 (802001..802696) [696 bp, 231 aa] {ON} highly ...    62   3e-11
Ecym_1407 Chr1 (846135..846941) [807 bp, 268 aa] {ON} similar to...    62   3e-11
KLTH0D08932g Chr4 (742772..742786,742899..743762) [879 bp, 292 a...    63   4e-11
NDAI0D03040 Chr4 (717810..718454) [645 bp, 214 aa] {ON} Anc_4.326      62   4e-11
TBLA0E03870 Chr5 (972894..973580) [687 bp, 228 aa] {ON} Anc_2.24...    62   5e-11
SAKL0E08558g Chr5 complement(695313..695990) [678 bp, 225 aa] {O...    62   5e-11
TPHA0F01280 Chr6 complement(293022..293657) [636 bp, 211 aa] {ON...    61   6e-11
KAFR0I00390 Chr9 complement(84398..85093) [696 bp, 231 aa] {ON} ...    62   6e-11
KNAG0E03990 Chr5 (788341..789045) [705 bp, 234 aa] {ON} Anc_4.32...    62   6e-11
KAFR0G00680 Chr7 complement(170317..171210) [894 bp, 297 aa] {ON...    62   7e-11
KLTH0H09042g Chr8 (776732..777460) [729 bp, 242 aa] {ON} similar...    61   8e-11
ZYRO0C09680g Chr3 (735760..736698) [939 bp, 312 aa] {ON} similar...    62   8e-11
SAKL0E09834g Chr5 complement(819736..820308) [573 bp, 190 aa] {O...    60   8e-11
TPHA0F02330 Chr6 (513129..514112) [984 bp, 327 aa] {ON} Anc_2.75...    62   8e-11
TDEL0C04120 Chr3 complement(725595..726290) [696 bp, 231 aa] {ON...    61   1e-10
AFR464W Chr6 (1274600..1275394) [795 bp, 264 aa] {ON} Syntenic h...    61   1e-10
Ecym_1155 Chr1 complement(318859..319560) [702 bp, 233 aa] {ON} ...    61   1e-10
CAGL0K08316g Chr11 (839222..840193) [972 bp, 323 aa] {ON} some s...    61   1e-10
Kpol_1041.7 s1041 (25272..26135) [864 bp, 287 aa] {ON} (25272..2...    61   1e-10
Kwal_34.16142 s34 complement(220030..220608) [579 bp, 192 aa] {O...    60   1e-10
AER132W Chr5 (888052..888750) [699 bp, 232 aa] {ON} Syntenic hom...    60   2e-10
ADL262W Chr4 (243996..244010,244072..244869) [813 bp, 270 aa] {O...    60   2e-10
ABL139C Chr2 complement(134873..135757) [885 bp, 294 aa] {ON} Sy...    60   2e-10
ZYRO0B09438g Chr2 (738659..739555) [897 bp, 298 aa] {ON} similar...    60   2e-10
ZYRO0A01606g Chr1 (133530..134252) [723 bp, 240 aa] {ON} highly ...    60   3e-10
NDAI0B03750 Chr2 complement(940372..941094) [723 bp, 240 aa] {ON...    60   3e-10
SAKL0H20746g Chr8 (1817259..1818014) [756 bp, 251 aa] {ON} simil...    60   3e-10
KLLA0A04213g Chr1 complement(382243..382818) [576 bp, 191 aa] {O...    59   3e-10
Ecym_4146 Chr4 complement(312161..312736) [576 bp, 191 aa] {ON} ...    59   3e-10
AGL093W Chr7 (532002..532577) [576 bp, 191 aa] {ON} Syntenic hom...    59   3e-10
KLLA0D08327g Chr4 (708240..709004) [765 bp, 254 aa] {ON} similar...    60   3e-10
TBLA0H03330 Chr8 (817665..818243) [579 bp, 192 aa] {ON} Anc_8.42...    59   3e-10
ABR183W Chr2 (755915..756538) [624 bp, 207 aa] {ON} Rho1b; Synte...    59   4e-10
NCAS0B06460 Chr2 complement(1221860..1222564) [705 bp, 234 aa] {...    59   4e-10
KLLA0C12001g Chr3 complement(1029092..1029871) [780 bp, 259 aa] ...    59   4e-10
SAKL0H13068g Chr8 complement(1125095..1125670) [576 bp, 191 aa] ...    59   4e-10
Ecym_6421 Chr6 (820187..821071) [885 bp, 294 aa] {ON} similar to...    60   4e-10
KAFR0B06320 Chr2 (1307235..1307810) [576 bp, 191 aa] {ON} Anc_8....    59   4e-10
Suva_10.324 Chr10 complement(570500..571075) [576 bp, 191 aa] {O...    59   4e-10
Skud_12.297 Chr12 complement(544541..545116) [576 bp, 191 aa] {O...    59   4e-10
Kpol_529.16 s529 complement(43810..44385) [576 bp, 191 aa] {ON} ...    59   4e-10
Ecym_7212 Chr7 (444427..445050) [624 bp, 207 aa] {ON} similar to...    59   4e-10
Kwal_23.3135 s23 complement(172095..172670) [576 bp, 191 aa] {ON...    59   4e-10
KLTH0F07920g Chr6 complement(687410..687985) [576 bp, 191 aa] {O...    59   4e-10
YLR229C Chr12 complement(604212..604787) [576 bp, 191 aa] {ON}  ...    59   4e-10
TBLA0B01410 Chr2 complement(304771..306687) [1917 bp, 638 aa] {O...    60   4e-10
ZYRO0A09306g Chr1 (745829..746404) [576 bp, 191 aa] {ON} highly ...    59   5e-10
KLTH0F05698g Chr6 complement(489561..490376) [816 bp, 271 aa] {O...    59   5e-10
Smik_12.290 Chr12 complement(544884..545459) [576 bp, 191 aa] {O...    58   5e-10
KNAG0F01270 Chr6 complement(229391..230398) [1008 bp, 335 aa] {O...    60   5e-10
TDEL0F05450 Chr6 (1014759..1015334) [576 bp, 191 aa] {ON} Anc_8....    58   5e-10
TPHA0C02190 Chr3 complement(498886..499461) [576 bp, 191 aa] {ON...    58   5e-10
CAGL0F05269g Chr6 complement(533759..534334) [576 bp, 191 aa] {O...    58   5e-10
TPHA0K01820 Chr11 complement(385771..386733) [963 bp, 320 aa] {O...    59   6e-10
KNAG0A04510 Chr1 complement(632334..632939) [606 bp, 201 aa] {ON...    58   6e-10
KLLA0A11330g Chr1 (982552..983124) [573 bp, 190 aa] {ON} similar...    58   7e-10
KLTH0F18590g Chr6 (1511729..1512355) [627 bp, 208 aa] {ON} highl...    58   9e-10
ACR257C Chr3 complement(808667..809446) [780 bp, 259 aa] {ON} Sy...    58   1e-09
Kwal_55.21941 s55 (1048693..1049322) [630 bp, 209 aa] {ON} YPR16...    57   1e-09
NCAS0J02000 Chr10 (384676..385347) [672 bp, 223 aa] {ON} Anc_4.326     58   1e-09
Ecym_5349 Chr5 complement(708225..709076,709277..709288) [864 bp...    58   1e-09
TBLA0B00370 Chr2 (68828..69868) [1041 bp, 346 aa] {ON}                 58   1e-09
KLTH0F18612g Chr6 (1513182..1513811) [630 bp, 209 aa] {ON} simil...    57   2e-09
Suva_3.60 Chr3 (81874..82491) [618 bp, 205 aa] {ON} YCR027C (REAL)     57   2e-09
TBLA0H00690 Chr8 complement(148963..149622) [660 bp, 219 aa] {ON...    57   2e-09
CAGL0E03113g Chr5 complement(289401..290372) [972 bp, 323 aa] {O...    58   2e-09
SAKL0F15642g Chr6 (1273987..1274616) [630 bp, 209 aa] {ON} highl...    57   2e-09
NCAS0B02880 Chr2 complement(494164..494739) [576 bp, 191 aa] {ON...    57   2e-09
KLLA0B10626g Chr2 (936497..937123) [627 bp, 208 aa] {ON} uniprot...    57   2e-09
NDAI0C04820 Chr3 (1113624..1114199) [576 bp, 191 aa] {ON} Anc_8....    56   2e-09
KNAG0H03380 Chr8 (632140..633114) [975 bp, 324 aa] {ON} Anc_2.18...    57   2e-09
NCAS0A08470 Chr1 complement(1678221..1678847) [627 bp, 208 aa] {...    57   3e-09
NDAI0G04930 Chr7 complement(1191671..1192303) [633 bp, 210 aa] {...    56   3e-09
NDAI0H03720 Chr8 (909855..910775) [921 bp, 306 aa] {ON} Anc_2.75       57   5e-09
KAFR0A07530 Chr1 (1520661..1521554) [894 bp, 297 aa] {ON} Anc_2....    57   5e-09
KAFR0F00400 Chr6 complement(94002..94754) [753 bp, 250 aa] {ON} ...    56   6e-09
KNAG0K02400 Chr11 complement(482842..483861) [1020 bp, 339 aa] {...    56   6e-09
KNAG0I01930 Chr9 (376663..377622) [960 bp, 319 aa] {ON}                56   7e-09
TBLA0D05710 Chr4 (1411089..1412231) [1143 bp, 380 aa] {ON} Anc_1...    56   1e-08
SAKL0F15620g Chr6 (1272848..1273471) [624 bp, 207 aa] {ON} highl...    55   1e-08
TDEL0A01170 Chr1 complement(198136..198957) [822 bp, 273 aa] {ON...    55   2e-08
NCAS0D00420 Chr4 complement(64888..65739) [852 bp, 283 aa] {ON} ...    55   2e-08
Smik_14.27 Chr14 (44732..45976) [1245 bp, 414 aa] {ON} YNL304W (...    55   3e-08
YCR027C Chr3 complement(167370..167999) [630 bp, 209 aa] {ON}  R...    54   3e-08
NDAI0F03360 Chr6 (810071..811003) [933 bp, 310 aa] {ON} Anc_2.75       54   3e-08
YNL180C Chr14 complement(299654..300649) [996 bp, 331 aa] {ON}  ...    54   6e-08
Skud_3.103 Chr3 complement(150880..151509) [630 bp, 209 aa] {ON}...    53   6e-08
Skud_14.35 Chr14 (53689..55065) [1377 bp, 458 aa] {ON} YNL304W (...    54   6e-08
Smik_3.126 Chr3 complement(166497..167126) [630 bp, 209 aa] {ON}...    52   8e-08
Suva_14.35 Chr14 (56635..57891) [1257 bp, 418 aa] {ON} YNL304W (...    54   8e-08
YNL304W Chr14 (60297..61550) [1254 bp, 417 aa] {ON}  YPT11Rab fa...    53   1e-07
TDEL0F01360 Chr6 complement(241607..242470) [864 bp, 287 aa] {ON...    53   1e-07
KAFR0A08400 Chr1 complement(1686919..1688154) [1236 bp, 411 aa] ...    53   1e-07
Skud_14.154 Chr14 complement(290647..291642) [996 bp, 331 aa] {O...    52   2e-07
NCAS0H00220 Chr8 complement(29761..30399) [639 bp, 212 aa] {ON}        52   2e-07
Kpol_1013.49 s1013 complement(108782..109414) [633 bp, 210 aa] {...    51   3e-07
Ecym_2048 Chr2 (75961..77217) [1257 bp, 418 aa] {ON} similar to ...    51   4e-07
Kwal_55.21937 s55 (1047204..1047830) [627 bp, 208 aa] {ON} YPR16...    50   4e-07
Smik_14.150 Chr14 complement(278905..279900) [996 bp, 331 aa] {O...    51   4e-07
NDAI0D00180 Chr4 complement(26285..26926) [642 bp, 213 aa] {ON}        50   4e-07
Kwal_55.21971 s55 complement(1059877..1061142) [1266 bp, 421 aa]...    51   4e-07
CAGL0G05764g Chr7 complement(552809..553681) [873 bp, 290 aa] {O...    51   5e-07
SAKL0D10780g Chr4 (896563..897222) [660 bp, 219 aa] {ON} similar...    50   5e-07
ADL162W Chr4 (405599..406813) [1215 bp, 404 aa] {ON} Syntenic ho...    51   5e-07
CAGL0M03817g Chr13 complement(431237..432664) [1428 bp, 475 aa] ...    51   6e-07
Kpol_1008.17 s1008 (34952..35581) [630 bp, 209 aa] {ON} (34952.....    50   6e-07
TPHA0I03130 Chr9 (696033..696662) [630 bp, 209 aa] {ON}                50   7e-07
TPHA0O00870 Chr15 complement(162632..163369) [738 bp, 245 aa] {O...    50   7e-07
TBLA0F02960 Chr6 (719060..719707) [648 bp, 215 aa] {ON} Anc_7.52...    50   8e-07
TBLA0J00210 Chr10 complement(27395..28039) [645 bp, 214 aa] {ON}...    49   9e-07
NDAI0A06180 Chr1 complement(1405552..1407303) [1752 bp, 583 aa] ...    50   1e-06
TDEL0E00580 Chr5 (126371..127576) [1206 bp, 401 aa] {ON} Anc_3.4...    50   1e-06
ZYRO0D01474g Chr4 complement(105651..106289) [639 bp, 212 aa] {O...    49   1e-06
TDEL0H00500 Chr8 complement(74047..74679) [633 bp, 210 aa] {ON} ...    49   1e-06
KLTH0F18810g Chr6 complement(1525047..1526393) [1347 bp, 448 aa]...    50   1e-06
Kpol_1013.48 s1013 complement(107294..107959) [666 bp, 221 aa] {...    49   1e-06
NDAI0J00230 Chr10 (38760..39515) [756 bp, 251 aa] {ON}                 49   1e-06
Ecym_7211 Chr7 (442765..443412) [648 bp, 215 aa] {ON} similar to...    49   2e-06
KNAG0D05300 Chr4 (974092..974730) [639 bp, 212 aa] {ON}                49   2e-06
KAFR0B00480 Chr2 complement(98402..99040) [639 bp, 212 aa] {ON} ...    49   2e-06
SAKL0C12716g Chr3 complement(1135452..1136720) [1269 bp, 422 aa]...    49   2e-06
ABR182W Chr2 (754518..755147) [630 bp, 209 aa] {ON} Rho1a; Synte...    48   2e-06
Suva_14.161 Chr14 complement(295880..296878) [999 bp, 332 aa] {O...    49   3e-06
Suva_16.495 Chr16 (859802..860431) [630 bp, 209 aa] {ON} YPR165W...    48   3e-06
Skud_16.464 Chr16 (818093..818722) [630 bp, 209 aa] {ON} YPR165W...    48   3e-06
Smik_16.424 Chr16 (736628..737257) [630 bp, 209 aa] {ON} YPR165W...    48   3e-06
YPR165W Chr16 (875368..875997) [630 bp, 209 aa] {ON}  RHO1GTP-bi...    48   3e-06
CAGL0I08459g Chr9 (829562..830194) [633 bp, 210 aa] {ON} highly ...    48   3e-06
NCAS0A15070 Chr1 (2971104..2971739) [636 bp, 211 aa] {ON}              48   3e-06
KAFR0A03120 Chr1 complement(636653..637282) [630 bp, 209 aa] {ON}      47   5e-06
TPHA0I03140 Chr9 (697331..697990) [660 bp, 219 aa] {ON} Anc_7.521      47   7e-06
Kpol_1060.60 s1060 complement(139699..140631) [933 bp, 310 aa] {...    47   1e-05
TDEL0H00970 Chr8 complement(158769..159638) [870 bp, 289 aa] {ON...    46   2e-05
KAFR0H01380 Chr8 (258305..258901) [597 bp, 198 aa] {ON} Anc_8.50...    45   2e-05
TBLA0B08610 Chr2 complement(2057209..2059068) [1860 bp, 619 aa] ...    46   2e-05
TPHA0P01330 Chr16 complement(269708..271318) [1611 bp, 536 aa] {...    46   2e-05
TBLA0B00790 Chr2 complement(171658..172677) [1020 bp, 339 aa] {O...    45   3e-05
KLLA0C12881g Chr3 (1090895..1092016) [1122 bp, 373 aa] {ON} simi...    45   3e-05
SAKL0H11066g Chr8 (955148..955741) [594 bp, 197 aa] {ON} highly ...    44   6e-05
ZYRO0C02618g Chr3 complement(208102..209172) [1071 bp, 356 aa] {...    45   7e-05
Kwal_47.18241 s47 (748088..748780) [693 bp, 230 aa] {ON} YOR089C...    44   1e-04
NCAS0A10020 Chr1 complement(2005133..2006716) [1584 bp, 527 aa] ...    44   2e-04
Kpol_1056.30 s1056 complement(68711..69394) [684 bp, 227 aa] {ON...    43   2e-04
KLTH0G05654g Chr7 complement(450410..451090,451167..451244) [759...    43   2e-04
Kpol_333.2 s333 (2276..2875) [600 bp, 199 aa] {ON} (2276..2875) ...    42   3e-04
Skud_16.231 Chr16 (424100..424696) [597 bp, 198 aa] {ON} YPL051W...    42   4e-04
ZYRO0F08536g Chr6 complement(687627..688223) [597 bp, 198 aa] {O...    42   4e-04
Kpol_1076.2 s1076 complement(1580..3259) [1680 bp, 559 aa] {ON} ...    42   4e-04
YPL051W Chr16 (459963..460559) [597 bp, 198 aa] {ON}  ARL3GTPase...    41   5e-04
Suva_16.264 Chr16 (463019..463615) [597 bp, 198 aa] {ON} YPL051W...    40   9e-04
KAFR0E01740 Chr5 complement(352927..353958) [1032 bp, 343 aa] {O...    41   0.001
Kwal_27.11872 s27 complement(985259..985852) [594 bp, 197 aa] {O...    40   0.002
Smik_16.185 Chr16 (335352..335948) [597 bp, 198 aa] {ON} YPL051W...    40   0.002
TBLA0A00450 Chr1 complement(83149..83760) [612 bp, 203 aa] {ON} ...    40   0.002
TPHA0C01660 Chr3 (384105..384704) [600 bp, 199 aa] {ON} Anc_8.50...    40   0.002
KLLA0F02662g Chr6 (241804..242565) [762 bp, 253 aa] {ON} conserv...    40   0.002
KAFR0J01900 Chr10 (369226..369768) [543 bp, 180 aa] {ON} Anc_2.1...    39   0.002
NCAS0C02320 Chr3 (436472..437071) [600 bp, 199 aa] {ON} Anc_8.502      39   0.003
TBLA0A06090 Chr1 (1499665..1499689,1499931..1500475) [570 bp, 18...    39   0.003
NCAS0D01240 Chr4 complement(226870..227421) [552 bp, 183 aa] {ON...    39   0.003
KLLA0F17072g Chr6 complement(1566668..1567240) [573 bp, 190 aa] ...    39   0.003
CAGL0I03916g Chr9 (343014..343559) [546 bp, 181 aa] {ON} highly ...    39   0.004
Kpol_1019.32 s1019 (66082..66627) [546 bp, 181 aa] {ON} (66082.....    39   0.004
Skud_16.61 Chr16 (112172..112199,112340..112884) [573 bp, 190 aa...    39   0.004
ZYRO0F05742g Chr6 complement(473659..474204) [546 bp, 181 aa] {O...    39   0.004
KAFR0L01290 Chr12 complement(239086..239631) [546 bp, 181 aa] {O...    39   0.004
TPHA0A03130 Chr1 (688097..688642) [546 bp, 181 aa] {ON} Anc_7.30...    39   0.004
NDAI0A02910 Chr1 (653631..654176) [546 bp, 181 aa] {ON}                39   0.004
Skud_4.117 Chr4 (212154..212699) [546 bp, 181 aa] {ON} YDL137W (...    39   0.004
SAKL0G06908g Chr7 complement(568249..569100) [852 bp, 283 aa] {O...    39   0.005
TDEL0C02390 Chr3 (420853..421398) [546 bp, 181 aa] {ON} Anc_7.30...    39   0.005
Kpol_2000.16 s2000 complement(29208..29753) [546 bp, 181 aa] {ON...    39   0.005
NCAS0E03720 Chr5 complement(731259..731804) [546 bp, 181 aa] {ON...    39   0.005
KNAG0B02830 Chr2 (545859..546404) [546 bp, 181 aa] {ON} Anc_7.30...    39   0.005
TPHA0P00900 Chr16 complement(180898..181443) [546 bp, 181 aa] {O...    38   0.005
KAFR0B01090 Chr2 (206995..207540) [546 bp, 181 aa] {ON} Anc_7.30...    38   0.005
Skud_4.66 Chr4 (113702..114247) [546 bp, 181 aa] {ON} YDL192W (R...    38   0.005
Smik_4.48 Chr4 (94533..95078) [546 bp, 181 aa] {ON} YDL192W (REAL)     38   0.005
NDAI0A02160 Chr1 (489919..490575) [657 bp, 218 aa] {ON} Anc_7.307      39   0.005
YDL192W Chr4 (116321..116866) [546 bp, 181 aa] {ON}  ARF1ADP-rib...    38   0.005
Smik_4.98 Chr4 (193129..193674) [546 bp, 181 aa] {ON} YDL137W (R...    38   0.005
YDL137W Chr4 (216529..217074) [546 bp, 181 aa] {ON}  ARF2ADP-rib...    38   0.005
CAGL0J09064g Chr10 (894680..895225) [546 bp, 181 aa] {ON} highly...    38   0.005
NCAS0A13870 Chr1 complement(2722379..2722924) [546 bp, 181 aa] {...    38   0.005
KNAG0C04000 Chr3 (788971..789546) [576 bp, 191 aa] {ON} Anc_7.30...    38   0.006
TBLA0A05900 Chr1 (1456128..1456673) [546 bp, 181 aa] {ON} Anc_7....    38   0.006
Suva_4.107 Chr4 (204848..205393) [546 bp, 181 aa] {ON} YDL137W (...    38   0.006
Suva_4.56 Chr4 (104717..105262) [546 bp, 181 aa] {ON} YDL192W (R...    38   0.006
CAGL0J11242g Chr10 (1094754..1095908) [1155 bp, 384 aa] {ON} sim...    39   0.007
Suva_16.88 Chr16 (148107..148134,148267..148811) [573 bp, 190 aa...    38   0.007
Smik_6.423 Chr6 complement(684936..685480,685617..685644) [573 b...    38   0.007
YPL218W Chr16 (138698..138725,138865..139409) [573 bp, 190 aa] {...    38   0.007
TBLA0F02110 Chr6 complement(518429..518974) [546 bp, 181 aa] {ON...    38   0.008
TDEL0A04760 Chr1 complement(841005..841718) [714 bp, 237 aa] {ON}      38   0.009
TDEL0B01350 Chr2 (239829..240425) [597 bp, 198 aa] {ON} Anc_8.50...    37   0.010
NDAI0E03010 Chr5 (642507..643181) [675 bp, 224 aa] {ON} Anc_8.502      38   0.010
Ecym_2552 Chr2 complement(1071072..1071668) [597 bp, 198 aa] {ON...    37   0.010
Kpol_1002.39 s1002 (115751..116317) [567 bp, 188 aa] {ON} (11575...    37   0.011
TPHA0J02510 Chr10 complement(557245..557814) [570 bp, 189 aa] {O...    37   0.013
TPHA0F01600 Chr6 (371312..371857) [546 bp, 181 aa] {ON} Anc_2.19...    37   0.013
Suva_8.147 Chr8 (259965..260516) [552 bp, 183 aa] {ON} YOR094W (...    37   0.013
AGL261W Chr7 (218211..218807) [597 bp, 198 aa] {ON} Syntenic hom...    37   0.014
KLTH0E11660g Chr5 complement(1038583..1039245) [663 bp, 220 aa] ...    37   0.014
CAGL0L12826g Chr12 complement(1373063..1373662) [600 bp, 199 aa]...    37   0.015
Kwal_56.24462 s56 complement(1005762..1006307) [546 bp, 181 aa] ...    37   0.016
KNAG0A02140 Chr1 (186453..187052) [600 bp, 199 aa] {ON} Anc_8.50...    37   0.019
SAKL0E10054g Chr5 (843076..843621) [546 bp, 181 aa] {ON} highly ...    37   0.020
CAGL0E05896g Chr5 complement(584585..585129,585415..585439) [570...    37   0.022
KAFR0K00190 Chr11 (47432..47459,47605..48149) [573 bp, 190 aa] {...    36   0.026
TPHA0B03060 Chr2 complement(695421..696458) [1038 bp, 345 aa] {O...    37   0.028
TDEL0E05440 Chr5 complement(998317..998861,998933..998957) [570 ...    36   0.034
KLLA0C13563g Chr3 complement(1157278..1157826) [549 bp, 182 aa] ...    35   0.039
KLTH0E13838g Chr5 (1219497..1220048) [552 bp, 183 aa] {ON} highl...    35   0.040
KLLA0E24773g Chr5 (2194554..2195105) [552 bp, 183 aa] {ON} highl...    35   0.041
AFL114W Chr6 (222754..223326) [573 bp, 190 aa] {ON} Syntenic hom...    35   0.045
ZYRO0E07304g Chr5 complement(559169..559713,559791..559815) [570...    35   0.047
SAKL0A03960g Chr1 (368829..368850,368923..369467) [567 bp, 188 a...    35   0.048
NCAS0B06760 Chr2 (1290711..1291256) [546 bp, 181 aa] {ON} Anc_2....    35   0.049
Kwal_56.24453 s56 complement(1004296..1004841) [546 bp, 181 aa] ...    35   0.049
SAKL0F10296g Chr6 complement(791446..791991) [546 bp, 181 aa] {O...    35   0.051
TBLA0B01480 Chr2 complement(320668..321213) [546 bp, 181 aa] {ON...    35   0.052
KLTH0H02200g Chr8 (199831..200376) [546 bp, 181 aa] {ON} highly ...    35   0.052
KLTH0H02222g Chr8 (201281..201826) [546 bp, 181 aa] {ON} highly ...    35   0.053
SAKL0H08624g Chr8 complement(744555..745106) [552 bp, 183 aa] {O...    35   0.055
Ecym_7092 Chr7 (177595..178146) [552 bp, 183 aa] {ON} similar to...    35   0.056
Skud_2.292 Chr2 complement(535291..535842) [552 bp, 183 aa] {ON}...    35   0.060
KLLA0F05225g Chr6 (515391..515936) [546 bp, 181 aa] {ON} highly ...    35   0.064
TPHA0A01165 Chr1 complement(228734..229285) [552 bp, 183 aa] {ON}      35   0.067
YHR022C Chr8 complement(149575..150345) [771 bp, 256 aa] {ON} Pu...    35   0.068
Ecym_8057 Chr8 complement(123686..124231) [546 bp, 181 aa] {ON} ...    35   0.068
ADR094W Chr4 (878121..878666) [546 bp, 181 aa] {ON} Syntenic hom...    35   0.068
Smik_2.305 Chr2 complement(554080..554631) [552 bp, 183 aa] {ON}...    35   0.072
YBR164C Chr2 complement(567875..568426) [552 bp, 183 aa] {ON}  A...    35   0.072
Suva_4.416 Chr4 complement(737342..737893) [552 bp, 183 aa] {ON}...    35   0.072
NDAI0B04050 Chr2 complement(1027616..1028029) [414 bp, 137 aa] {...    34   0.074
KAFR0E00655 Chr5 complement(145183..145734) [552 bp, 183 aa] {ON}      35   0.074
ZYRO0A10340g Chr1 complement(841263..841814) [552 bp, 183 aa] {O...    35   0.080
KNAG0A01690 Chr1 complement(99320..99871) [552 bp, 183 aa] {ON} ...    35   0.080
TDEL0F01430 Chr6 complement(253231..253776) [546 bp, 181 aa] {ON...    35   0.081
AGR221W Chr7 (1164825..1165376) [552 bp, 183 aa] {ON} Syntenic h...    35   0.085
Kpol_1020.46 s1020 (107506..108051) [546 bp, 181 aa] {ON} (10750...    35   0.088
NCAS0C01840 Chr3 complement(342241..342792) [552 bp, 183 aa] {ON...    35   0.088
CAGL0I10835g Chr9 (1071206..1071757) [552 bp, 183 aa] {ON} highl...    35   0.088
ZYRO0E02090g Chr5 complement(155560..156105) [546 bp, 181 aa] {O...    35   0.090
ACL078W Chr3 (212664..213209) [546 bp, 181 aa] {ON} Syntenic hom...    34   0.097
KNAG0D01000 Chr4 (164190..164217,164460..165004) [573 bp, 190 aa...    34   0.10 
NDAI0E02560 Chr5 complement(533331..533882) [552 bp, 183 aa] {ON...    34   0.10 
CAGL0E06292g Chr5 (633372..634598) [1227 bp, 408 aa] {ON} some s...    35   0.10 
Ecym_5356 Chr5 complement(720805..721350) [546 bp, 181 aa] {ON} ...    34   0.11 
SAKL0F10318g Chr6 complement(793294..793782) [489 bp, 162 aa] {O...    34   0.11 
KNAG0H03300 Chr8 (620438..620983) [546 bp, 181 aa] {ON} Anc_2.19...    34   0.13 
Skud_15.259 Chr15 (459133..459684) [552 bp, 183 aa] {ON} YOR094W...    34   0.13 
NDAI0F01490 Chr6 (367903..367927,368225..368772) [573 bp, 190 aa...    34   0.13 
Smik_15.274 Chr15 (463883..464434) [552 bp, 183 aa] {ON} YOR094W...    34   0.14 
YOR094W Chr15 (502795..503346) [552 bp, 183 aa] {ON}  ARF3Glucos...    34   0.14 
TDEL0A05420 Chr1 (950041..950592) [552 bp, 183 aa] {ON} Anc_8.59...    34   0.14 
TBLA0E01940 Chr5 complement(474121..476922) [2802 bp, 933 aa] {O...    35   0.15 
TBLA0E04020 Chr5 (1011363..1011914) [552 bp, 183 aa] {ON} Anc_8....    33   0.18 
KLTH0H03696g Chr8 (335581..335602,335689..336233) [567 bp, 188 a...    33   0.18 
Suva_16.203 Chr16 complement(356955..357512) [558 bp, 185 aa] {O...    33   0.21 
NDAI0B04110 Chr2 (1042191..1042736) [546 bp, 181 aa] {ON} Anc_6....    33   0.24 
KLTH0G08074g Chr7 complement(651983..652537) [555 bp, 184 aa] {O...    33   0.26 
Ecym_2181 Chr2 (354573..355145) [573 bp, 190 aa] {ON} similar to...    33   0.30 
TPHA0H02990 Chr8 (715815..717776) [1962 bp, 653 aa] {ON} Anc_7.1...    33   0.32 
KLTH0D00880g Chr4 complement(84021..86015) [1995 bp, 664 aa] {ON...    33   0.35 
YAL048C Chr1 complement(52801..54789) [1989 bp, 662 aa] {ON}  GE...    33   0.36 
Skud_1.12 Chr1 complement(28719..30704) [1986 bp, 661 aa] {ON} Y...    33   0.37 
Kpol_1049.6 s1049 (13314..15272) [1959 bp, 652 aa] {ON} (13314.....    33   0.46 
KAFR0B05110 Chr2 complement(1051041..1051583) [543 bp, 180 aa] {...    32   0.50 
Smik_1.15 Chr1 complement(35773..37758) [1986 bp, 661 aa] {ON} Y...    33   0.52 
Kwal_26.6810 s26 complement(74581..76575) [1995 bp, 664 aa] {ON}...    33   0.57 
Suva_1.16 Chr1 complement(29877..31853) [1977 bp, 658 aa] {ON} Y...    33   0.60 
Suva_1.30 Chr1 (53039..56005) [2967 bp, 988 aa] {ON} YAL035W (REAL)    33   0.62 
SAKL0D14498g Chr4 (1190537..1190579,1190642..1192623) [2025 bp, ...    33   0.63 
Kwal_23.2944 s23 complement(84192..84746) [555 bp, 184 aa] {ON} ...    32   0.70 
TBLA0A10480 Chr1 (2580976..2582211) [1236 bp, 411 aa] {ON} Anc_5...    32   0.74 
KLLA0A03465g Chr1 complement(314573..316552) [1980 bp, 659 aa] {...    32   0.85 
KLLA0B02046g Chr2 (178646..179218) [573 bp, 190 aa] {ON} highly ...    32   0.99 
KAFR0E02440 Chr5 complement(494552..497515) [2964 bp, 987 aa] {O...    32   1.0  
AEL232C Chr5 complement(196356..197285) [930 bp, 309 aa] {ON} NO...    32   1.0  
KAFR0I00240 Chr9 complement(51330..53309) [1980 bp, 659 aa] {ON}...    32   1.1  
CAGL0M12276g Chr13 (1225135..1227084) [1950 bp, 649 aa] {ON} hig...    32   1.1  
Skud_13.177 Chr13 complement(306114..307697) [1584 bp, 527 aa] {...    32   1.1  
NDAI0D01840 Chr4 (432480..433610) [1131 bp, 376 aa] {ON} Anc_5.2...    32   1.2  
TDEL0E03600 Chr5 (677077..677943) [867 bp, 288 aa] {ON} Anc_5.26...    32   1.3  
Ecym_5018 Chr5 complement(39804..41783) [1980 bp, 659 aa] {ON} s...    32   1.5  
TDEL0H04320 Chr8 (743371..745332) [1962 bp, 653 aa] {ON} Anc_7.1...    31   1.7  
Smik_13.187 Chr13 complement(311260..312843) [1584 bp, 527 aa] {...    31   1.8  
TPHA0I02500 Chr9 complement(554264..555934) [1671 bp, 556 aa] {O...    31   2.2  
KAFR0A02180 Chr1 complement(455809..457344) [1536 bp, 511 aa] {O...    31   2.6  
Suva_13.190 Chr13 complement(310063..311646) [1584 bp, 527 aa] {...    31   2.9  
KNAG0F02740 Chr6 (519000..519956) [957 bp, 318 aa] {ON} Anc_5.26...    30   2.9  
TBLA0B09230 Chr2 complement(2184288..2184752) [465 bp, 154 aa] {...    30   3.8  
ZYRO0E06446g Chr5 complement(488300..489820) [1521 bp, 506 aa] {...    30   4.0  
KNAG0E04140 Chr5 (820949..822970) [2022 bp, 673 aa] {ON} Anc_7.1...    30   4.2  
ZYRO0A05500g Chr1 complement(448060..448785) [726 bp, 241 aa] {O...    30   4.3  
TBLA0A01350 Chr1 (320382..321452) [1071 bp, 356 aa] {ON} Anc_1.4...    30   4.5  
TBLA0A04400 Chr1 complement(1082864..1084813) [1950 bp, 649 aa] ...    30   4.7  
ZYRO0C00770g Chr3 complement(58234..60192) [1959 bp, 652 aa] {ON...    30   5.1  
TBLA0I01600 Chr9 complement(348934..351318) [2385 bp, 794 aa] {O...    30   5.3  
NCAS0A07600 Chr1 (1510813..1512783) [1971 bp, 656 aa] {ON}             30   6.3  
ADR402W Chr4 (1426897..1428882) [1986 bp, 661 aa] {ON} Syntenic ...    30   6.6  
NDAI0H01980 Chr8 (479594..481675) [2082 bp, 693 aa] {ON} Anc_7.1...    29   7.6  
YMR023C Chr13 complement(319437..321017) [1581 bp, 526 aa] {ON} ...    29   7.6  
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    29   9.5  

>KLLA0D01265g Chr4 (110784..111407) [624 bp, 207 aa] {ON} highly
           similar to uniprot|P32939 Saccharomyces cerevisiae
           YML001W YPT7 Gtp-binding protein of the rab family
           required for homotypic fusion event in vacuole
           inheritance for endosome-endosome fusion and for fusion
           of endosomes to vacuoles when expressed from high copy
           plasmid GTP-binding protein rab family
          Length = 207

 Score =  395 bits (1015), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 192/207 (92%), Positives = 192/207 (92%)

Query: 1   MSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQ 60
           MSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQ
Sbjct: 1   MSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQ 60

Query: 61  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPF 120
           VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPF
Sbjct: 61  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPF 120

Query: 121 VILANXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQ 180
           VILAN               AQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQ
Sbjct: 121 VILANKVDVEESKKVVSSRSAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQ 180

Query: 181 SDADAYEDDLSEAINIQLDGEPSSCNC 207
           SDADAYEDDLSEAINIQLDGEPSSCNC
Sbjct: 181 SDADAYEDDLSEAINIQLDGEPSSCNC 207

>SAKL0E01386g Chr5 (105246..105872) [627 bp, 208 aa] {ON} highly
           similar to uniprot|P32939 Saccharomyces cerevisiae
           YML001W YPT7 Gtp-binding protein of the rab family
           required for homotypic fusion event in vacuole
           inheritance for endosome-endosome fusion and for fusion
           of endosomes to vacuoles when expressed from high copy
           plasmid GTP-binding protein rab family
          Length = 208

 Score =  360 bits (925), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 173/206 (83%), Positives = 183/206 (88%)

Query: 2   SRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQV 61
           SRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEV V++DKVATMQV
Sbjct: 3   SRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDEDKVATMQV 62

Query: 62  WDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFV 121
           WDTAGQERFQSLGVAFYRGADCCVLVYDVTN KSF+N+KSWRDEFLVHANVSSPE+FPFV
Sbjct: 63  WDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPESFPFV 122

Query: 122 ILANXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQS 181
           IL N               AQE AKSLGNVPLF TSAK SINV+ AFEEIARSALQQSQ+
Sbjct: 123 ILGNKIDVEESKKVVNTRSAQELAKSLGNVPLFLTSAKGSINVETAFEEIARSALQQSQA 182

Query: 182 DADAYEDDLSEAINIQLDGEPSSCNC 207
           DADA+EDD ++AINIQLDGEPSSCNC
Sbjct: 183 DADAFEDDFNDAINIQLDGEPSSCNC 208

>Ecym_3028 Chr3 (54759..55385) [627 bp, 208 aa] {ON} similar to
           Ashbya gossypii ACR003C
          Length = 208

 Score =  355 bits (910), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 181/206 (87%)

Query: 2   SRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQV 61
           SRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEV V+ DKVATMQV
Sbjct: 3   SRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDGDKVATMQV 62

Query: 62  WDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFV 121
           WDTAGQERFQSLGVAFYRGADCCVLVYDVTN KSF+N+K+WRDEFLVHANV SPETFPFV
Sbjct: 63  WDTAGQERFQSLGVAFYRGADCCVLVYDVTNSKSFENIKAWRDEFLVHANVPSPETFPFV 122

Query: 122 ILANXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQS 181
           IL N               +QE AKSLGN+P F TSAK++INV DAFEEIARSALQQSQ+
Sbjct: 123 ILGNKIDVEESKKVVTTRSSQELAKSLGNIPFFLTSAKNAINVDDAFEEIARSALQQSQA 182

Query: 182 DADAYEDDLSEAINIQLDGEPSSCNC 207
           DADAYEDD ++AINIQLDGEPSSC+C
Sbjct: 183 DADAYEDDFNDAINIQLDGEPSSCSC 208

>ACR003C Chr3 complement(359762..360388) [627 bp, 208 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML001W
           (YPT7)
          Length = 208

 Score =  354 bits (909), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 170/206 (82%), Positives = 180/206 (87%)

Query: 2   SRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQV 61
           SRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEV V+ DKVATMQV
Sbjct: 3   SRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDGDKVATMQV 62

Query: 62  WDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFV 121
           WDTAGQERFQSLGVAFYRGADCCVLVYDVTN KSF+NVKSWRDEFLVHANV SPE+FPFV
Sbjct: 63  WDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENVKSWRDEFLVHANVPSPESFPFV 122

Query: 122 ILANXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQS 181
           IL N               +QE AKSLGN+P F TSAK++INV DAFEEIARSALQQSQ+
Sbjct: 123 ILGNKIDVEESKKVVTTRTSQELAKSLGNIPFFLTSAKNAINVDDAFEEIARSALQQSQA 182

Query: 182 DADAYEDDLSEAINIQLDGEPSSCNC 207
           DA AYEDD ++AINIQLDGEPSSCNC
Sbjct: 183 DAGAYEDDFNDAINIQLDGEPSSCNC 208

>TDEL0G04450 Chr7 complement(808210..808836) [627 bp, 208 aa] {ON}
           Anc_6.24 YML001W
          Length = 208

 Score =  354 bits (909), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 184/206 (89%)

Query: 2   SRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQV 61
           SRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEV+++DDKVATMQV
Sbjct: 3   SRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVATMQV 62

Query: 62  WDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFV 121
           WDTAGQERFQSLGVAFYRGADCCVLVYDVTN KSF+N+KSWRDEFLVHANVSSPETFPFV
Sbjct: 63  WDTAGQERFQSLGVAFYRGADCCVLVYDVTNVKSFENIKSWRDEFLVHANVSSPETFPFV 122

Query: 122 ILANXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQS 181
           IL N               AQ+ AKSLGNVPLFFTSAK++INV  AFEEI RSALQQ+Q+
Sbjct: 123 ILGNKIDVEESKKVVNTKSAQDLAKSLGNVPLFFTSAKNAINVDTAFEEIGRSALQQNQA 182

Query: 182 DADAYEDDLSEAINIQLDGEPSSCNC 207
           DADA+E+D ++AINIQLDGEPSSC+C
Sbjct: 183 DADAFEEDFNDAINIQLDGEPSSCSC 208

>KLTH0C11132g Chr3 complement(915337..915963) [627 bp, 208 aa] {ON}
           highly similar to uniprot|P32939 Saccharomyces
           cerevisiae YML001W YPT7 Gtp-binding protein of the rab
           family required for homotypic fusion event in vacuole
           inheritance for endosome-endosome fusion and for fusion
           of endosomes to vacuoles when expressed from high copy
           plasmid GTP-binding protein rab family
          Length = 208

 Score =  352 bits (903), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 168/206 (81%), Positives = 181/206 (87%)

Query: 2   SRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQV 61
           SRKKNILKVIILGDSGVGKTSLMHRYVNDK+SQQYKATIGADFLTKEV ++ DKVATMQV
Sbjct: 3   SRKKNILKVIILGDSGVGKTSLMHRYVNDKFSQQYKATIGADFLTKEVTMDGDKVATMQV 62

Query: 62  WDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFV 121
           WDTAGQERFQSLGVAFYRGADCCVLVYDVTN KSF+N+KSWRDEFLVHANVSSPETFPFV
Sbjct: 63  WDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFV 122

Query: 122 ILANXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQS 181
           IL N               AQ+ AKSLGN+PLF TSAK SINV  AFEEIAR+ALQQSQ+
Sbjct: 123 ILGNKLDVEESKKVVSNRSAQDMAKSLGNIPLFLTSAKGSINVDTAFEEIARNALQQSQA 182

Query: 182 DADAYEDDLSEAINIQLDGEPSSCNC 207
           DADA+EDD ++AINIQLDGEPSSC+C
Sbjct: 183 DADAFEDDFNDAINIQLDGEPSSCSC 208

>Kpol_1037.28 s1037 (68071..68697) [627 bp, 208 aa] {ON}
           (68071..68697) [627 nt, 209 aa]
          Length = 208

 Score =  352 bits (902), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 167/206 (81%), Positives = 181/206 (87%)

Query: 2   SRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQV 61
           SRKKNILKVI+LGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEV V+DDK ATMQV
Sbjct: 3   SRKKNILKVIVLGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDDKAATMQV 62

Query: 62  WDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFV 121
           WDTAGQERFQSLGVAFYRGADCCVLVYDVTN KSF+N+KSWRDEFL+HANVSSPETFPFV
Sbjct: 63  WDTAGQERFQSLGVAFYRGADCCVLVYDVTNSKSFENIKSWRDEFLIHANVSSPETFPFV 122

Query: 122 ILANXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQS 181
           IL N               AQE AK LG+VPLF TSAK++INV  AFEEIARSALQQ+Q+
Sbjct: 123 ILGNKIDVEDSKKIVTQKSAQELAKELGDVPLFLTSAKNAINVDQAFEEIARSALQQNQA 182

Query: 182 DADAYEDDLSEAINIQLDGEPSSCNC 207
           DADA+EDD ++AINIQLDGEPSSC+C
Sbjct: 183 DADAFEDDFNDAINIQLDGEPSSCSC 208

>ZYRO0C07700g Chr3 complement(584547..585170) [624 bp, 207 aa] {ON}
           highly similar to uniprot|P32939 Saccharomyces
           cerevisiae YML001W YPT7 Gtp-binding protein of the rab
           family required for homotypic fusion event in vacuole
           inheritance for endosome-endosome fusion and for fusion
           of endosomes to vacuoles when expressed from high copy
           plasmid GTP-binding protein rab family
          Length = 207

 Score =  350 bits (897), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 181/206 (87%), Gaps = 1/206 (0%)

Query: 2   SRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQV 61
           SRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEV V DDKVATMQV
Sbjct: 3   SRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTV-DDKVATMQV 61

Query: 62  WDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFV 121
           WDTAGQERFQSLGVAFYRGADCCVLVYDVTN KSF+N+KSWRDEFLVHANV SPETFPFV
Sbjct: 62  WDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVLSPETFPFV 121

Query: 122 ILANXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQS 181
           IL N               AQE AKSLGNVPLF TSAK++INV  AFEEIARSALQQ+Q+
Sbjct: 122 ILGNKVDVEESKKTVSVKSAQELAKSLGNVPLFLTSAKNAINVDTAFEEIARSALQQNQA 181

Query: 182 DADAYEDDLSEAINIQLDGEPSSCNC 207
           DADA+E+D ++AINIQLDGEPS+C+C
Sbjct: 182 DADAFEEDFNDAINIQLDGEPSACSC 207

>NDAI0D00840 Chr4 (189925..190551) [627 bp, 208 aa] {ON} Anc_6.24
          Length = 208

 Score =  349 bits (895), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 184/206 (89%)

Query: 2   SRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQV 61
           SRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEV ++DDK+ATMQV
Sbjct: 3   SRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKIATMQV 62

Query: 62  WDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFV 121
           WDTAGQERFQSLGVAFYRGADCCVLVYDVTN KSF+N+KSWRDEFL+HAN+S+PETFPFV
Sbjct: 63  WDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLIHANISTPETFPFV 122

Query: 122 ILANXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQS 181
           IL N               A E AKSLG++PLFFTSAKDSIN+++AFEEIARSALQQ+Q+
Sbjct: 123 ILGNKIDVEESKKIVSSNSATELAKSLGDIPLFFTSAKDSINIENAFEEIARSALQQNQN 182

Query: 182 DADAYEDDLSEAINIQLDGEPSSCNC 207
           D DA+++D ++AINI+LDGEP+SC+C
Sbjct: 183 DVDAFDEDFNDAINIRLDGEPNSCSC 208

>Kwal_56.22440 s56 (130574..131200) [627 bp, 208 aa] {ON} YML001W
           (YPT7) - GTP-binding protein, rab family [contig 185]
           FULL
          Length = 208

 Score =  348 bits (893), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 166/206 (80%), Positives = 181/206 (87%)

Query: 2   SRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQV 61
           +RKKNILKVIILGDSGVGKTSLMHRYV+DK+SQQYKATIGADFLTKEV ++ DKVATMQV
Sbjct: 3   ARKKNILKVIILGDSGVGKTSLMHRYVSDKFSQQYKATIGADFLTKEVSMDGDKVATMQV 62

Query: 62  WDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFV 121
           WDTAGQERFQSLGVAFYRGADCCVLVYDVTN KSF+N+KSWRDEFLVHANVSSPETFPFV
Sbjct: 63  WDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFV 122

Query: 122 ILANXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQS 181
           IL N               AQ+ AKSLGN+PLF TSAK SINV  AFEEIAR+ALQQSQ+
Sbjct: 123 ILGNKLDVEESKKVVSNRSAQDMAKSLGNIPLFLTSAKGSINVDTAFEEIARNALQQSQA 182

Query: 182 DADAYEDDLSEAINIQLDGEPSSCNC 207
           DADA+EDD ++AINIQLDGEPSSC+C
Sbjct: 183 DADAFEDDFNDAINIQLDGEPSSCSC 208

>KNAG0M01220 Chr13 (222591..223214) [624 bp, 207 aa] {ON} Anc_6.24
           YML001W
          Length = 207

 Score =  343 bits (879), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 165/205 (80%), Positives = 179/205 (87%), Gaps = 1/205 (0%)

Query: 3   RKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVW 62
           RKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEV V DDKVATMQVW
Sbjct: 4   RKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTV-DDKVATMQVW 62

Query: 63  DTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVI 122
           DTAGQERFQSLGVAFYRGADCCVLVYDVTN KSF+N+K+W+DEFLVHANVSSPETFPFVI
Sbjct: 63  DTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVI 122

Query: 123 LANXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQSD 182
           L N               AQE A SLGN+PLF TSAK +INV  AFEEIARSALQQ+Q+D
Sbjct: 123 LGNKVDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQNQND 182

Query: 183 ADAYEDDLSEAINIQLDGEPSSCNC 207
           ADA+E+D ++AINIQLDGEP+SC+C
Sbjct: 183 ADAFEEDFNDAINIQLDGEPNSCSC 207

>TBLA0A07180 Chr1 complement(1787774..1788400) [627 bp, 208 aa] {ON}
           Anc_6.24 YML001W
          Length = 208

 Score =  342 bits (878), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 162/206 (78%), Positives = 178/206 (86%)

Query: 2   SRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQV 61
           +RKK ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEV +++D  ATMQV
Sbjct: 3   TRKKQILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVAIDNDTTATMQV 62

Query: 62  WDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFV 121
           WDTAGQERFQSLGVAFYRGADCCVLVYDVTN KSF+N+KSWRDEFL+HANVSSPETFPFV
Sbjct: 63  WDTAGQERFQSLGVAFYRGADCCVLVYDVTNPKSFENIKSWRDEFLIHANVSSPETFPFV 122

Query: 122 ILANXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQS 181
           IL N               AQE +KSLGN+PLF TSAK+SINV  AFEEIAR AL+Q+++
Sbjct: 123 ILGNKVDTKDSKKSVTLKAAQELSKSLGNIPLFQTSAKNSINVDSAFEEIARGALEQNKA 182

Query: 182 DADAYEDDLSEAINIQLDGEPSSCNC 207
           DADAYEDD ++AINIQLDGEPSSC C
Sbjct: 183 DADAYEDDFNDAINIQLDGEPSSCAC 208

>Smik_13.158 Chr13 (258333..258959) [627 bp, 208 aa] {ON} YML001W
           (REAL)
          Length = 208

 Score =  341 bits (875), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 179/206 (86%)

Query: 2   SRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQV 61
           SRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEV V+ DKVATMQV
Sbjct: 3   SRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDGDKVATMQV 62

Query: 62  WDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFV 121
           WDTAGQERFQSLGVAFYRGADCCVLVYDVTN  SF+N+KSWRDEFLVHANVSSPETFPFV
Sbjct: 63  WDTAGQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVSSPETFPFV 122

Query: 122 ILANXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQS 181
           IL N               AQE AKSLG++PLF TSAK++INV  AFEEIARSALQQ+Q+
Sbjct: 123 ILGNKIDAEESKKVVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQNQA 182

Query: 182 DADAYEDDLSEAINIQLDGEPSSCNC 207
           D +A+EDD ++AINI+LDGE +SC+C
Sbjct: 183 DTEAFEDDYNDAINIRLDGENNSCSC 208

>YML001W Chr13 (267174..267800) [627 bp, 208 aa] {ON}  YPT7Rab
           family GTPase; GTP-binding protein of the rab family;
           required for homotypic fusion event in vacuole
           inheritance, for endosome-endosome fusion, similar to
           mammalian Rab7
          Length = 208

 Score =  340 bits (871), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 162/206 (78%), Positives = 179/206 (86%)

Query: 2   SRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQV 61
           SRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEV V+ DKVATMQV
Sbjct: 3   SRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDGDKVATMQV 62

Query: 62  WDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFV 121
           WDTAGQERFQSLGVAFYRGADCCVLVYDVTN  SF+N+KSWRDEFLVHANV+SPETFPFV
Sbjct: 63  WDTAGQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFPFV 122

Query: 122 ILANXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQS 181
           IL N               AQE AKSLG++PLF TSAK++INV  AFEEIARSALQQ+Q+
Sbjct: 123 ILGNKIDAEESKKIVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQNQA 182

Query: 182 DADAYEDDLSEAINIQLDGEPSSCNC 207
           D +A+EDD ++AINI+LDGE +SC+C
Sbjct: 183 DTEAFEDDYNDAINIRLDGENNSCSC 208

>Suva_13.161 Chr13 (257150..257776) [627 bp, 208 aa] {ON} YML001W
           (REAL)
          Length = 208

 Score =  340 bits (871), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 162/206 (78%), Positives = 179/206 (86%)

Query: 2   SRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQV 61
           SRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEV V+ DKVATMQV
Sbjct: 3   SRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDGDKVATMQV 62

Query: 62  WDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFV 121
           WDTAGQERFQSLGVAFYRGADCCVLVYDVTN  SF+N+KSWRDEFLVHANV+SPETFPFV
Sbjct: 63  WDTAGQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFPFV 122

Query: 122 ILANXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQS 181
           IL N               AQE AKSLG++PLF TSAK++INV  AFEEIARSALQQ+Q+
Sbjct: 123 ILGNKIDAEESKKVVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQNQA 182

Query: 182 DADAYEDDLSEAINIQLDGEPSSCNC 207
           D +A+EDD ++AINI+LDGE +SC+C
Sbjct: 183 DTEAFEDDYNDAINIRLDGENNSCSC 208

>Skud_13.153 Chr13 (253075..253701) [627 bp, 208 aa] {ON} YML001W
           (REAL)
          Length = 208

 Score =  340 bits (871), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 162/206 (78%), Positives = 179/206 (86%)

Query: 2   SRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQV 61
           SRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEV V+ DKVATMQV
Sbjct: 3   SRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDGDKVATMQV 62

Query: 62  WDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFV 121
           WDTAGQERFQSLGVAFYRGADCCVLVYDVTN  SF+N+KSWRDEFLVHANV+SPETFPFV
Sbjct: 63  WDTAGQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFPFV 122

Query: 122 ILANXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQS 181
           IL N               AQE AKSLG++PLF TSAK++INV  AFEEIARSALQQ+Q+
Sbjct: 123 ILGNKIDAEESKKVVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQNQA 182

Query: 182 DADAYEDDLSEAINIQLDGEPSSCNC 207
           D +A+EDD ++AINI+LDGE +SC+C
Sbjct: 183 DTEAFEDDYNDAINIRLDGENNSCSC 208

>CAGL0E02607g Chr5 complement(248998..249624) [627 bp, 208 aa] {ON}
           highly similar to uniprot|P32939 Saccharomyces
           cerevisiae YML001w YPT7 GTP-binding protein of the RAB
           family
          Length = 208

 Score =  338 bits (867), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 159/207 (76%), Positives = 180/207 (86%)

Query: 1   MSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQ 60
           ++RKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEV+++DDKV TMQ
Sbjct: 2   IARKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQ 61

Query: 61  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPF 120
           VWDTAGQERFQSLGVAFYRGADCCVLVYDVTN KSF+N+KSW+DEFLVHAN+SSPE+FPF
Sbjct: 62  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPF 121

Query: 121 VILANXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQ 180
           VIL N                QE AKSLG+VPLF TSAK +INV  AFEEIA+SALQQ+Q
Sbjct: 122 VILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQ 181

Query: 181 SDADAYEDDLSEAINIQLDGEPSSCNC 207
           +DA A+EDD ++AINIQL+GE +SC+C
Sbjct: 182 NDAHAFEDDFNDAINIQLEGESNSCSC 208

>KAFR0G02670 Chr7 complement(552130..552756) [627 bp, 208 aa] {ON}
           Anc_6.24 YML001W
          Length = 208

 Score =  335 bits (860), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 176/206 (85%)

Query: 2   SRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQV 61
           S+KK ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKE+ V+ D+ ATMQV
Sbjct: 3   SKKKTILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEINVDGDRTATMQV 62

Query: 62  WDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFV 121
           WDTAGQERFQSLGVAFYRGADCCVLVYDVTN KSF+N+KSWRDEFLVHANVSSPE+FPFV
Sbjct: 63  WDTAGQERFQSLGVAFYRGADCCVLVYDVTNTKSFENIKSWRDEFLVHANVSSPESFPFV 122

Query: 122 ILANXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQS 181
           IL N               AQ+ AKSLGN+PLF TSAK SINV  AFEEIARSALQQ+Q+
Sbjct: 123 ILGNKIDIEETKKVISVKSAQDLAKSLGNIPLFLTSAKSSINVDPAFEEIARSALQQNQN 182

Query: 182 DADAYEDDLSEAINIQLDGEPSSCNC 207
           DADA+E+D ++AINIQLDGE  SC C
Sbjct: 183 DADAFEEDFNDAINIQLDGEADSCAC 208

>NCAS0H00850 Chr8 (155266..155892) [627 bp, 208 aa] {ON} Anc_6.24
          Length = 208

 Score =  334 bits (857), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 182/206 (88%)

Query: 2   SRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQV 61
           SRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEV ++DDKVATMQV
Sbjct: 3   SRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQV 62

Query: 62  WDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFV 121
           WDTAGQERFQSLGVAFYRGADCCVLVYDVTN KSF+N+KSWRDEFLVHANVSSPETFPFV
Sbjct: 63  WDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFV 122

Query: 122 ILANXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQS 181
           IL N               AQE AKSLGN PLF TSAKDSIN+ +AFEEIARSALQQ+QS
Sbjct: 123 ILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQNQS 182

Query: 182 DADAYEDDLSEAINIQLDGEPSSCNC 207
           DADA++DD ++AINIQLD EP+SC+C
Sbjct: 183 DADAFDDDFNDAINIQLDDEPNSCSC 208

>TPHA0J00360 Chr10 (80553..81182) [630 bp, 209 aa] {ON} Anc_6.24
           YML001W
          Length = 209

 Score =  333 bits (854), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 160/207 (77%), Positives = 175/207 (84%), Gaps = 1/207 (0%)

Query: 2   SRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVND-DKVATMQ 60
           SRKKN+LKVI+LGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEV+++D  + ATMQ
Sbjct: 3   SRKKNLLKVIVLGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVIDDGSQAATMQ 62

Query: 61  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPF 120
           VWDTAGQERFQSLGVAFYRGADCCVLVYDVTN KSFDN+KSWRDEFL+HANVSSPETFPF
Sbjct: 63  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNPKSFDNIKSWRDEFLIHANVSSPETFPF 122

Query: 121 VILANXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQ 180
           VIL N                QE AK LGN+PLF TSAKDSINV  AFEEI R ALQQ+Q
Sbjct: 123 VILGNKIDIEDSKQKISAKQGQEMAKELGNIPLFLTSAKDSINVDVAFEEITRGALQQNQ 182

Query: 181 SDADAYEDDLSEAINIQLDGEPSSCNC 207
           +DADA++DD ++AINIQLD E SSC C
Sbjct: 183 NDADAFKDDFNDAINIQLDDESSSCAC 209

>KNAG0D02650 Chr4 (474662..475297) [636 bp, 211 aa] {ON} Anc_8.70
           YFL005W
          Length = 211

 Score =  133 bits (334), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 118/209 (56%), Gaps = 18/209 (8%)

Query: 6   NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTA 65
           +I+KV+++GDSGVGK+ L+ R+V DK+S  +  TIG DF  K V +N  K+  +Q+WDTA
Sbjct: 13  SIMKVLLIGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKTVDINGKKIK-LQLWDTA 71

Query: 66  GQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILAN 125
           GQERF+++  A+YRGA   +LVYDVT+ ++F+NVK+W      HA     +    +++ N
Sbjct: 72  GQERFRTITTAYYRGAMGIILVYDVTDERTFENVKNWFKTVSDHA----TDDAQLLLVGN 127

Query: 126 XXXXXXXXXXXXXXXAQEQAKSLG---NVPLFFTSAKDSINVQDAFEEIAR----SALQQ 178
                            EQ ++LG    +P    SAKD  NV + F  +A+        Q
Sbjct: 128 ------KCDMDTRLVTHEQGEALGKELGIPFVEASAKDDTNVNEVFFTLAKLIQGRLDSQ 181

Query: 179 SQSDADAYEDDLSEAINIQLDGEPSSCNC 207
           S +D+ A   +    +NI  +G+ SS NC
Sbjct: 182 SAADSTAGRGNSKGGVNINENGKKSSSNC 210

>Kwal_23.5058 s23 (989533..990174) [642 bp, 213 aa] {ON} YFL005W
           (SEC4) - Ras-like small GTP-binding protein [contig 7]
           FULL
          Length = 213

 Score =  128 bits (322), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 74/202 (36%), Positives = 112/202 (55%), Gaps = 8/202 (3%)

Query: 6   NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTA 65
           +I+K++++GDSGVGK+ L+ R+V DK+S  +  TIG DF  K V +N  KV  +Q+WDTA
Sbjct: 19  SIMKILLVGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKTVDINGKKVK-LQLWDTA 77

Query: 66  GQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILAN 125
           GQERF+++  A+YRGA   +LVYDVT+ ++F NVK W      HAN    +    +++ N
Sbjct: 78  GQERFRTITTAYYRGAMGIILVYDVTDERTFANVKQWFSTVNQHAN----DEAQLLLVGN 133

Query: 126 XXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQSDADA 185
                           +  AK LG +P    SAKD  NV D F ++A+   ++  S+   
Sbjct: 134 --KSDMDTRAVSTDQGESLAKELG-IPFVEASAKDDTNVNDIFFQLAKLIQEKIDSEKLV 190

Query: 186 YEDDLSEAINIQLDGEPSSCNC 207
                  ++N+   G  +  NC
Sbjct: 191 GNTGRDGSVNVGAGGNNAKSNC 212

>AGL021W Chr7 (681754..682392) [639 bp, 212 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFL005W (SEC4)
          Length = 212

 Score =  127 bits (320), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 74/202 (36%), Positives = 111/202 (54%), Gaps = 8/202 (3%)

Query: 6   NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTA 65
           +I+K++++GDSGVGK+ L+ R+V DK+S  +  TIG DF  K V +N  K+  +Q+WDTA
Sbjct: 18  SIMKILLVGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKAVDINGKKIK-LQLWDTA 76

Query: 66  GQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILAN 125
           GQERF+++  A+YRGA   +LVYDVT+ ++F+N++ W      HAN    E    +++ N
Sbjct: 77  GQERFRTITTAYYRGAMGIILVYDVTDERTFENIRQWFTTVNQHAN----EEAQLLLVGN 132

Query: 126 XXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQSDADA 185
                           +  AK LG VP    SAKD  NV D F  +A+   ++  +D   
Sbjct: 133 --KKDMDTRAVTYEQGESLAKELG-VPFIEASAKDDENVSDIFFTLAKLIQEKIDNDKLV 189

Query: 186 YEDDLSEAINIQLDGEPSSCNC 207
                  ++NI       S NC
Sbjct: 190 NNSGREGSVNISSGSNMPSSNC 211

>KLTH0A02662g Chr1 complement(226313..226954) [642 bp, 213 aa] {ON}
           highly similar to uniprot|P07560 Saccharomyces
           cerevisiae YFL005W SEC4 Secretory vesicle-associated Rab
           GTPase essential for exocytosis associates with the
           exocyst component Sec15p and may regulate polarized
           delivery of transport vesicles to the exocyst at the
           plasma membrane
          Length = 213

 Score =  127 bits (320), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 75/202 (37%), Positives = 111/202 (54%), Gaps = 8/202 (3%)

Query: 6   NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTA 65
           +I+K++++GDSGVGK+ L+ R+V DK+S  +  TIG DF  K V +N  KV  +Q+WDTA
Sbjct: 19  SIMKILLVGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKTVDINGKKVK-LQLWDTA 77

Query: 66  GQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILAN 125
           GQERF+++  A+YRGA   +LVYDVT+ ++F N+K W      HAN    +    +++ N
Sbjct: 78  GQERFRTITTAYYRGAMGIILVYDVTDERTFSNIKQWFSTVNQHAN----DEAQLLLVGN 133

Query: 126 XXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQSDADA 185
                          A   AK LG +P    SAKD  NV D F  +A+   ++  S+   
Sbjct: 134 KSDMDTRAVSTDQGEA--LAKELG-IPFVEASAKDDTNVNDIFFLLAKLIQEKIDSEKLV 190

Query: 186 YEDDLSEAINIQLDGEPSSCNC 207
                  ++N+   G  S  NC
Sbjct: 191 GNTGRDGSVNVGAAGNNSKSNC 212

>Ecym_1518 Chr1 (1069582..1070196) [615 bp, 204 aa] {ON} similar to
           Ashbya gossypii ABR220W
          Length = 204

 Score =  125 bits (314), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 74/203 (36%), Positives = 114/203 (56%), Gaps = 11/203 (5%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           + K++++GDSGVGK+ L+ R+ +D Y+  Y +TIG DF  K V + D K   +Q+WDTAG
Sbjct: 8   LFKLLLIGDSGVGKSCLLLRFADDTYTNDYISTIGVDFKIKTVEL-DGKTVKLQIWDTAG 66

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANX 126
           QERF+++  ++YRGA   ++VYDVT+ +SF+NVK+W  E   +      +     +L   
Sbjct: 67  QERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKTWLQEIDRYGTAGVVK-----LLVGN 121

Query: 127 XXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQ-QSQSDADA 185
                         A+E A SL ++P+  TSA DS NV++AF  +AR   +  S    D 
Sbjct: 122 KNDLKDKKVVDFEVAKEFADSL-SIPVLETSALDSSNVEEAFLTMARQIKETMSHQQKDT 180

Query: 186 YEDDLSEAINIQ---LDGEPSSC 205
            + D    +N++   L G  S C
Sbjct: 181 GKKDDKSGVNLKGQSLTGSSSGC 203

>SAKL0B01012g Chr2 complement(92466..93080) [615 bp, 204 aa] {ON}
           highly similar to uniprot|P01123 Saccharomyces
           cerevisiae YFL038C YPT1 Ras-like small GTPase involved
           in the ER-to-Golgi step of the secretory pathway complex
           formation with the Rab escort protein Mrs6p is required
           for prenylation of Ypt1p by protein
           geranylgeranyltransferase type II (Bet2p-Bet4p)
          Length = 204

 Score =  125 bits (313), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 75/205 (36%), Positives = 114/205 (55%), Gaps = 15/205 (7%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           + K++++GDSGVGK+ L+ R+ +D Y+  Y +TIG DF  K V + D K   +Q+WDTAG
Sbjct: 8   LFKLLLIGDSGVGKSCLLLRFADDTYTNDYISTIGVDFKIKTVDL-DGKTVKLQIWDTAG 66

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANX 126
           QERF+++  ++YRGA   ++VYDVT+ +SF+NVK+W  E   +            +L   
Sbjct: 67  QERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKTWLQEIDRYGTAG-----VLKLLVGN 121

Query: 127 XXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIAR---SALQQSQSDA 183
                         A+E A SL  +P+  TSA DS NV++AF  +AR    ++ Q Q D 
Sbjct: 122 KNDLTDKKVVEYEVAKEFADSL-QIPVLETSALDSSNVEEAFLTMARQIKESMSQQQRDN 180

Query: 184 DAYEDDLSEAINIQ---LDGEPSSC 205
              E+     +N++   L G  S C
Sbjct: 181 GKKEE--KAGVNLKGQSLTGTSSGC 203

>NCAS0J00630 Chr10 complement(95335..95991) [657 bp, 218 aa] {ON}
           Anc_8.70
          Length = 218

 Score =  124 bits (312), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 115/202 (56%), Gaps = 13/202 (6%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           ++K++++GDSGVGK+ L+ R+V +K++  +  TIG DF  K + +   K+  +Q+WDTAG
Sbjct: 26  VMKILLIGDSGVGKSCLLVRFVENKFNPSFITTIGIDFKIKTLDIQGRKIK-LQLWDTAG 84

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANX 126
           QERF+++  A+YRGA   +LVYDVT+ ++F N++ W      HAN    E    +++ N 
Sbjct: 85  QERFRTITTAYYRGAMGIILVYDVTDERTFQNIRQWYSTVNEHAN----EQVQLLLVGN- 139

Query: 127 XXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQSDADAY 186
                          +E A+ LG +P    SAK+  NV D F ++A+  L Q + D D  
Sbjct: 140 -KSDLGNRQVTKEQGEELARELG-LPFMEASAKNDDNVNDLFLQLAK--LIQEKIDNDEM 195

Query: 187 EDDLSEAINIQL---DGEPSSC 205
            +  +   N+ +   DG+ SSC
Sbjct: 196 GEPRTAKKNVNIKSKDGKTSSC 217

>SAKL0B02332g Chr2 (227078..227719) [642 bp, 213 aa] {ON} highly
           similar to uniprot|P07560 Saccharomyces cerevisiae
           YFL005W SEC4 Secretory vesicle-associated Rab GTPase
           essential for exocytosis associates with the exocyst
           component Sec15p and may regulate polarized delivery of
           transport vesicles to the exocyst at the plasma membrane
          Length = 213

 Score =  124 bits (312), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 72/201 (35%), Positives = 112/201 (55%), Gaps = 8/201 (3%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           I+K++++GDSGVGK+ L+ R+V DK+S  +  TIG DF  K V +N  K+  +Q+WDTAG
Sbjct: 20  IMKILLVGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKTVDINGKKIK-LQLWDTAG 78

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANX 126
           QERF+++  A+YRGA   +LVYDVT+ ++F N+K W      HAN    +    +++ N 
Sbjct: 79  QERFRTITTAYYRGAMGIILVYDVTDERTFSNIKQWLSTVNQHAN----DEAQLLLVGNK 134

Query: 127 XXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQSDADAY 186
                         A   +K LG +P    SAK+  NV + F  +A+   ++  +D    
Sbjct: 135 SDMDTRAVTYEQGEA--LSKELG-LPFVEASAKNDDNVNEIFFTLAKLIQEKIDNDKLVG 191

Query: 187 EDDLSEAINIQLDGEPSSCNC 207
             +   ++NI  +G  S  NC
Sbjct: 192 NTNKDGSVNINSNGGGSKSNC 212

>ABR220W Chr2 (817292..817906) [615 bp, 204 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFL038C (YPT1)
          Length = 204

 Score =  124 bits (310), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 101/167 (60%), Gaps = 7/167 (4%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           + K++++GDSGVGK+ L+ R+ +D Y+  Y +TIG DF  K V + D K   +Q+WDTAG
Sbjct: 8   LFKLLLIGDSGVGKSCLLLRFADDTYTNDYISTIGVDFKIKTVEL-DGKTVKLQIWDTAG 66

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANX 126
           QERF+++  ++YRGA   ++VYDVT+ +SFDN+K+W  E   +      +     +L   
Sbjct: 67  QERFRTITSSYYRGAHGIIIVYDVTDQESFDNMKTWLQEIDRYGTAGVVK-----LLVGN 121

Query: 127 XXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIAR 173
                         A+E A SL N+P+  TSA DS NV++AF  +AR
Sbjct: 122 KNDLKDKKVVDFEVAREFADSL-NIPVLETSALDSSNVEEAFLTMAR 167

>KAFR0B01660 Chr2 complement(318959..319579) [621 bp, 206 aa] {ON}
           Anc_8.70 YFL005W
          Length = 206

 Score =  122 bits (306), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 106/182 (58%), Gaps = 10/182 (5%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           I+K++++GDSGVGK+ L+ R+V DK+S  +  TIG DF  K V +N  KV  +Q+WDTAG
Sbjct: 11  IMKILLIGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKTVDINGKKVK-LQLWDTAG 69

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANX 126
           QERF+++  A+YRGA   +LVYDVT+ ++F N+K W      HAN    +    +++ N 
Sbjct: 70  QERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNDHAN----DDAQLLLVGNK 125

Query: 127 XXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQSDADAY 186
                         A   AK LG +P   +SAKD  NV + F  +AR  L Q + D++  
Sbjct: 126 SDMDTRLVTYEQGEA--LAKELG-LPFVESSAKDDQNVNEIFFTLAR--LIQDKIDSNKL 180

Query: 187 ED 188
            D
Sbjct: 181 SD 182

>Kpol_1011.3 s1011 complement(4828..5472) [645 bp, 214 aa] {ON}
           complement(4828..5472) [645 nt, 215 aa]
          Length = 214

 Score =  122 bits (306), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 67/178 (37%), Positives = 107/178 (60%), Gaps = 10/178 (5%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           I+K++++GDSGVGK+ L+ R+V+DK++  +  TIG DF  K V +N  K+  +Q+WDTAG
Sbjct: 19  IMKILLIGDSGVGKSCLLVRFVDDKFNPSFITTIGIDFKIKTVEINGKKIK-LQLWDTAG 77

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANX 126
           QERF+++  A+YRGA   +LVYDVT+ K+F N++ W      HAN    +    +++ N 
Sbjct: 78  QERFRTITTAYYRGAMGIILVYDVTDEKTFANIRQWFKTVTEHAN----DEAQLLLVGN- 132

Query: 127 XXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQSDAD 184
                          +E +K LG +P   +SAK+  NV + F  +A+  L Q + D++
Sbjct: 133 -KSDMDTRAVTYEQGEELSKELG-IPFIESSAKNDENVNEIFSTLAK--LIQEKIDSN 186

>KAFR0C03330 Chr3 (679443..680075) [633 bp, 210 aa] {ON} Anc_8.70
           YFL005W
          Length = 210

 Score =  122 bits (305), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 71/178 (39%), Positives = 105/178 (58%), Gaps = 10/178 (5%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           I+K++++GDSGVGK+ L+ R+V DK+S  +  TIG DF  K V +N  K+  +Q+WDTAG
Sbjct: 16  IMKILLIGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKTVEINGKKIK-LQLWDTAG 74

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANX 126
           QERF+++  A+YRGA   +LVYDVT+ K+F N+  W      HAN    +    +++ N 
Sbjct: 75  QERFRTITTAYYRGAMGIILVYDVTDEKTFANINKWFKTVTEHAN----DDAQLLLVGN- 129

Query: 127 XXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQSDAD 184
                          +  AK LG +P   +SAKD+ NV D F  +A+  L Q + DA+
Sbjct: 130 -KNDMDTRVVSCEQGEVLAKELG-LPFVESSAKDNNNVSDIFLSLAK--LIQDKIDAN 183

>KLLA0E12079g Chr5 (1075299..1075943) [645 bp, 214 aa] {ON} highly
           similar to uniprot|P07560 Saccharomyces cerevisiae
           YFL005W SEC4 Secretory vesicle-associated Rab GTPase
           essential for exocytosis associates with the exocyst
           component Sec15p and may regulate polarized delivery of
           transport vesicles to the exocyst at the plasma membrane
          Length = 214

 Score =  120 bits (301), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 109/193 (56%), Gaps = 10/193 (5%)

Query: 6   NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTA 65
           +++K+++LGDSGVGK+ L+ R+V DK++  +  TIG DF  K V +N  +V  +Q+WDTA
Sbjct: 19  SVMKILLLGDSGVGKSCLLVRFVEDKFTPTFITTIGIDFKIKTVDINGKRVK-LQLWDTA 77

Query: 66  GQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILAN 125
           GQERF+++  A+YRGA   VL+YDVT+ ++F+N++ W      HA+    E    +++ N
Sbjct: 78  GQERFRTITTAYYRGAMGIVLIYDVTDERTFENIRQWFSTVNQHAS----EDVVMLLVGN 133

Query: 126 XXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQSDADA 185
                          A   AK LG +P    SAKD  NV + F  +A+  L Q + D   
Sbjct: 134 KKDMDTRTVSYEQGEA--LAKELG-IPFIEASAKDDTNVSEIFFTLAK--LIQEKIDDGK 188

Query: 186 YEDDLSEAINIQL 198
            E    +  N+ +
Sbjct: 189 MEGKAEKEGNVSI 201

>NCAS0C04020 Chr3 (817944..818576) [633 bp, 210 aa] {ON} Anc_1.215
           YKR055W
          Length = 210

 Score =  120 bits (301), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 115/204 (56%), Gaps = 15/204 (7%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           I+K++++GDSGVGK+ L+ R+V DK++  +  TIG DF  K V +N  KV  +Q+WDTAG
Sbjct: 16  IMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVK-LQLWDTAG 74

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANX 126
           QERF+++  A+YRGA   +LVYDVT+ ++F NVK W      HAN    +    +++ N 
Sbjct: 75  QERFRTITTAYYRGAMGIILVYDVTDERTFSNVKQWFKTVNEHAN----DEAQLLLVGN- 129

Query: 127 XXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQSDADAY 186
                          +  AK LG +P   +SAK+  NV + F  +A+  L Q + D++  
Sbjct: 130 -KSDMDTRVVTYEQGESLAKELG-LPFIESSAKNDDNVNEIFFTLAK--LIQEKIDSNKL 185

Query: 187 E-----DDLSEAINIQLDGEPSSC 205
                  D + +IN +  G  S+C
Sbjct: 186 AGPGNGKDANISINAKDGGSKSNC 209

>CAGL0F02123g Chr6 (212117..212764) [648 bp, 215 aa] {ON} highly
           similar to uniprot|P07560 Saccharomyces cerevisiae
           YFL005w SEC4
          Length = 215

 Score =  120 bits (300), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 77/205 (37%), Positives = 116/205 (56%), Gaps = 14/205 (6%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           I+K++++GDSGVGK+ L+ R+V DK++  +  TIG DF  K V +N  KV  +Q+WDTAG
Sbjct: 20  IMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVK-LQLWDTAG 78

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANX 126
           QERF+++  A+YRGA   +LVYDVT+ ++F N+K W      HAN    +    +++ N 
Sbjct: 79  QERFRTITTAYYRGAMGIILVYDVTDERTFANIKQWFKTVNEHAN----DEAQLLLVGNK 134

Query: 127 XXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQSDADAY 186
                         A   AK LG +P   +SAK+  NV + F  +AR  L Q + D++  
Sbjct: 135 SDMDTRVVTYEQGEA--LAKELG-LPFIESSAKNDDNVNEIFFTLAR--LIQEKIDSNKL 189

Query: 187 EDDLS-EAINIQLD---GEPSSCNC 207
               S +  NI ++   G+ S  NC
Sbjct: 190 SGPNSGKDGNISINANKGDSSKSNC 214

>KLLA0D05313g Chr4 (459496..460110) [615 bp, 204 aa] {ON} highly
           similar to uniprot|P01123 Saccharomyces cerevisiae
           YFL038C YPT1 Ras-like small GTPase involved in the
           ER-to-Golgi step of the secretory pathway complex
           formation with the Rab escort protein Mrs6p is required
           for prenylation of Ypt1p by protein
           geranylgeranyltransferase type II (Bet2p-Bet4p)
          Length = 204

 Score =  119 bits (299), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 71/200 (35%), Positives = 111/200 (55%), Gaps = 16/200 (8%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           + K++++GDSGVGK+ L+ R+ +D Y+  Y +TIG DF  K V + D K   +Q+WDTAG
Sbjct: 8   LFKLLLIGDSGVGKSCLLLRFADDTYTNDYISTIGVDFKIKTVEL-DGKTVKLQIWDTAG 66

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANX 126
           QERF+++  ++YRGA   ++VYDVT+ +SF+NVK+W  E          +     +L   
Sbjct: 67  QERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKTWLQEIDRFGTAGVLK-----LLVGN 121

Query: 127 XXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAF----EEIARSALQQSQSD 182
                         A+E A S+G +P   TSA DS NV++AF    ++I  S  +Q + +
Sbjct: 122 KNDLTDKKVVDTEVAKEFADSIG-IPFIETSALDSSNVEEAFLIMTKQIKESVAKQQKDN 180

Query: 183 ADAYEDDLSEAINIQLDGEP 202
             A      +  N+ L G+ 
Sbjct: 181 GRA-----EDKSNVNLKGQS 195

>Suva_6.54 Chr6 (102191..102838) [648 bp, 215 aa] {ON} YFL005W
           (REAL)
          Length = 215

 Score =  119 bits (299), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 106/179 (59%), Gaps = 10/179 (5%)

Query: 6   NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTA 65
           +I+K++++GDSGVGK+ L+ R+V DK++  +  TIG DF  K V +N  KV  +Q+WDTA
Sbjct: 19  SIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVK-LQLWDTA 77

Query: 66  GQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILAN 125
           GQERF+++  A+YRGA   +LVYDVT+ ++F N+K W      HAN    +    +++ N
Sbjct: 78  GQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHAN----DEAQLLLVGN 133

Query: 126 XXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQSDAD 184
                          A   AK LG +P   +SAK+  NV + F  +AR  L Q + D++
Sbjct: 134 KSDMDTRVVTADQGEA--LAKELG-IPFIESSAKNDDNVNEIFFTLAR--LIQEKIDSN 187

>TBLA0D02650 Chr4 (655924..656577) [654 bp, 217 aa] {ON} Anc_8.70
           YFL005W
          Length = 217

 Score =  119 bits (298), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 98/162 (60%), Gaps = 8/162 (4%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           I+K++++GDSGVGK+ L+ R+V+DK++  +  TIG DF  K + +N  K+  +Q+WDTAG
Sbjct: 20  IMKILLIGDSGVGKSCLLVRFVDDKFNPSFITTIGIDFKIKTIDINGKKIK-LQLWDTAG 78

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANX 126
           QERF+++  A+YRGA   +LVYDVT+  +F+N+++W      HAN  +      +++ N 
Sbjct: 79  QERFRTITTAYYRGAMGIILVYDVTDENTFENIRTWFKTVNEHANGEA----QLLLVGN- 133

Query: 127 XXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAF 168
                          +  AK LG +P   +SAKD  NV + F
Sbjct: 134 -KSDMETRTVTYEQGESLAKELG-IPFIESSAKDDKNVNEIF 173

>Ecym_7305 Chr7 (650045..650686) [642 bp, 213 aa] {ON} similar to
           Ashbya gossypii AGL021W
          Length = 213

 Score =  119 bits (298), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 67/168 (39%), Positives = 97/168 (57%), Gaps = 8/168 (4%)

Query: 6   NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTA 65
           +I+KV+++GDSGVGK+ L+ R+V DK+S  +  TIG DF  K V ++  K+  +Q+WDTA
Sbjct: 19  SIMKVLLVGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKTVDIDGKKIK-LQLWDTA 77

Query: 66  GQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILAN 125
           GQERF+++  A+YRGA   +LVYDVT+ ++F+N++ W      HA   +       IL  
Sbjct: 78  GQERFRTITTAYYRGAMGIILVYDVTDERTFENIRQWFSTVNQHATEDAQ------ILLV 131

Query: 126 XXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIAR 173
                           +  AK LG VP    SAKD  NV D F  +A+
Sbjct: 132 GNKKDMDTRAVTYEQGESLAKELG-VPFIEASAKDDENVSDIFFTLAK 178

>NDAI0G03340 Chr7 (792718..793341) [624 bp, 207 aa] {ON} Anc_8.70
          Length = 207

 Score =  119 bits (297), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 69/179 (38%), Positives = 106/179 (59%), Gaps = 10/179 (5%)

Query: 6   NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTA 65
           +I+K++++GDSGVGK+ L+ R+V DK++  +  TIG DF  K V +N  KV  +Q+WDTA
Sbjct: 12  SIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVK-LQLWDTA 70

Query: 66  GQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILAN 125
           GQERF+++  A+YRGA   +LVYDVT+ ++F N+K W      HAN    +    +++ N
Sbjct: 71  GQERFRTITTAYYRGAMGIILVYDVTDERTFSNIKQWFKTVNEHAN----DEAQLLLVGN 126

Query: 126 XXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQSDAD 184
                           +  AK LG +P   +SAK+  NV + F  +A+  L Q + DA+
Sbjct: 127 --KSDMDTRVVTYEQGESLAKELG-LPFVESSAKNDDNVNEIFFTLAK--LIQEKIDAN 180

>KAFR0C03580 Chr3 (733658..734296) [639 bp, 212 aa] {ON} Anc_8.25
           YFL038C
          Length = 212

 Score =  118 bits (296), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 72/211 (34%), Positives = 119/211 (56%), Gaps = 17/211 (8%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K + + D K   +Q+WDTAG
Sbjct: 8   LFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTIEL-DGKTVKLQIWDTAG 66

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANX 126
           QERF+++  ++YRG+   ++VYDVT+ +SF+ VK W  E   +A  +        +L   
Sbjct: 67  QERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSA-----VLKLLVGN 121

Query: 127 XXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQ-------QS 179
                         A+E A+S  N+P   TSA DS NV++AF  +AR   +       Q 
Sbjct: 122 KCDLDGKRMVEYDVAKEFAES-NNMPFLETSALDSTNVEEAFLTMARQIKESFAQQKIQD 180

Query: 180 QSDADAYEDDLSEAINIQLDGEP---SSCNC 207
            S+A+A  +  ++  N+ L+G+    ++ NC
Sbjct: 181 GSNANANSNLQNDKSNVNLNGQSLTNATNNC 211

>YFL005W Chr6 (130334..130981) [648 bp, 215 aa] {ON}  SEC4Rab family
           GTPase essential for vesicle-mediated exocytic secretion
           and autophagy; associates with the exocyst component
           Sec15p and may regulate polarized delivery of transport
           vesicles to the exocyst at the plasma membrane
          Length = 215

 Score =  118 bits (296), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 69/179 (38%), Positives = 106/179 (59%), Gaps = 10/179 (5%)

Query: 6   NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTA 65
           +I+K++++GDSGVGK+ L+ R+V DK++  +  TIG DF  K V +N  KV  +Q+WDTA
Sbjct: 19  SIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVK-LQLWDTA 77

Query: 66  GQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILAN 125
           GQERF+++  A+YRGA   +LVYDVT+ ++F N+K W      HAN    +    +++ N
Sbjct: 78  GQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHAN----DEAQLLLVGN 133

Query: 126 XXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQSDAD 184
                          A   AK LG +P   +SAK+  NV + F  +A+  L Q + D++
Sbjct: 134 KSDMETRVVTADQGEA--LAKELG-IPFIESSAKNDDNVNEIFFTLAK--LIQEKIDSN 187

>TBLA0C00450 Chr3 complement(84352..84984) [633 bp, 210 aa] {ON}
           Anc_8.25 YFL038C
          Length = 210

 Score =  118 bits (295), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 104/179 (58%), Gaps = 10/179 (5%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           + K++++G+SGVGK+ L+ R+ +D YS  Y +TIG DF  K + + D K   +Q+WDTAG
Sbjct: 8   LFKLLLIGNSGVGKSCLLLRFSDDTYSNDYISTIGVDFKIKTIEI-DGKTVKLQIWDTAG 66

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANX 126
           QERF+++  ++YRG+   ++VYDVT+  SF++VK W  E   +A  S        +L   
Sbjct: 67  QERFRTITSSYYRGSHGIIIVYDVTDQDSFNSVKMWLQEIDRYATSS-----VLKLLVGN 121

Query: 127 XXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIA---RSALQQSQSD 182
                         A+E A++  N+P   TSA DS NV++AF  +A   + +L Q Q D
Sbjct: 122 KSDLKDKRIVEYDVAKEFAET-NNMPFLETSALDSTNVEEAFLTMAKQIKESLSQQQKD 179

>KNAG0G00930 Chr7 (183672..184313) [642 bp, 213 aa] {ON} Anc_8.70
           YFL005W
          Length = 213

 Score =  118 bits (296), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 68/196 (34%), Positives = 112/196 (57%), Gaps = 16/196 (8%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           I+K++++GDSGVGK+ L+ R+V D+++  +  TIG DF  K V +N  KV  +Q+WDTAG
Sbjct: 18  IMKILLVGDSGVGKSCLLVRFVEDRFNPSFITTIGIDFKIKTVDINGKKVK-LQLWDTAG 76

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANX 126
           QERF+++  A+YRGA   +LVYDVT+ ++F+N++ W      HAN    +    +++ N 
Sbjct: 77  QERFRTITTAYYRGAMGIILVYDVTDERTFNNIRQWFTTVTEHAN----DDAQLLLVGN- 131

Query: 127 XXXXXXXXXXXXXXAQEQAKSLG---NVPLFFTSAKDSINVQDAFEEIARSALQQSQSDA 183
                         ++EQ ++L     +P   +SAKD  NV + F  + +  L Q + DA
Sbjct: 132 -----KSDMDTRVVSREQGETLAAELGLPFVESSAKDDDNVNEIFFTLTK--LIQDKIDA 184

Query: 184 DAYEDDLSEAINIQLD 199
           +       +  NI ++
Sbjct: 185 NTVSTGNGKGGNININ 200

>Smik_6.73 Chr6 (143556..144203) [648 bp, 215 aa] {ON} YFL005W
           (REAL)
          Length = 215

 Score =  118 bits (295), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 69/179 (38%), Positives = 106/179 (59%), Gaps = 10/179 (5%)

Query: 6   NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTA 65
           +I+K++++GDSGVGK+ L+ R+V DK++  +  TIG DF  K V +N  KV  +Q+WDTA
Sbjct: 19  SIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVK-LQLWDTA 77

Query: 66  GQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILAN 125
           GQERF+++  A+YRGA   +LVYDVT+ ++F N+K W      HAN    +    +++ N
Sbjct: 78  GQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHAN----DEAQLLLVGN 133

Query: 126 XXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQSDAD 184
                          A   AK LG +P   +SAK+  NV + F  +A+  L Q + D++
Sbjct: 134 KSDMDTRVVTADQGEA--LAKELG-IPFIESSAKNDDNVNEIFFTLAK--LIQEKIDSN 187

>Kwal_14.1116 s14 complement(202534..203148) [615 bp, 204 aa] {ON}
           YFL038C (YPT1) - Ras-like GTP-binding protein; most
           similar to mammalian Rab1A protein [contig 244] FULL
          Length = 204

 Score =  118 bits (295), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 111/207 (53%), Gaps = 17/207 (8%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           + K++++GDSGVGK+ L+ R+ +D Y+  Y +TIG DF  K V + D K   +Q+WDTAG
Sbjct: 8   LFKLLLIGDSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVEL-DGKTVKLQIWDTAG 66

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANX 126
           QERF+++  ++YRGA   ++VYDVT+  SF++VK W  E   +A           ++   
Sbjct: 67  QERFRTITSSYYRGAHGIIIVYDVTDHDSFNDVKMWLQEIDRYATAG-----VLKLMVGN 121

Query: 127 XXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIA---RSALQQSQSDA 183
                         A+E A SL  +P   TSA DS NV++AF  +A   + ++ Q   D 
Sbjct: 122 KSDLQDKRMVEYDVAKEFADSL-QIPFLETSALDSSNVEEAFLTMAKQIKESMAQQHRDT 180

Query: 184 DAYEDDLSEAINIQLDGEP---SSCNC 207
              +D      N+ L G+    SS  C
Sbjct: 181 GKKDD----KANVNLKGQSLSNSSSGC 203

>TDEL0C00980 Chr3 (164219..164866) [648 bp, 215 aa] {ON} Anc_8.70
           YFL005W
          Length = 215

 Score =  118 bits (295), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 104/178 (58%), Gaps = 10/178 (5%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           I+K++++GDSGVGK+ L+ R+V+DK++  +  TIG DF  K V +N  K   +Q+WDTAG
Sbjct: 20  IMKILLIGDSGVGKSCLLVRFVDDKFNPSFITTIGIDFKIKTVDINGKKTK-LQLWDTAG 78

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANX 126
           QERF+++  A+YRGA   +LVYDVT+ ++F N++ W      HAN    +    +++ N 
Sbjct: 79  QERFRTITTAYYRGAMGIILVYDVTDERTFTNIRQWFKTVNEHAN----DDAQLLLVGN- 133

Query: 127 XXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQSDAD 184
                          +  AK LG +P   +SAK+  NV + F  +AR  L Q + D D
Sbjct: 134 -KSDMDTRTVTYEQGETLAKELG-IPFVESSAKNDDNVNEIFFTLAR--LIQEKIDND 187

>ZYRO0F03872g Chr6 (329213..329866) [654 bp, 217 aa] {ON} highly
           similar to uniprot|P07560 Saccharomyces cerevisiae
           YFL005W SEC4 Secretory vesicle-associated Rab GTPase
           essential for exocytosis associates with the exocyst
           component Sec15p and may regulate polarized delivery of
           transport vesicles to the exocyst at the plasma membrane
          Length = 217

 Score =  118 bits (295), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 105/178 (58%), Gaps = 10/178 (5%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           I+K++++GDSGVGK+ L+ R+V+DK++  +  TIG DF  K V +N  K+  +Q+WDTAG
Sbjct: 20  IMKILLIGDSGVGKSCLLVRFVDDKFNPSFITTIGIDFKIKTVDINGKKIK-LQLWDTAG 78

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANX 126
           QERF+++  A+YRGA   +LVYDVT+ ++F N++ W      HAN    +    +++ N 
Sbjct: 79  QERFRTITTAYYRGAMGIILVYDVTDERTFSNIRQWFKTVNEHAN----DDAQLLLVGNK 134

Query: 127 XXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQSDAD 184
                         A   AK LG +P   +SAK+  NV + F  +A+  L Q + D D
Sbjct: 135 SDMDTRTVTYEQGEA--LAKELG-IPFIESSAKNDDNVNEIFFTLAK--LIQEKIDND 187

>KLTH0G18788g Chr7 (1624218..1624832) [615 bp, 204 aa] {ON} highly
           similar to uniprot|P01123 Saccharomyces cerevisiae
           YFL038C YPT1 Ras-like small GTPase involved in the
           ER-to-Golgi step of the secretory pathway complex
           formation with the Rab escort protein Mrs6p is required
           for prenylation of Ypt1p by protein
           geranylgeranyltransferase type II (Bet2p-Bet4p)
          Length = 204

 Score =  117 bits (294), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 71/201 (35%), Positives = 110/201 (54%), Gaps = 14/201 (6%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           + K++++GDSGVGK+ L+ R+ +D Y+  Y +TIG DF  K V + D K   +Q+WDTAG
Sbjct: 8   LFKLLLIGDSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVEL-DGKTVKLQIWDTAG 66

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANX 126
           QERF+++  ++YRGA   ++VYDVT+  SF++VK W  E   +A     +     ++   
Sbjct: 67  QERFRTITSSYYRGAHGIIIVYDVTDHDSFNDVKMWLQEIDRYATAGVLK-----LMVGN 121

Query: 127 XXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIA---RSALQQSQSDA 183
                         A+E A SL  +P   TSA DS NV++AF  +A   + ++ Q   D 
Sbjct: 122 KSDLQDKRMVEYDVAKEFADSL-QIPFLETSALDSSNVEEAFLTMAKQIKESMAQQHKDT 180

Query: 184 DAYEDDLSEAINIQLDGEPSS 204
              +D      N+ L G+  S
Sbjct: 181 GKKDD----KANVNLKGQSLS 197

>ZYRO0C07062g Chr3 (532175..532819) [645 bp, 214 aa] {ON} highly
           similar to uniprot|Q99260 Saccharomyces cerevisiae
           YLR262C YPT6 Ras-like GTP binding protein involved in
           the secretory pathway, required for fusion of
           endosome-derived vesicles with the late Golgi; has
           similarity to the human GTPase, Rab6
          Length = 214

 Score =  117 bits (293), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 110/206 (53%), Gaps = 12/206 (5%)

Query: 9   KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQE 68
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + + DDK   +Q+WDTAGQE
Sbjct: 14  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYL-DDKTIRLQLWDTAGQE 72

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXXX 128
           RF+SL  ++ R +   ++VYD+T  KSF+ +  W ++     N    E     I+ N   
Sbjct: 73  RFRSLIPSYIRDSRVAIVVYDITKRKSFEFIDKWIEDV---KNERGEENVILCIVGN-KS 128

Query: 129 XXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQSDADAYED 188
                        + +AK LG      TS K   NV++ F+ IA+S  +  +S     +D
Sbjct: 129 DLSDERQVSTEEGETKAKVLGAKIFMETSTKAGYNVKNLFKRIAKSLPEFQESPNTGVKD 188

Query: 189 DLSE----AINIQLDGE---PSSCNC 207
           D +E     I+I  + E    SSC C
Sbjct: 189 DSNENNAGVIDITTNEEEQQASSCQC 214

>Kpol_1023.21 s1023 complement(39597..40220) [624 bp, 207 aa] {ON}
           complement(39597..40220) [624 nt, 208 aa]
          Length = 207

 Score =  117 bits (293), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 72/206 (34%), Positives = 114/206 (55%), Gaps = 14/206 (6%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V + D K   +Q+WDTAG
Sbjct: 8   LFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVQL-DGKTVKLQIWDTAG 66

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANX 126
           QERF+++  ++YRG+   ++VYD+T+ +SF+ VK W  E   +A  +  +     +L   
Sbjct: 67  QERFRTITSSYYRGSHGIIIVYDITDQESFNGVKMWLQEIDRYATSTVLK-----LLVGN 121

Query: 127 XXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIAR----SALQQSQSD 182
                         A+E A++   +P   TSA DS NV++AF  +AR    S  QQ Q D
Sbjct: 122 KCDLNDKRVVEYDVAKEFAEA-NKMPFLETSALDSTNVEEAFLTMARQIKESISQQQQID 180

Query: 183 ADAYEDDLSEAINIQ---LDGEPSSC 205
               +DD    +N++   L    S C
Sbjct: 181 DKMGKDDKGGNVNLKGQSLTNTSSGC 206

>TPHA0P00360 Chr16 (76379..77023) [645 bp, 214 aa] {ON} Anc_8.70
           YFL005W
          Length = 214

 Score =  117 bits (293), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 66/179 (36%), Positives = 106/179 (59%), Gaps = 10/179 (5%)

Query: 6   NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTA 65
           +I+K++++GDSGVGK+ L+ R+V+DK++  +  TIG DF  K V +N  K+  +Q+WDTA
Sbjct: 18  SIMKILLIGDSGVGKSCLLVRFVDDKFNPSFITTIGIDFKIKTVEINGRKIK-LQLWDTA 76

Query: 66  GQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILAN 125
           GQERF+++  A+YRGA   +LVYDVT+ K+F N++ W      HAN    +    +++ N
Sbjct: 77  GQERFRTITTAYYRGAMGIILVYDVTDEKTFANIRQWFKTVTEHAN----DDAQLLLVGN 132

Query: 126 XXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQSDAD 184
                            E ++ LG +P    SAK+  NV + F  +A+  L Q + D++
Sbjct: 133 --KSDMETRTVTHEQGDELSRELG-IPFVEASAKNDDNVNEIFFTLAK--LIQEKIDSN 186

>NDAI0G03050 Chr7 complement(711396..712028) [633 bp, 210 aa] {ON}
           Anc_8.25
          Length = 210

 Score =  117 bits (292), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 110/204 (53%), Gaps = 11/204 (5%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V + D K   +Q+WDTAG
Sbjct: 8   LFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVEL-DGKTVKLQIWDTAG 66

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANX 126
           QERF+++  ++YRG+   ++VYDVT+  SFD VK W  E   +A  +        +L   
Sbjct: 67  QERFRTITSSYYRGSHGIIIVYDVTDQDSFDGVKMWLQEIDRYATST-----VLKLLVGN 121

Query: 127 XXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIAR----SALQQSQSD 182
                         A+E A S   +P   TSA +S NV++AF  +AR    S  QQ   D
Sbjct: 122 KCDLEDKRVVEYDVAKEFADS-NKMPFLETSALNSTNVEEAFLTMARQIKESMNQQKMED 180

Query: 183 ADAYEDDLSEAINIQLDGEPSSCN 206
           ++A      +  N+ L G  S  N
Sbjct: 181 SNAASKGGDKNSNVNLTGGQSLTN 204

>TPHA0D00270 Chr4 complement(37369..37992) [624 bp, 207 aa] {ON}
           Anc_8.25 YFL038C
          Length = 207

 Score =  116 bits (291), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 111/195 (56%), Gaps = 11/195 (5%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V + D K   +Q+WDTAG
Sbjct: 8   LFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVEL-DGKTVKLQIWDTAG 66

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANX 126
           QERF+++  ++YRG+   ++VYDVT+ +SF++VK W  E   +A  +  +     +L   
Sbjct: 67  QERFRTITSSYYRGSHGIIIVYDVTDQESFNSVKMWLQEIDRYATSTVLK-----LLVGN 121

Query: 127 XXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIAR----SALQQSQSD 182
                         A+E A+    +P   TSA DS NV++AF  +AR    S   Q Q +
Sbjct: 122 KSDMTDKRVVEYDVAKEFAEQ-NKMPFLETSALDSTNVEEAFLTMARQIKESISHQQQIE 180

Query: 183 ADAYEDDLSEAINIQ 197
             +  DD S  +N++
Sbjct: 181 MKSGNDDKSGNVNLK 195

>Skud_6.66 Chr6 (132521..133168) [648 bp, 215 aa] {ON} YFL005W
           (REAL)
          Length = 215

 Score =  115 bits (289), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 68/179 (37%), Positives = 105/179 (58%), Gaps = 10/179 (5%)

Query: 6   NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTA 65
           +I+K++++GDSGVGK+ L+ R+V DK++  +  TIG DF  K V +N  KV  +Q+WDTA
Sbjct: 19  SIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVK-LQLWDTA 77

Query: 66  GQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILAN 125
           GQERF+++  A+YRGA   +LVYDVT+ ++F N+K W      HA     +    +++ N
Sbjct: 78  GQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHA----TDEAQLLLVGN 133

Query: 126 XXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQSDAD 184
                          A   AK LG +P   +SAK+  NV + F  +A+  L Q + D++
Sbjct: 134 KSDMDTRVVTVDQGEA--LAKELG-IPFIESSAKNDDNVNEIFFTLAK--LIQEKIDSN 187

>Suva_6.19 Chr6 complement(28872..29492) [621 bp, 206 aa] {ON}
           YFL038C (REAL)
          Length = 206

 Score =  115 bits (288), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 71/200 (35%), Positives = 112/200 (56%), Gaps = 14/200 (7%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V + D K   +Q+WDTAG
Sbjct: 8   LFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVEL-DGKTVKLQIWDTAG 66

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANX 126
           QERF+++  ++YRG+   ++VYDVT+ +SF+ VK W  E   +A  +  +     +L   
Sbjct: 67  QERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLK-----LLVGN 121

Query: 127 XXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIAR----SALQQSQSD 182
                         A+E A +   +P   TSA DS NV+DAF  +AR    S  QQ+ ++
Sbjct: 122 KCDLKDKRVVEYDVAKEFADA-NKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNE 180

Query: 183 ADAYEDDLSEAINIQLDGEP 202
               +DD     N+ L G+ 
Sbjct: 181 TTQKKDDKG---NVNLKGQS 197

>CAGL0K12672g Chr11 (1256370..1256990) [621 bp, 206 aa] {ON} highly
           similar to uniprot|P01123 Saccharomyces cerevisiae
           YFL038c YPT1
          Length = 206

 Score =  115 bits (288), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 72/208 (34%), Positives = 116/208 (55%), Gaps = 19/208 (9%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V + D K   +Q+WDTAG
Sbjct: 8   LFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVEL-DGKTVKLQIWDTAG 66

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANX 126
           QERF+++  ++YRG+   ++VYDVT+ +SF+ VK W  E   +A  +        +L   
Sbjct: 67  QERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATST-----VLKLLVGN 121

Query: 127 XXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIAR----SALQQSQSD 182
                         A+E A++   +P   TSA DS NV++AF  +AR    S  QQ+ ++
Sbjct: 122 KCDLADKRVVEYDVAKEFAEA-NKMPFLETSALDSTNVEEAFLTMARQIKESMTQQNMNE 180

Query: 183 ADAYEDDLSEAINIQLDGEP-----SSC 205
           +   ++D     N+ L G+      SSC
Sbjct: 181 SQQKKNDKG---NVNLKGQSLTQSGSSC 205

>KAFR0A05260 Chr1 complement(1040753..1041460) [708 bp, 235 aa] {ON}
           Anc_6.49 YLR262C
          Length = 235

 Score =  115 bits (289), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 76/217 (35%), Positives = 111/217 (51%), Gaps = 23/217 (10%)

Query: 9   KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQE 68
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + + DDK   +Q+WDTAGQE
Sbjct: 24  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYL-DDKTIRLQLWDTAGQE 82

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXXX 128
           RF+SL  ++ R +   ++VYD+T  KSF+ +  W D+     N    E     I+ N   
Sbjct: 83  RFRSLIPSYIRDSKVAIVVYDITKKKSFEFIDKWVDDV---KNERGEENVVLCIVGN-KN 138

Query: 129 XXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARS--ALQQSQSDADAY 186
                        + +AK LG      TS K   NV++ F+ IA+S    Q   +D  + 
Sbjct: 139 DLGDERQVSTEEGEAKAKKLGAKIFMETSTKAGYNVKNLFKRIAKSLPEFQSENTDESSL 198

Query: 187 EDDLSE--------------AINIQ-LDG-EPSSCNC 207
           ++ LS                I+I   DG E SSC C
Sbjct: 199 DNKLSSNTGGNNSSSNGKAGVIDISTTDGQEQSSCQC 235

>KLTH0C10384g Chr3 (861122..861826) [705 bp, 234 aa] {ON} highly
           similar to uniprot|Q99260 Saccharomyces cerevisiae
           YLR262C YPT6 Ras-like GTP binding protein involved in
           the secretory pathway, required for fusion of
           endosome-derived vesicles with the late Golgi; has
           similarity to the human GTPase, Rab6
          Length = 234

 Score =  115 bits (289), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 69/205 (33%), Positives = 110/205 (53%), Gaps = 11/205 (5%)

Query: 9   KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQE 68
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + + DDK   +Q+WDTAGQE
Sbjct: 35  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYL-DDKTIRLQLWDTAGQE 93

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXXX 128
           RF+SL  ++ R +   ++VYDVTN KSF+ +  W ++     +    E     I+ N   
Sbjct: 94  RFRSLIPSYIRDSHVAIVVYDVTNKKSFEYIDKWVEDV---KSERGEENVVLCIVGN-KN 149

Query: 129 XXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQSDADAYED 188
                        + +A+ L       TS K   NV++ F +IA++  +  +SD+   +D
Sbjct: 150 DLSDERQVSTEEGERKAQVLNAKIFIETSTKVGFNVKNLFRKIAKTLPEFQKSDSVPLDD 209

Query: 189 DLSEA------INIQLDGEPSSCNC 207
           + ++       I    + E SSC C
Sbjct: 210 NATKNKPDVIDITTNEEQEQSSCQC 234

>KNAG0E03100 Chr5 complement(618438..619076) [639 bp, 212 aa] {ON}
           Anc_8.25 YFL038C
          Length = 212

 Score =  115 bits (287), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 64/167 (38%), Positives = 97/167 (58%), Gaps = 7/167 (4%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V + D K   +Q+WDTAG
Sbjct: 8   LFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVEL-DGKTVKLQIWDTAG 66

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANX 126
           QERF+++  ++YRG+   ++VYDVT+  SFD VK W  E   +A  +        +L   
Sbjct: 67  QERFRTITSSYYRGSHGIIIVYDVTDQDSFDGVKMWLQEIDRYATST-----VLKLLVGN 121

Query: 127 XXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIAR 173
                         A+E A +  N+P   TSA DS NV++AF  +AR
Sbjct: 122 KCDLNDKRVVEYDVAKEFADA-NNMPFLETSALDSTNVEEAFLTMAR 167

>Suva_10.359 Chr10 complement(629445..630092) [648 bp, 215 aa] {ON}
           YLR262C (REAL)
          Length = 215

 Score =  115 bits (287), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 74/220 (33%), Positives = 113/220 (51%), Gaps = 18/220 (8%)

Query: 1   MSRKKNIL---KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVA 57
           MSR    L   K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + + DDK  
Sbjct: 1   MSRSGKSLTKYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYL-DDKTI 59

Query: 58  TMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPET 117
            +Q+WDTAGQERF+SL  ++ R +   ++VYD+T  KSF+ +  W ++     N    E 
Sbjct: 60  RLQLWDTAGQERFRSLIPSYIRDSRVAIIVYDITKRKSFEYIDKWIEDV---KNERGEEN 116

Query: 118 FPFVILANXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQ 177
               I+ N                +++AK LG      TS K   NV++ F++IA+S  +
Sbjct: 117 VILCIVGN-KSDLSDERQISTEEGEKKAKLLGAKIFMETSTKAGYNVKNLFKKIAKSLPE 175

Query: 178 QSQSDADAYEDDLSEAINIQLDG----------EPSSCNC 207
              S+A   + + + + N    G          E S C C
Sbjct: 176 FQNSEATPLDGENANSGNQNKPGVIDISTTDEQEKSGCQC 215

>TPHA0F02500 Chr6 complement(551815..552462) [648 bp, 215 aa] {ON}
           Anc_6.49 YLR262C
          Length = 215

 Score =  115 bits (287), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 104/192 (54%), Gaps = 8/192 (4%)

Query: 1   MSRKKNIL---KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVA 57
           MSR    L   K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + + DDK  
Sbjct: 1   MSRANKSLTKYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYL-DDKTI 59

Query: 58  TMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPET 117
            +Q+WDTAGQERF+SL  ++ R +   ++VYD+T  KSF+ +  W ++          E 
Sbjct: 60  RLQLWDTAGQERFRSLIPSYIRDSRVAIVVYDITKKKSFEYIDKWIEDVKTE---RGSEN 116

Query: 118 FPFVILANXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQ 177
               I+ N                + +AK LG      TS K   NV++ F++IA+S  +
Sbjct: 117 VILCIVGN-KSDLSDERQVTTEEGEAKAKELGATIFMETSTKAGHNVKNLFKKIAKSLPE 175

Query: 178 QSQSDADAYEDD 189
              SD+   +D+
Sbjct: 176 FQNSDSTPLDDN 187

>ZYRO0F02816g Chr6 complement(237904..238533) [630 bp, 209 aa] {ON}
           highly similar to uniprot|P01123 Saccharomyces
           cerevisiae YFL038C YPT1 Ras-like small GTPase involved
           in the ER-to-Golgi step of the secretory pathway complex
           formation with the Rab escort protein Mrs6p is required
           for prenylation of Ypt1p by protein
           geranylgeranyltransferase type II (Bet2p-Bet4p)
          Length = 209

 Score =  114 bits (286), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 71/200 (35%), Positives = 112/200 (56%), Gaps = 12/200 (6%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V + D K   +Q+WDTAG
Sbjct: 8   LFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVDL-DGKTVKLQIWDTAG 66

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANX 126
           QERF+++  ++YRG+   ++VYDVT+ +SF+ VK W  E   +A  +  +     +L   
Sbjct: 67  QERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLK-----LLVGN 121

Query: 127 XXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIAR----SALQQSQSD 182
                         A+E A +   +P   TSA DS NV++AF  +AR    S  QQ + D
Sbjct: 122 KCDLKDKRVVEYDVAKEFADA-NKMPFIETSALDSTNVEEAFLTMARQIKDSMAQQQRHD 180

Query: 183 ADAYEDDLSEAINIQLDGEP 202
             A  +  +E  N+ L G+ 
Sbjct: 181 GGA-ANGQNENGNVNLKGQS 199

>Kpol_1042.2 s1042 complement(4659..5303) [645 bp, 214 aa] {ON}
           complement(4659..5303) [645 nt, 215 aa]
          Length = 214

 Score =  114 bits (285), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 74/220 (33%), Positives = 114/220 (51%), Gaps = 19/220 (8%)

Query: 1   MSRKKNIL---KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVA 57
           MSR    L   K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + + DDK  
Sbjct: 1   MSRPNKSLTKYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYL-DDKTI 59

Query: 58  TMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPET 117
            +Q+WDTAGQERF+SL  ++ R +   ++VYD+T  KSFD +  W ++     N    + 
Sbjct: 60  RLQLWDTAGQERFRSLIPSYIRDSRVAIVVYDITKKKSFDCIDKWIEDV---KNERGEDN 116

Query: 118 FPFVILANXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQ 177
               ++ N                +++AK LG      TS K   NV++ F++IA+S L 
Sbjct: 117 VILCVVGN-KSDLTDERQVSTEDGEKKAKELGAKIFMETSTKAGYNVKNLFKKIAKS-LP 174

Query: 178 QSQSDADAYEDDLSEAINIQLDG----------EPSSCNC 207
           + Q+      D+   + N +  G          + SSC C
Sbjct: 175 EFQNSESTPLDETENSDNTKKTGIIDITTNDELQQSSCQC 214

>Skud_6.32 Chr6 complement(58531..59151) [621 bp, 206 aa] {ON}
           YFL038C (REAL)
          Length = 206

 Score =  114 bits (284), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 68/197 (34%), Positives = 109/197 (55%), Gaps = 8/197 (4%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V + D K   +Q+WDTAG
Sbjct: 8   LFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVEL-DGKTVKLQIWDTAG 66

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANX 126
           QERF+++  ++YRG+   ++VYDVT+ +SF+ VK W  E   +A  +  +     +L   
Sbjct: 67  QERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLK-----LLVGN 121

Query: 127 XXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQ-QSQSDADA 185
                         A+E A +   +P   TSA DS NV+DAF  +AR   +  SQ + + 
Sbjct: 122 KCDLKDKRVVEYDVAKEFADA-NKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNE 180

Query: 186 YEDDLSEAINIQLDGEP 202
                 +  N+ L G+ 
Sbjct: 181 TTQKKEDKGNVNLKGQS 197

>Smik_6.40 Chr6 complement(70749..71369) [621 bp, 206 aa] {ON}
           YFL038C (REAL)
          Length = 206

 Score =  114 bits (284), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 68/197 (34%), Positives = 109/197 (55%), Gaps = 8/197 (4%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V + D K   +Q+WDTAG
Sbjct: 8   LFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVEL-DGKTVKLQIWDTAG 66

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANX 126
           QERF+++  ++YRG+   ++VYDVT+ +SF+ VK W  E   +A  +  +     +L   
Sbjct: 67  QERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLK-----LLVGN 121

Query: 127 XXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQ-QSQSDADA 185
                         A+E A +   +P   TSA DS NV+DAF  +AR   +  SQ + + 
Sbjct: 122 KCDLKDKRVVEYDVAKEFADA-NKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNE 180

Query: 186 YEDDLSEAINIQLDGEP 202
                 +  N+ L G+ 
Sbjct: 181 TTQKKEDKGNVNLKGQS 197

>YFL038C Chr6 complement(55366..55986) [621 bp, 206 aa] {ON}
           YPT1Rab family GTPase, involved in the ER-to-Golgi step
           of the secretory pathway; complex formation with the Rab
           escort protein Mrs6p is required for prenylation of
           Ypt1p by protein geranylgeranyltransferase type II
           (Bet2p-Bet4p)
          Length = 206

 Score =  114 bits (284), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 68/197 (34%), Positives = 109/197 (55%), Gaps = 8/197 (4%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V + D K   +Q+WDTAG
Sbjct: 8   LFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVEL-DGKTVKLQIWDTAG 66

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANX 126
           QERF+++  ++YRG+   ++VYDVT+ +SF+ VK W  E   +A  +  +     +L   
Sbjct: 67  QERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLK-----LLVGN 121

Query: 127 XXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQ-QSQSDADA 185
                         A+E A +   +P   TSA DS NV+DAF  +AR   +  SQ + + 
Sbjct: 122 KCDLKDKRVVEYDVAKEFADA-NKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNE 180

Query: 186 YEDDLSEAINIQLDGEP 202
                 +  N+ L G+ 
Sbjct: 181 TTQKKEDKGNVNLKGQS 197

>TBLA0E03190 Chr5 complement(803935..804558) [624 bp, 207 aa] {ON}
           Anc_6.49 YLR262C
          Length = 207

 Score =  113 bits (283), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 68/203 (33%), Positives = 111/203 (54%), Gaps = 9/203 (4%)

Query: 9   KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQE 68
           K++ LG+ GVGKTSL+ R++ D + + Y+ATIG DFL+K + + DDK   +Q+WDTAGQE
Sbjct: 10  KIVFLGEQGVGKTSLITRFMYDTFDEHYQATIGIDFLSKTMYL-DDKTIRLQLWDTAGQE 68

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXXX 128
           RF+SL  ++ R +   ++VYD+T  KSF+ +  W  +     N    +     I+ N   
Sbjct: 69  RFRSLIPSYIRDSRVAIVVYDITKKKSFEYIDKWIQDV---KNERGDDGVILCIVGN-KS 124

Query: 129 XXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQSDADAYE- 187
                        + +AK LG      TS K   NV++ F++IA+S  +   ++ +  E 
Sbjct: 125 DLSDQRQVSNEEGENKAKLLGADIFMETSTKAGYNVKNLFKKIAKSLPEFENTEGNPLEN 184

Query: 188 DDLSEAINIQLDGEP---SSCNC 207
           ++ +  I+I  + EP   + C C
Sbjct: 185 EERAGVIDIGENEEPKQEAGCQC 207

>Kwal_56.22555 s56 complement(178575..179213) [639 bp, 212 aa] {ON}
           YLR262C (YPT6) - highly homologous to the human GTPase,
           Rab6 [contig 185] FULL
          Length = 212

 Score =  113 bits (283), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 71/208 (34%), Positives = 108/208 (51%), Gaps = 18/208 (8%)

Query: 9   KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQE 68
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + + DDK   +Q+WDTAGQE
Sbjct: 14  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYL-DDKTIRLQLWDTAGQE 72

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXXX 128
           RF+SL  ++ R +   ++VYDVTN KSF+ +  W ++     +    E     I+ N   
Sbjct: 73  RFRSLIPSYIRDSHVAIVVYDVTNKKSFEYIDKWVEDV---KSERGEENVVLCIVGN-KN 128

Query: 129 XXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQSDADAYED 188
                        + +A+ L       TS K   NV++ F +IA++  +  ++D    ED
Sbjct: 129 DLSDERQVSTEEGERKAQVLNAKIFIETSTKAGFNVKNLFRKIAKTLPEFQKAD----ED 184

Query: 189 DLSEA---------INIQLDGEPSSCNC 207
            L E          I    + E SSC C
Sbjct: 185 PLGEQAKNKPDVIDITTASEQEQSSCQC 212

>YLR262C Chr12 complement(668244..668891) [648 bp, 215 aa] {ON}
           YPT6Rab family GTPase, Ras-like GTP binding protein
           involved in the secretory pathway, required for fusion
           of endosome-derived vesicles with the late Golgi,
           maturation of the vacuolar carboxypeptidase Y; has
           similarity to the human GTPase, Rab6
          Length = 215

 Score =  113 bits (282), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 73/220 (33%), Positives = 113/220 (51%), Gaps = 18/220 (8%)

Query: 1   MSRKKNIL---KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVA 57
           MSR    L   K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + + DDK  
Sbjct: 1   MSRSGKSLTKYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYL-DDKTI 59

Query: 58  TMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPET 117
            +Q+WDTAGQERF+SL  ++ R +   ++VYD+T  KSF+ +  W ++     N    E 
Sbjct: 60  RLQLWDTAGQERFRSLIPSYIRDSRVAIIVYDITKRKSFEYIDKWIEDV---KNERGDEN 116

Query: 118 FPFVILANXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQ 177
               I+ N                +++AK LG      TS K   NV+  F++IA+S  +
Sbjct: 117 VILCIVGN-KSDLSDERQISTEEGEKKAKLLGAKIFMETSTKAGYNVKALFKKIAKSLPE 175

Query: 178 QSQSDADAYEDDLSEAINIQLDG----------EPSSCNC 207
              S++   + + + + N    G          E S+C C
Sbjct: 176 FQNSESTPLDSENANSANQNKPGVIDISTAEEQEQSACQC 215

>CAGL0K06017g Chr11 complement(586922..587581) [660 bp, 219 aa] {ON}
           highly similar to uniprot|Q99260 Saccharomyces
           cerevisiae YLR262c GTP-binding protein
          Length = 219

 Score =  113 bits (282), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 66/187 (35%), Positives = 104/187 (55%), Gaps = 5/187 (2%)

Query: 9   KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQE 68
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + + DDK   +Q+WDTAGQE
Sbjct: 13  KIVFLGEQGVGKTSLITRFMYDTFDDNYQATIGIDFLSKTMYL-DDKTIRLQLWDTAGQE 71

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXXX 128
           RF+SL  ++ R +   ++VYD+T  KSF+ +  W ++     N    E     ++ N   
Sbjct: 72  RFRSLIPSYIRDSRVAIVVYDITKRKSFEFIDKWIEDV---KNERGAENVILCVVGN-KS 127

Query: 129 XXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQSDADAYED 188
                        +++A+ LG      TS K   NV++ F++IA+S  +   SDA+  E+
Sbjct: 128 DLADERQVTAEEGEKKAQDLGAKIFMQTSTKVGYNVKNLFKKIAKSLPEFQDSDANPLEN 187

Query: 189 DLSEAIN 195
               A N
Sbjct: 188 TGGAAGN 194

>Smik_12.336 Chr12 complement(606255..606905) [651 bp, 216 aa] {ON}
           YLR262C (REAL)
          Length = 216

 Score =  112 bits (280), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 102/186 (54%), Gaps = 10/186 (5%)

Query: 1   MSRKKNIL---KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVA 57
           MSR    L   K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + + DDK  
Sbjct: 1   MSRSGKSLTKYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYL-DDKTI 59

Query: 58  TMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPET 117
            +Q+WDTAGQERF+SL  ++ R +   ++VYD+T  KSF+ +  W ++     N    E 
Sbjct: 60  RLQLWDTAGQERFRSLIPSYIRDSRVAIIVYDITKRKSFEYIDKWIEDV---KNERGEEN 116

Query: 118 FPFVILANXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARS--A 175
               I+ N                +++AK LG      TS K   NV+  F++IA+S   
Sbjct: 117 VILCIVGN-KSDLSDERQISTEEGEKKAKLLGAKIFMETSTKAGYNVKTLFKKIAKSLPE 175

Query: 176 LQQSQS 181
            Q S+S
Sbjct: 176 FQNSES 181

>NCAS0D02500 Chr4 (474037..474705) [669 bp, 222 aa] {ON} Anc_6.49
          Length = 222

 Score =  112 bits (280), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 104/192 (54%), Gaps = 8/192 (4%)

Query: 1   MSRKKNIL---KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVA 57
           MSR    L   K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + + DDK  
Sbjct: 1   MSRSGKALTKYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYL-DDKTI 59

Query: 58  TMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPET 117
            +Q+WDTAGQERF+SL  ++ R +   ++VYD+T  KSF+ +  W ++     N    + 
Sbjct: 60  RLQLWDTAGQERFRSLIPSYIRDSRVAIVVYDITKKKSFEYIDKWIEDV---KNERGDDN 116

Query: 118 FPFVILANXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQ 177
               I+ N                + +AK LG      TS K   NV++ F++IA+S  +
Sbjct: 117 VILCIVGN-KSDLSDERQVTIEEGENKAKILGADIFMETSTKAGYNVKNLFKKIAKSLPE 175

Query: 178 QSQSDADAYEDD 189
              SD +  + D
Sbjct: 176 FQNSDTNPLDTD 187

>Skud_12.341 Chr12 complement(609187..609837) [651 bp, 216 aa] {ON}
           YLR262C (REAL)
          Length = 216

 Score =  112 bits (280), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 101/186 (54%), Gaps = 10/186 (5%)

Query: 1   MSRKKNIL---KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVA 57
           MSR    L   K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + + DDK  
Sbjct: 1   MSRSGKSLTKYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYL-DDKTI 59

Query: 58  TMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPET 117
            +Q+WDTAGQERF+SL  ++ R +   ++VYD+T  KSF+ +  W ++     N    E 
Sbjct: 60  RLQLWDTAGQERFRSLIPSYIRDSRVAIIVYDITKRKSFEYIDKWIEDV---KNERGEEN 116

Query: 118 FPFVILANXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARS--A 175
               I+ N                +++AK LG      TS K   NV+  F+ IA+S   
Sbjct: 117 VILCIVGN-KSDLSDERQISTEEGEKKAKLLGAKIFMETSTKAGYNVKTLFKRIAKSLPE 175

Query: 176 LQQSQS 181
            Q S+S
Sbjct: 176 FQNSES 181

>TDEL0C00490 Chr3 complement(75792..76418) [627 bp, 208 aa] {ON}
           Anc_8.25 YFL038C
          Length = 208

 Score =  112 bits (279), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 112/204 (54%), Gaps = 13/204 (6%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V + D K   +Q+WDTAG
Sbjct: 8   LFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVEL-DGKTVKLQIWDTAG 66

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANX 126
           QERF+++  ++YRG+   ++VYDVT+ +SF+ VK W  E   +A  +  +     +L   
Sbjct: 67  QERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLK-----LLVGN 121

Query: 127 XXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIAR----SALQQSQSD 182
                         A+E A++   +P   TSA DS NV+ AF  +A+    S  QQ   D
Sbjct: 122 KCDLEDKRVVEYDVAREFAEA-NKMPFLETSALDSTNVEQAFLTMAKQIKDSMAQQHARD 180

Query: 183 ADAYEDDLSEAINIQLDGEPSSCN 206
             +   D  +  N+ L G+  + N
Sbjct: 181 GGSNAKD--DQGNVNLKGQSLTNN 202

>TDEL0G04210 Chr7 (764766..765434) [669 bp, 222 aa] {ON} Anc_6.49
           YLR262C
          Length = 222

 Score =  111 bits (278), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 68/188 (36%), Positives = 102/188 (54%), Gaps = 6/188 (3%)

Query: 9   KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQE 68
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + + DDK   +Q+WDTAGQE
Sbjct: 14  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYL-DDKTIRLQLWDTAGQE 72

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXXX 128
           RF+SL  ++ R +   ++VYD+T  KSF+ +  W ++     N    E     I+ N   
Sbjct: 73  RFRSLIPSYIRDSRVAIVVYDITKKKSFEFIDKWIEDV---KNERGEENVILCIVGN-KS 128

Query: 129 XXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQ-QSQSDADAYE 187
                        + +AK LG      TS K   NV++ F++IA+S  + Q    A A E
Sbjct: 129 DLADERQVSTEEGEAKAKLLGAKIFMETSTKAGHNVKNLFKKIAKSLPEFQEGQHAGALE 188

Query: 188 DDLSEAIN 195
            D S  + 
Sbjct: 189 GDNSNEVG 196

>KLLA0F20471g Chr6 (1901749..1902387) [639 bp, 212 aa] {ON} highly
           similar to uniprot|Q99260 Saccharomyces cerevisiae
           YLR262C YPT6 Ras-like GTP binding protein involved in
           the secretory pathway, required for fusion of
           endosome-derived vesicles with the late Golgi; has
           similarity to the human GTPase, Rab6
          Length = 212

 Score =  111 bits (277), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 66/176 (37%), Positives = 99/176 (56%), Gaps = 9/176 (5%)

Query: 9   KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQE 68
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + + DDK   +Q+WDTAGQE
Sbjct: 13  KIVFLGEQGVGKTSLITRFMYDTFDDNYQATIGIDFLSKTMYL-DDKTIRLQLWDTAGQE 71

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXXX 128
           RF+SL  ++ R +   ++VYDVTN KSF+ +  W ++  +       E    VI+ N   
Sbjct: 72  RFRSLIPSYIRDSHVAIVVYDVTNRKSFEYIDKWIEDVKME---RGEENVILVIVGNKSD 128

Query: 129 XXXXXXXXXXXXAQEQAKSLGNVPLFF-TSAKDSINVQDAFEEIAR--SALQQSQS 181
                         E+  ++ N  LF  TS K   NV+  F++IA+     Q +QS
Sbjct: 129 LVEERQVSTEEG--ERKSTVLNAKLFIETSTKAGFNVKTLFKKIAKLLPEFQDAQS 182

>NDAI0I02380 Chr9 complement(542975..543643) [669 bp, 222 aa] {ON} 
          Length = 222

 Score =  111 bits (277), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 101/192 (52%), Gaps = 8/192 (4%)

Query: 1   MSRKKNIL---KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVA 57
           MSR    L   K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + + DDK  
Sbjct: 1   MSRSGKTLTKYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYL-DDKTI 59

Query: 58  TMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPET 117
            +Q+WDTAGQERF+SL  ++ R +   ++VYD+T  +SFD +  W ++     N    + 
Sbjct: 60  RLQLWDTAGQERFRSLIPSYIRDSRVAIVVYDITKKESFDFIDKWINDV---KNERGEDN 116

Query: 118 FPFVILANXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQ 177
               I+ N                + +AK LG      TS K   NV+  F+ IA+S  +
Sbjct: 117 VILCIVGN-KNDLTDQRQVSIEEGENKAKQLGANIFMETSTKAGYNVKTLFKRIAKSLPE 175

Query: 178 QSQSDADAYEDD 189
              S +D    D
Sbjct: 176 FQNSTSDPLSGD 187

>SAKL0E02090g Chr5 complement(160194..160838) [645 bp, 214 aa] {ON}
           highly similar to uniprot|Q99260 Saccharomyces
           cerevisiae YLR262C YPT6 Ras-like GTP binding protein
           involved in the secretory pathway, required for fusion
           of endosome-derived vesicles with the late Golgi; has
           similarity to the human GTPase, Rab6
          Length = 214

 Score =  110 bits (276), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 70/206 (33%), Positives = 110/206 (53%), Gaps = 12/206 (5%)

Query: 9   KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQE 68
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + + DDK   +Q+WDTAGQE
Sbjct: 14  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYL-DDKTIRLQLWDTAGQE 72

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXXX 128
           RF+SL  ++ R +   ++VYDVTN KSF+ +  W ++     +    E     I+ N   
Sbjct: 73  RFRSLIPSYIRDSHVAIVVYDVTNKKSFEYIDKWIEDV---KSERGEENVILCIVGN-KN 128

Query: 129 XXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQSDADAYED 188
                        + +A+ L       TS K   NV++ F++IA+S  +   S     ++
Sbjct: 129 DLVDERQVSTEEGERKAQVLNAKIFMETSTKAGFNVKNLFKKIAKSLPEFQNSSYSPLDN 188

Query: 189 DLSE----AINIQLDG-EP--SSCNC 207
           + SE     I+I  +  EP   +C C
Sbjct: 189 EQSENKPGVIDISTNSDEPDQGTCQC 214

>NCAS0C03710 Chr3 complement(747168..747803) [636 bp, 211 aa] {ON}
           Anc_8.25
          Length = 211

 Score =  110 bits (276), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 66/183 (36%), Positives = 101/183 (55%), Gaps = 11/183 (6%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V + D K   +Q+WDTAG
Sbjct: 8   LFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVEL-DGKTVKLQIWDTAG 66

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANX 126
           QERF+++  ++YRG+   ++VYDVT+  SF+ VK W  E   +A  +        +L   
Sbjct: 67  QERFRTITSSYYRGSHGIIIVYDVTDQDSFNGVKMWLQEIDRYATST-----VLKLLVGN 121

Query: 127 XXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIAR----SALQQSQSD 182
                         A+E A +   +P   TSA +S NV++AF  +AR    S  QQ   D
Sbjct: 122 KCDLTDKRVVEYDVAKEFADA-NKMPFLETSALNSTNVEEAFLTMARQIKESMSQQKMED 180

Query: 183 ADA 185
             A
Sbjct: 181 GGA 183

>KNAG0E02720 Chr5 (541478..542173) [696 bp, 231 aa] {ON} 
          Length = 231

 Score =  109 bits (273), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 62/179 (34%), Positives = 99/179 (55%), Gaps = 5/179 (2%)

Query: 9   KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQE 68
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + + DD     Q+WDTAGQE
Sbjct: 18  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYL-DDHTIRFQLWDTAGQE 76

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXXX 128
           RF+SL  ++ R +   ++VYD+T  KSF+ +  W ++     N  S +   F I+ N   
Sbjct: 77  RFRSLIPSYIRDSRVAIVVYDITKKKSFEYIDKWVEDV---KNERSADNVIFCIVGN-KS 132

Query: 129 XXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQSDADAYE 187
                        +++ K LG      TS K   NV++ F++IA+S  +   +D +  +
Sbjct: 133 DLTDERQVSTEEGEQKTKVLGAQIFMETSTKAGYNVKNLFKKIAKSLPEFQDTDTNTLD 191

>KNAG0C01840 Chr3 (363258..363896) [639 bp, 212 aa] {ON} Anc_1.338
           YBR264C
          Length = 212

 Score =  107 bits (268), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 68/208 (32%), Positives = 102/208 (49%), Gaps = 16/208 (7%)

Query: 9   KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQE 68
           KV++LG S VGK+S++ R V  K+ +   ATIGA F  KEV + D K   + VWDTAGQE
Sbjct: 12  KVVLLGGSSVGKSSIVTRLVTGKFMKN-SATIGAAFSWKEVFLEDKKAVKLSVWDTAGQE 70

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXXX 128
           R+++L   +YR  D  ++VYDVTN  S +  KSW +E   + N          ++ N   
Sbjct: 71  RYRALTPMYYRNTDVALIVYDVTNSTSIEGAKSWIEELHNYVNEDRRNKISIWLVGNKID 130

Query: 129 XXXXXXXXXXXXAQEQAKS--LGNVP----LFFTSAKDSINVQDAFEEIARSALQQSQSD 182
                         E      + ++P    L + SAK    +++ F EI+R      Q  
Sbjct: 131 LLPTAQDSDTTYPHEDVLRGIMHDIPNPNELAYVSAKTGAGIEEMFNEISR------QVP 184

Query: 183 ADAYEDDLSEAINIQLD---GEPSSCNC 207
            +A+E    ++  +QL+       SCNC
Sbjct: 185 EEAFEASNKDSELLQLNTTKNSSHSCNC 212

>AGR257C Chr7 complement(1225880..1226542) [663 bp, 220 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR262C
           (YPT6)
          Length = 220

 Score =  107 bits (268), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 63/166 (37%), Positives = 93/166 (56%), Gaps = 7/166 (4%)

Query: 9   KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQE 68
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K V + DD+   +Q+WDTAGQE
Sbjct: 14  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTVYL-DDRTIRLQLWDTAGQE 72

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXXX 128
           RF+SL  ++ R +   ++VYD+TN KSF+ +  W ++     N    E     I+ N   
Sbjct: 73  RFRSLIPSYIRDSHVAIVVYDITNKKSFEYIDKWVEDV---RNERGEENLILCIVGN-KS 128

Query: 129 XXXXXXXXXXXXAQEQAKSLGNVPLFF-TSAKDSINVQDAFEEIAR 173
                        + +AK L N  +F  TS K   NV   F+ IA+
Sbjct: 129 DLVDERKVTVEEGENKAKLL-NAKIFVETSTKAGFNVGALFKRIAK 173

>Ecym_3137 Chr3 (254058..254723) [666 bp, 221 aa] {ON} similar to
           Ashbya gossypii AGR257C
          Length = 221

 Score =  107 bits (267), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 71/214 (33%), Positives = 104/214 (48%), Gaps = 21/214 (9%)

Query: 9   KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQE 68
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K V + DD+   +Q+WDTAGQE
Sbjct: 14  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTVYL-DDRNIRLQLWDTAGQE 72

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXXX 128
           RF+SL  ++ R +   ++VYDVTN +SF+ +  W ++          E     I+ N   
Sbjct: 73  RFRSLIPSYIRDSHVAIVVYDVTNKRSFEYIDKWVEDVKTE---RGEENLILCIVGNKND 129

Query: 129 XXXXXXXXXXXXAQEQAKSLGNVPLFF-TSAKDSINVQDAFEEIAR-----------SAL 176
                         E    L N  +F  TS K   NV+  F+ IA+           S +
Sbjct: 130 LVDERSVSTKEG--EMKAQLLNAKIFMETSTKAGFNVKQLFKSIAKLLPEFQNTKVSSGV 187

Query: 177 QQSQSDADAYEDDLSEAINIQ---LDGEPSSCNC 207
              +S+      D    I+I      G  SSC C
Sbjct: 188 LDGESEKHNNGGDKPGVIDISTPATGGNESSCQC 221

>CAGL0G07689g Chr7 complement(729919..730566) [648 bp, 215 aa] {ON}
           highly similar to uniprot|P36018 Saccharomyces
           cerevisiae YKR014c YPT52 GTP-binding protein
          Length = 215

 Score =  106 bits (264), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 60/170 (35%), Positives = 90/170 (52%), Gaps = 8/170 (4%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIV---NDDKVATMQVWDT 64
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ V +   N+D V   ++WDT
Sbjct: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63

Query: 65  AGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILA 124
           AGQER++SL   +YR A+  ++VYDVT   S    +SW  E     N    E     ++ 
Sbjct: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQEL---QNKVGDEELVIYLVG 120

Query: 125 NXXXXXXXXXXXXXXXAQEQAKSLGNVPLFF--TSAKDSINVQDAFEEIA 172
           N                +E A+      L F   SAK    V+D F+EI 
Sbjct: 121 NKVDIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIG 170

>Smik_14.234 Chr14 (430086..430748) [663 bp, 220 aa] {ON} YNL093W
           (REAL)
          Length = 220

 Score =  103 bits (258), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 110/214 (51%), Gaps = 20/214 (9%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
           +K+++LG+S VGK+S++ R+V+D + +  + TIGA FLTK +I  DDKV   ++WDTAGQ
Sbjct: 13  IKLVLLGESAVGKSSIVLRFVSDDFRESREPTIGAAFLTKRII-RDDKVIKFEIWDTAGQ 71

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXX 127
           ERF  L   +YR A   ++V+DVT+  SF   + W  E  +H  V   +     ++ N  
Sbjct: 72  ERFAPLAPMYYRNAQAALVVFDVTDDGSFHKAQDWIQE--LHEKVG--DNIVIALVGNKI 127

Query: 128 XXXXXXXXXXXXXAQE-QAKSL---GNVPLFFTSAKDSINVQDAFEEIA-------RSAL 176
                         +E + ++L    N+  F  SAK   N+ + F+++        +   
Sbjct: 128 DLLNIQGENSNRAVKEAELQNLCKRENLLYFEASAKTGENIHEIFQKLGQKIPYPQKCTR 187

Query: 177 QQSQSDADAYED---DLSEAINIQLDGEPSSCNC 207
           Q S  D    +D   DL EA  ++   E  +CNC
Sbjct: 188 QNSNHDLTITDDQRIDL-EATTVEGTRETGTCNC 220

>Suva_14.247 Chr14 (448490..449146) [657 bp, 218 aa] {ON} YNL093W
           (REAL)
          Length = 218

 Score =  103 bits (256), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 62/209 (29%), Positives = 103/209 (49%), Gaps = 12/209 (5%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
           +KV++LG+S VGK+S++ R+V++ ++Q  + TIGA FLTK +  ND+ +   ++WDTAGQ
Sbjct: 13  IKVVLLGESAVGKSSIVLRFVSNDFTQSREPTIGAAFLTKRISRNDEAIK-FEIWDTAGQ 71

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXX 127
           ERF  L   +YR A   ++V+D+TN +SF   ++W ++  +H  V +      V      
Sbjct: 72  ERFAPLAPMYYRNAQAALVVFDITNEQSFHKAQNWVEQ--LHERVGNHIIIALVGNKIDL 129

Query: 128 XXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQSDADAYE 187
                          E      N+  F TSAK   N+ + F+ I        Q+     +
Sbjct: 130 LSMQNVNRAVRIEVVEDLCQRENLLYFETSAKTGENIHEVFQAIGEKTPYPKQNTRRNSD 189

Query: 188 DDLS---------EAINIQLDGEPSSCNC 207
            DL+         E+  ++   E   C+C
Sbjct: 190 HDLTITDDQRIDLESTTVEGARETGGCSC 218

>CAGL0J08635g Chr10 complement(856102..856728) [627 bp, 208 aa] {ON}
           highly similar to uniprot|P36017 Saccharomyces
           cerevisiae YOR089c VPS21 GTP-binding protein
          Length = 208

 Score =  103 bits (256), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 67/207 (32%), Positives = 105/207 (50%), Gaps = 13/207 (6%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
           LK+++LG++ VGK+S++ R+V++ +S+  + TIGA FLT+ V +N+  V   ++WDTAGQ
Sbjct: 8   LKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVTINEHTV-KFEIWDTAGQ 66

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXX 127
           ERF SL   +YR A   ++VYDVT  +SF   + W  E    A   S +    ++     
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELQEQA---SKDIIIALVGNKID 123

Query: 128 XXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAF----EEIARSALQQSQSDA 183
                          E+     N+  F TSAK   N+ D F    E++      Q+    
Sbjct: 124 VLENGTERSVSREEAEKLAEEENLLFFETSAKSGENITDVFLAIGEKVPLKTANQANVPN 183

Query: 184 DAYED---DLSEAINIQLDGEPSSCNC 207
           +A E+   DL+  +N       SSC+C
Sbjct: 184 NANENQRVDLTSVVNN--PAANSSCSC 208

>KAFR0C04310 Chr3 (855871..856470) [600 bp, 199 aa] {ON} Anc_1.338
           YBR264C
          Length = 199

 Score =  102 bits (254), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 67/205 (32%), Positives = 104/205 (50%), Gaps = 21/205 (10%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
           LK+++LG+S VGK+S++ R+V  K+ Q+  ATIGA F +K + ++D K   +++WDTAGQ
Sbjct: 11  LKLVLLGESSVGKSSIVTRFVTGKF-QKNNATIGAAFTSKSIKLDDYKEVNLEIWDTAGQ 69

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXX 127
           ER++SL   +YR  D  ++V+DVTN +S +  +SW DE   +           +++AN  
Sbjct: 70  ERYRSLAPMYYRETDVALVVFDVTNKRSLERAQSWIDELNFYIVSERQHAVKIMLVANKA 129

Query: 128 XXXXXXXXXXXXXAQEQAKSLGNVPLFFT--SAKDSINVQDAFEEIARSALQQSQSDADA 185
                                 NV L FT  SAK    +Q+ F++I     + S    D 
Sbjct: 130 DLITGMDIDT------------NVDLSFTKVSAKTGEGIQELFDQILSQIPEDSFRSPD- 176

Query: 186 YEDDLSEAINIQLDGEPSS---CNC 207
              D    I+I  D   S+   C C
Sbjct: 177 --HDNKNVISINKDNATSNVSYCTC 199

>KAFR0J01850 Chr10 complement(356911..357540) [630 bp, 209 aa] {ON}
           Anc_2.196 YNL093W
          Length = 209

 Score =  102 bits (254), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 110/214 (51%), Gaps = 12/214 (5%)

Query: 1   MSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQ 60
           MS     +K+++LG++ VGK+S++ R+V++ +S+  + TIGA FLT+ V +N++ +   +
Sbjct: 1   MSNPITSIKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVNINNNTI-KFE 59

Query: 61  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPF 120
           +WDTAGQERF SL   +YR A   ++VYD+T  +SF   + W  E  +H   S  +    
Sbjct: 60  IWDTAGQERFASLAPMYYRNAQAALVVYDITKPQSFIKARHWVKE--LHEQAS--KDIII 115

Query: 121 VILANXXXXXXXXXXXXXXXAQEQAKSLGNVPLFF--TSAKDSINVQDAF----EEIARS 174
            ++ N                +E  +      L F  TSAK + NV D F    E+I   
Sbjct: 116 ALVGNKVDIIENDESERKVAREEGERLAEEEGLIFFETSAKTAENVNDVFLNIGEKIPLK 175

Query: 175 ALQQSQSDADAYEDD-LSEAINIQLDGEPSSCNC 207
               S +D    ED  ++ A +     E SSC+C
Sbjct: 176 NDNSSPNDTTITEDQRINLAASANATSEASSCSC 209

>NCAS0B06720 Chr2 complement(1278798..1279436) [639 bp, 212 aa] {ON}
           Anc_2.196
          Length = 212

 Score =  102 bits (254), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 69/212 (32%), Positives = 109/212 (51%), Gaps = 19/212 (8%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
           +K+++LG++ VGK+S++ R+V++ +S+  + TIGA FLT+ V +ND+ V   ++WDTAGQ
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVNINDNTV-KFEIWDTAGQ 66

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXX 127
           ERF SL   +YR A   ++VYDVT  +SF   + W  E    AN    +     ++ N  
Sbjct: 67  ERFASLAPMYYRNAQAALIVYDVTKPQSFIKARHWIKELHEQAN----KDMIIALVGNKV 122

Query: 128 XXXXXXXXXXXXXAQEQAKSLGNVPLFF--TSAKDSINVQDAFEEIAR------SALQQS 179
                         +E  K      L F  TSAK  +NV + F  I        +  Q++
Sbjct: 123 DVLENNEDERKVAREEGEKLAEEEGLLFFETSAKTGLNVTETFVAIGEKIPLKTAGDQET 182

Query: 180 QSDADAYED----DLSEAINIQLDGEPSSCNC 207
            S+  A  D    DL+ + N    G+ + C+C
Sbjct: 183 DSNGVAISDEQRIDLANSGNAA--GQTAGCSC 212

>YOR089C Chr15 complement(490196..490828) [633 bp, 210 aa] {ON}
           VPS21Rab family GTPase required for endocytic transport
           and for sorting of vacuolar hydrolases; localized in
           endocytic intermediates; detected in mitochondria;
           geranylgeranylation required for membrane association;
           mammalian Rab5 homolog
          Length = 210

 Score =  102 bits (253), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 68/210 (32%), Positives = 110/210 (52%), Gaps = 17/210 (8%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
           +K+++LG++ VGK+S++ R+V++ +++  + TIGA FLT+ V +N+  V   ++WDTAGQ
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVTINEHTV-KFEIWDTAGQ 66

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXX 127
           ERF SL   +YR A   ++VYDVT  +SF   + W  E  +H   S       +I     
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKE--LHEQASK----DIIIALVGN 120

Query: 128 XXXXXXXXXXXXXAQEQAKSLGNVP--LFF-TSAKDSINVQDAFEEIA-----RSALQQS 179
                        A+E+ + L      LFF TSAK   NV D F  I      ++A +Q+
Sbjct: 121 KIDMLQEGGERKVAREEGEKLAEEKGLLFFETSAKTGENVNDVFLGIGEKIPLKTAEEQN 180

Query: 180 QSDADAYEDDLSEAINIQLDGEP--SSCNC 207
            +  +   ++    +N   DG    S+C+C
Sbjct: 181 SASNERESNNQRVDLNAANDGTSANSACSC 210

>AER434C Chr5 complement(1466442..1467052,1467106..1467154) [660 bp,
           219 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YGL210W (YPT32) and YER031C (YPT31); 1-intron
          Length = 219

 Score =  102 bits (253), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 67/205 (32%), Positives = 111/205 (54%), Gaps = 18/205 (8%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           + K++++GDSGVGK++L+ R+  D+++   K+TIG +F T+ + V   KV   Q+WDTAG
Sbjct: 14  LFKIVLIGDSGVGKSNLLSRFTTDEFNVNSKSTIGVEFATRTIEVEGKKVKA-QIWDTAG 72

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANX 126
           QER++++  A+YRGA   ++VYD++   S++N   W  E   +A+    E     ++ N 
Sbjct: 73  QERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENAD----ENVAVGLIGN- 127

Query: 127 XXXXXXXXXXXXXXAQEQAKSL--GNVPLFF-TSAKDSINVQDAFEEIARSALQQ-SQSD 182
                           ++AK+   GN  LF  TSA ++ NV  AF E+  +  Q  S++ 
Sbjct: 128 ----KSDLAHLRAVPTDEAKNFAQGNQMLFTETSALNAENVDLAFRELITAIYQMVSKNQ 183

Query: 183 ADAYEDDLSEAI----NIQLDGEPS 203
            D  E++ S  +     I L   PS
Sbjct: 184 VDLSENNGSGTVPRGPTISLAPAPS 208

>KLTH0G01760g Chr7 (132121..132166,132307..132917) [657 bp, 218 aa]
           {ON} highly similar to uniprot|P51996 Saccharomyces
           cerevisiae YGL210W YPT32 probably involved in
           intra-Golgi transport or in the formation of transport
           vesicles at the most distal Golgi compartment; ras-like
           GTPase, highly homologous to YPT31
          Length = 218

 Score =  101 bits (252), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 61/193 (31%), Positives = 107/193 (55%), Gaps = 16/193 (8%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           + K++++GDSGVGK++L+ R+  ++++ + K+TIG +F T+ + V   K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTNEFNMESKSTIGVEFATRTIEVEGKKIKA-QIWDTAG 71

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANX 126
           QER++++  A+YRGA   ++VYD++   S++N   W  E   +A+    E     ++ N 
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENAD----ENVAVGLIGN- 126

Query: 127 XXXXXXXXXXXXXXAQEQAKSLG--NVPLFF-TSAKDSINVQDAFEEIARSALQ---QSQ 180
                           ++AK+    N  LF  TSA +S NV  AF E+  +  Q   + Q
Sbjct: 127 ----KSDLAHLRAVPTDEAKNFAQENQLLFTETSALNSENVDQAFRELITAIYQMVSKHQ 182

Query: 181 SDADAYEDDLSEA 193
            D + Y ++  +A
Sbjct: 183 VDLNEYGNNAGQA 195

>KAFR0A03560 Chr1 (729254..729877) [624 bp, 207 aa] {ON} Anc_1.289
           YKR014C
          Length = 207

 Score =  101 bits (251), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 95/174 (54%), Gaps = 14/174 (8%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDK---VATMQVWDT 64
            K+++LGDS VGK+S+++R+V D +    ++TIGA FL++ + +ND+    +   ++WDT
Sbjct: 4   FKLVLLGDSSVGKSSIVNRFVKDSFEDLRESTIGAAFLSQTIKLNDNGKEVIVKFEIWDT 63

Query: 65  AGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILA 124
           AGQER++SL   +YR A+  ++VYD+T   S +  K+W +E     N    +     ++ 
Sbjct: 64  AGQERYKSLAPMYYRNANAALVVYDITELDSLNKAKTWVEEL---KNKVGDDNIVIYLVG 120

Query: 125 NXX---XXXXXXXXXXXXXAQEQAKSLGNVPLFF--TSAKDSINVQDAFEEIAR 173
           N                  A+E AK  G   L F  TSAK   N+++ F+EI  
Sbjct: 121 NKLDVCEKDSSKRLVSLEGAKEYAKEQG---LLFIETSAKTGANIKETFQEIGE 171

>Smik_5.154 Chr5 complement(218975..219646) [672 bp, 223 aa] {ON}
           YER031C (REAL)
          Length = 223

 Score =  101 bits (252), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 99/175 (56%), Gaps = 13/175 (7%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           + K++++GDSGVGK++L+ R+  ++++   K+TIG +F T+ + + D K    Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEI-DGKRIKAQIWDTAG 71

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANX 126
           QER++++  A+YRGA   ++VYD++   S++N   W  E   +A+    +     ++ N 
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENAD----DNVAVGLIGN- 126

Query: 127 XXXXXXXXXXXXXXAQEQAKSLG--NVPLFF-TSAKDSINVQDAFEEIARSALQQ 178
                           E+AK+    N  LF  TSA +S NV  AFEE+  +  Q+
Sbjct: 127 ----KSDLAHLRAVPTEEAKTFAQENQLLFTETSALNSENVDKAFEELINTIYQK 177

>Suva_7.51 Chr7 (90232..90897) [666 bp, 221 aa] {ON} YGL210W (REAL)
          Length = 221

 Score =  101 bits (251), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 74/105 (70%), Gaps = 1/105 (0%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           + K++++GDSGVGK++L+ R+  D+++ + K+TIG +F T+ + V D K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVEDKKIKA-QIWDTAG 71

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHAN 111
           QER++++  A+YRGA   ++VYD++   S++N   W  E   +A+
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENAD 116

>Skud_5.140 Chr5 complement(211975..212646) [672 bp, 223 aa] {ON}
           YER031C (REAL)
          Length = 223

 Score =  101 bits (251), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 57/175 (32%), Positives = 100/175 (57%), Gaps = 13/175 (7%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           + K++++GDSGVGK++L+ R+  ++++   K+TIG +F T+ + + D K    Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEI-DGKRIKAQIWDTAG 71

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANX 126
           QER++++  A+YRGA   ++VYD++   S++N   W  E   +A+    +     ++ N 
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENAD----DNVAVGLIGN- 126

Query: 127 XXXXXXXXXXXXXXAQEQAKSLG--NVPLFF-TSAKDSINVQDAFEEIARSALQQ 178
                           E++K+    N  LF  TSA +S NV +AFEE+  +  Q+
Sbjct: 127 ----KSDLAHLRAVPTEESKTFAQENQLLFTETSALNSENVDEAFEELINTIYQK 177

>Skud_14.238 Chr14 (440139..440801) [663 bp, 220 aa] {ON} YNL093W
           (REAL)
          Length = 220

 Score =  101 bits (251), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 61/213 (28%), Positives = 106/213 (49%), Gaps = 18/213 (8%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
           +K+++LG+S VGK+S++ R++++ +++  + TIGA FLTK  I  DDK    ++WDTAGQ
Sbjct: 13  IKLVLLGESAVGKSSIVLRFISNDFTESREPTIGAAFLTKR-ITRDDKAIKFEIWDTAGQ 71

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXX 127
           ERF  L   +YR A   ++V+D+TN +SF   + W +E  +H  +   +     ++ N  
Sbjct: 72  ERFAPLAPMYYRNAQAALVVFDITNEQSFRKAQDWVEE--LHEKLG--DNIIIALVGNKM 127

Query: 128 XXXXXXXXXXXXXAQE-QAKSL---GNVPLFFTSAKDSINVQDAFEEIARSALQQSQSDA 183
                          E + ++L    N+  F  SAK   N+ + F+ +       + +  
Sbjct: 128 DLLTMQGEISNRAVNEDEIQNLCQQENLLYFEVSAKTGKNIHEVFQAVGEKIPFPTHNVG 187

Query: 184 DAYEDDLS---------EAINIQLDGEPSSCNC 207
              E DL+         E+  ++   E   CNC
Sbjct: 188 RTSEHDLTITDDQRIDLESTTVEGARETGGCNC 220

>KLLA0D02376g Chr4 (201512..202135) [624 bp, 207 aa] {ON} similar to
           uniprot|P36018 Saccharomyces cerevisiae YKR014C YPT52
           rab5-like GTPase involved in vacuolar protein sorting
           and endocytosis probable purine nucleotide- binding
           protein
          Length = 207

 Score =  100 bits (250), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 71/107 (66%), Gaps = 3/107 (2%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVN---DDKVATMQVWDT 64
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + ++   D++V   ++WDT
Sbjct: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63

Query: 65  AGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHAN 111
           AGQER++SL   +YR A+  ++VYDVT   S    K W DE     N
Sbjct: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVN 110

>SAKL0E09922g Chr5 complement(829249..829890) [642 bp, 213 aa] {ON}
           similar to uniprot|P36017 Saccharomyces cerevisiae
           YOR089C VPS21 Rab5-like GTPase involved in vacuolar
           protein sorting and endocytosis post vesicle
           internalization geranylgeranylated geranylgeranylation
           required for membrane association
          Length = 213

 Score =  100 bits (250), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 68/211 (32%), Positives = 102/211 (48%), Gaps = 17/211 (8%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
           +K+++LG++ VGK+S++ R+V++ +++  + TIGA FLT+ V + D  +   ++WDTAGQ
Sbjct: 9   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVNMGDHTI-KFEIWDTAGQ 67

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXX 127
           ERF SL   +YR A   ++VYDVT  +SF   + W  E    AN    +     ++ N  
Sbjct: 68  ERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQAN----KGIIIALVGNKL 123

Query: 128 XXXXXXXXXXXXXAQEQAKSLGNVPLFF-TSAKDSINVQDAFEEIARS-------ALQQS 179
                         + +  +     LFF TSAK   NV + F  I           LQQ 
Sbjct: 124 DLLENGGERKVAKEEGEKLAEEEGLLFFETSAKTGDNVNEVFLAIGEKIPLHTPEELQQQ 183

Query: 180 QSDADAYED---DLSEAINIQLDGEPSSCNC 207
           Q      ED   DL+   N    G    CNC
Sbjct: 184 QGGLRVTEDSRVDLTANANGS-TGAAGPCNC 213

>KLTH0G08206g Chr7 (666127..666765) [639 bp, 212 aa] {ON} highly
           similar to uniprot|P36017 Saccharomyces cerevisiae
           YOR089C VPS21 Rab5-like GTPase involved in vacuolar
           protein sorting and endocytosis post vesicle
           internalization geranylgeranylated geranylgeranylation
           required for membrane association
          Length = 212

 Score =  100 bits (249), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 69/212 (32%), Positives = 105/212 (49%), Gaps = 19/212 (8%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
           +K+++LG++ VGK+S++ R+V++ +++  + TIGA FLT+ V + D  +   ++WDTAGQ
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVNMGDHTI-KFEIWDTAGQ 66

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXX 127
           ERF SL   +YR A   ++VYDVT  +SF   + W  E    A+         +I     
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELREQASKD------IIIALVGN 120

Query: 128 XXXXXXXXXXXXXAQEQAKSLGNVP--LFF-TSAKDSINVQDAFEEIARSALQQSQSDAD 184
                        A E+A++L +    LFF TSAK   NV + F  I +    +S     
Sbjct: 121 KLDMVETGAERKVALEEAENLASQEGLLFFETSAKTGSNVNEVFLAIGQKIPLKSAQQQQ 180

Query: 185 A--------YEDDLSEAINIQLDGE-PSSCNC 207
                      DD    +    DG  PSSCNC
Sbjct: 181 QGQGSSGLRINDDSRVDLRAAQDGPAPSSCNC 212

>TPHA0P00950 Chr16 complement(193256..193897) [642 bp, 213 aa] {ON}
           Anc_2.196 YNL093W
          Length = 213

 Score =  100 bits (249), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 88/164 (53%), Gaps = 8/164 (4%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
           +K+++LG++ VGK+S++ R+V++ +S+  + TIGA FLT+ V + DD     ++WDTAGQ
Sbjct: 8   VKLVLLGEAAVGKSSIVVRFVSNDFSENKEPTIGAAFLTQRVNI-DDHTIKFEIWDTAGQ 66

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXX 127
           ERF SL   +YR A   ++VYDVT  +SF   + W  E  +H   S        +  N  
Sbjct: 67  ERFASLAPMYYRNAQAALIVYDVTKPQSFIKARHWVKE--LHEQASG--DIVIALAGNKV 122

Query: 128 XXXXXXXXXXXXXAQEQAKSLG---NVPLFFTSAKDSINVQDAF 168
                        A E+ + L    N+  F TSAK   NV + F
Sbjct: 123 DLIEENGENERKVATEEGQKLADEENLLFFETSAKTGYNVNEIF 166

>Ecym_5362 Chr5 (735204..735833) [630 bp, 209 aa] {ON} similar to
           Ashbya gossypii ACL084C
          Length = 209

 Score =  100 bits (249), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 66/209 (31%), Positives = 105/209 (50%), Gaps = 16/209 (7%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
           +K+++LG++ VGK+S++ R+V++ +S+  + TIGA FLT+ V + +  +   ++WDTAGQ
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVNMGNQTI-KFEIWDTAGQ 66

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXX 127
           ERF SL   +YR A   ++VYD+T  +SF   + W  E    A+ S       +I     
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDITKPQSFIKARHWVKELHEQASKS------IIIALVGN 120

Query: 128 XXXXXXXXXXXXXAQEQAKSLGNVP--LFF-TSAKDSINVQDAFEEIARSALQQSQSDAD 184
                        A+E+A+SL      LFF TSAK   NV + F  I      + Q   +
Sbjct: 121 KLDLLESDEERKVAREEAESLAQEEGLLFFETSAKTGDNVNEVFLGIGEKIPLKQQEVQN 180

Query: 185 AYEDDLSEAINIQLD------GEPSSCNC 207
                ++E   + L+         S CNC
Sbjct: 181 GNGASVNEVSRVDLNVAGSSGANSSGCNC 209

>KLLA0C13728g Chr3 (1173329..1173955) [627 bp, 208 aa] {ON} highly
           similar to uniprot|P36017 Saccharomyces cerevisiae
           YOR089C VPS21 Rab5-like GTPase involved in vacuolar
           protein sorting and endocytosis post vesicle
           internalization geranylgeranylated geranylgeranylation
           required for membrane association
          Length = 208

 Score =  100 bits (248), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 69/208 (33%), Positives = 106/208 (50%), Gaps = 15/208 (7%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
           +K+++LG++ VGK+S++ R+V++ +++  + TIGA FLT+ V + D  +   ++WDTAGQ
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVNMADHTI-KFEIWDTAGQ 66

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXX 127
           ERF SL   +YR A   ++VYDVT  +SF   + W  E  +H   S       VI     
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKE--LHEQASK----GIVIALVGN 120

Query: 128 XXXXXXXXXXXXXAQEQAKSLG---NVPLFFTSAKDSINVQDAF----EEIARSALQQSQ 180
                        A+E+A+ L    N+  F TSAK   NV + F    E+I       S 
Sbjct: 121 KMDLLESEEDRKVAKEEAEKLSQEENLLFFETSAKTGDNVNEVFLAIGEKIPLKKSDGSN 180

Query: 181 SDADAYEDDLSEAINIQLD-GEPSSCNC 207
           +D     +D    +N   D   P+SC C
Sbjct: 181 TDGLRGTEDGRIDLNKPDDTSNPNSCGC 208

>YER031C Chr5 complement(214076..214747) [672 bp, 223 aa] {ON}
           YPT31Rab family GTPase, very similar to Ypt32p; involved
           in the exocytic pathway; mediates intra-Golgi traffic or
           the budding of post-Golgi vesicles from the trans-Golgi
          Length = 223

 Score =  100 bits (249), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 57/175 (32%), Positives = 99/175 (56%), Gaps = 13/175 (7%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           + K++++GDSGVGK++L+ R+  ++++   K+TIG +F T+ + + D K    Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEI-DGKRIKAQIWDTAG 71

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANX 126
           QER++++  A+YRGA   ++VYD++   S++N   W  E   +A+    +     ++ N 
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENAD----DNVAVGLIGN- 126

Query: 127 XXXXXXXXXXXXXXAQEQAKSLG--NVPLFF-TSAKDSINVQDAFEEIARSALQQ 178
                           E++K+    N  LF  TSA +S NV  AFEE+  +  Q+
Sbjct: 127 ----KSDLAHLRAVPTEESKTFAQENQLLFTETSALNSENVDKAFEELINTIYQK 177

>Suva_5.128 Chr5 complement(190103..190774) [672 bp, 223 aa] {ON}
           YER031C (REAL)
          Length = 223

 Score =  100 bits (249), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 57/175 (32%), Positives = 99/175 (56%), Gaps = 13/175 (7%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           + K++++GDSGVGK++L+ R+  ++++   K+TIG +F T+ + + D K    Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEI-DGKRIKAQIWDTAG 71

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANX 126
           QER++++  A+YRGA   ++VYD++   S++N   W  E   +A+    +     ++ N 
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENAD----DNVAVGLIGN- 126

Query: 127 XXXXXXXXXXXXXXAQEQAKSLG--NVPLFF-TSAKDSINVQDAFEEIARSALQQ 178
                           E++K+    N  LF  TSA +S NV  AFEE+  +  Q+
Sbjct: 127 ----KSDLAHLRAVPTEESKTFAQENQLLFTETSALNSENVDKAFEELINTIYQK 177

>Kpol_1016.24 s1016 (61782..62417) [636 bp, 211 aa] {ON}
           (61782..62417) [636 nt, 212 aa]
          Length = 211

 Score =  100 bits (248), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 70/100 (70%), Gaps = 1/100 (1%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVN-DDKVATMQVWDTAG 66
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + ++ DD V   ++WDTAG
Sbjct: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQSIKLDEDDTVIKFEIWDTAG 63

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEF 106
           QER++SL   +YR A+  ++VYD+T   S    +SW +E 
Sbjct: 64  QERYKSLAPMYYRNANAALVVYDITASDSLSKAQSWVEEL 103

>Kwal_23.2978 s23 (97956..98591) [636 bp, 211 aa] {ON} YOR089C
           (VPS21) - small GTP-binding protein; geranylgeranylated;
           geranylgeranylation required for membrane association;
           also involved in endocytosis post vesicle
           internalization [contig 247] FULL
          Length = 211

 Score = 99.8 bits (247), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 108/214 (50%), Gaps = 24/214 (11%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
           +K+++LG++ VGK+S++ R+V++ +++  + TIGA FLT+ V + D  +   ++WDTAGQ
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVNMGDHTI-KFEIWDTAGQ 66

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXX 127
           ERF SL   +YR A   ++VYDVT  +SF   + W  E    A+         VI     
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELREQASKD------IVIALVGN 120

Query: 128 XXXXXXXXXXXXXAQEQAKSLG---NVPLFFTSAKDSINVQDAF----EEIARSALQQSQ 180
                        A+E+A++L     +  F TSAK   NV + F    ++I   + QQ Q
Sbjct: 121 KLDIVESGGERKVAREEAENLAAQEQLLFFETSAKTGSNVNEVFLGIGQKIPLKSPQQQQ 180

Query: 181 SDA-------DAYEDDLSEAINIQLDGEPSSCNC 207
           +         D    DL  A   Q +   S+CNC
Sbjct: 181 AQGPSGLRINDDARVDLRAA---QGNSAQSNCNC 211

>TPHA0D03430 Chr4 complement(719751..720422) [672 bp, 223 aa] {ON}
           Anc_3.521 YER031C
          Length = 223

 Score =  100 bits (248), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 98/174 (56%), Gaps = 13/174 (7%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           + K++++GDSGVGK++L+ R+  + ++ + K+TIG +F T+ + V + K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTNDFNLESKSTIGVEFATRTIEVENKKIKA-QIWDTAG 71

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANX 126
           QER++++  A+YRGA   ++VYD++   S++N   W  E   +A+    +     ++ N 
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKQSSYENCNHWLTELRENAD----DNVAVGLIGN- 126

Query: 127 XXXXXXXXXXXXXXAQEQAKSLG--NVPLFF-TSAKDSINVQDAFEEIARSALQ 177
                           E+AK+    N  LF  TSA +S NV  AF E+  S  Q
Sbjct: 127 ----KSDLSHLRAVPTEEAKNFAQENQLLFTETSALNSENVDQAFRELITSIYQ 176

>CAGL0K09394g Chr11 complement(930063..930728) [666 bp, 221 aa] {ON}
           highly similar to uniprot|P51996 Saccharomyces
           cerevisiae YGL210w YPT32 or uniprot|P38555 Saccharomyces
           cerevisiae YER031c YPT31
          Length = 221

 Score = 99.8 bits (247), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 106/189 (56%), Gaps = 17/189 (8%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           + K++++GDSGVGK++L+ R+  ++++ + K+TIG +F T+ + V D K+   Q+WDTAG
Sbjct: 14  LFKIVLIGDSGVGKSNLLSRFTTNEFNLESKSTIGVEFATRTIKVEDKKIKA-QIWDTAG 72

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANX 126
           QER++++  A+YRGA   ++VYD++   +++N   W  E   +A+    +     ++ N 
Sbjct: 73  QERYRAITSAYYRGAVGALIVYDISKSGTYENCNHWLTELKENAD----DNVAIGLIGN- 127

Query: 127 XXXXXXXXXXXXXXAQEQAKSLGNV-PLFF--TSAKDSINVQDAFEEIARSALQQSQSDA 183
                           E+A+   +   LFF  TSA +S NV  AF E+    ++Q     
Sbjct: 128 ----KSDLEHLRAVPTEEARGFASENQLFFTETSALNSENVDLAFREL----IEQIYKMV 179

Query: 184 DAYEDDLSE 192
           + ++ DL E
Sbjct: 180 NKHQVDLGE 188

>YGL210W Chr7 (93792..94460) [669 bp, 222 aa] {ON}  YPT32Rab family
           GTPase, very similar to Ypt31p; involved in the exocytic
           pathway; mediates intra-Golgi traffic or the budding of
           post-Golgi vesicles from the trans-Golgi
          Length = 222

 Score = 99.8 bits (247), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 74/105 (70%), Gaps = 1/105 (0%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           + K++++GDSGVGK++L+ R+  D+++ + K+TIG +F T+ + V + K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVENKKIKA-QIWDTAG 71

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHAN 111
           QER++++  A+YRGA   ++VYD++   S++N   W  E   +A+
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENAD 116

>Skud_7.58 Chr7 (99129..99797) [669 bp, 222 aa] {ON} YGL210W (REAL)
          Length = 222

 Score = 99.8 bits (247), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 74/105 (70%), Gaps = 1/105 (0%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           + K++++GDSGVGK++L+ R+  D+++ + K+TIG +F T+ + V + K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVENKKIKA-QIWDTAG 71

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHAN 111
           QER++++  A+YRGA   ++VYD++   S++N   W  E   +A+
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENAD 116

>Smik_7.53 Chr7 (88592..89260) [669 bp, 222 aa] {ON} YGL210W (REAL)
          Length = 222

 Score = 99.8 bits (247), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 74/105 (70%), Gaps = 1/105 (0%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           + K++++GDSGVGK++L+ R+  D+++ + K+TIG +F T+ + V + K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVENKKIKA-QIWDTAG 71

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHAN 111
           QER++++  A+YRGA   ++VYD++   S++N   W  E   +A+
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENAD 116

>YNL093W Chr14 (449868..450530) [663 bp, 220 aa] {ON}  YPT53Rab
           family GTPase, similar to Ypt51p and Ypt52p and to
           mammalian rab5; required for vacuolar protein sorting
           and endocytosis
          Length = 220

 Score = 99.8 bits (247), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 67/99 (67%), Gaps = 1/99 (1%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
           +KV++LG+S VGK+S++ R+V+D + +  + TIGA FLTK  I  D KV   ++WDTAGQ
Sbjct: 13  IKVVLLGESAVGKSSIVLRFVSDDFKESKEPTIGAAFLTKR-ITRDGKVIKFEIWDTAGQ 71

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEF 106
           ERF  L   +YR A   ++V+DVTN  SF   ++W +E 
Sbjct: 72  ERFAPLAPMYYRNAQAALVVFDVTNEGSFYKAQNWVEEL 110

>AAL176C Chr1 complement(31588..32205) [618 bp, 205 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKR014C
           (YPT52)
          Length = 205

 Score = 99.0 bits (245), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 60/203 (29%), Positives = 107/203 (52%), Gaps = 6/203 (2%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIV--NDDKVATMQVWDTA 65
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + +  +DD +   ++WDTA
Sbjct: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTA 63

Query: 66  GQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILAN 125
           GQER++SL   +YR A+  ++VYDVT   S    +SW +E  + + V   +   F++   
Sbjct: 64  GQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNE--LKSKVGDEDLVIFLVGNK 121

Query: 126 XXXXXXXXXXXXXXXAQEQAKSLGNVPLFF-TSAKDSINVQDAFEEIARSALQQSQSDAD 184
                           + QA +  +  +F   SAK    + D F+ I    L + + ++ 
Sbjct: 122 LDLVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIG-GKLYEQRRESL 180

Query: 185 AYEDDLSEAINIQLDGEPSSCNC 207
           A +   S +I +Q      + +C
Sbjct: 181 AAQPQHSSSIQLQRPTTNDATSC 203

>SAKL0F01914g Chr6 (162387..162432,162627..163246) [666 bp, 221 aa]
           {ON} highly similar to uniprot|P51996 Saccharomyces
           cerevisiae YGL210W YPT32 probably involved in
           intra-Golgi transport or in the formation of transport
           vesicles at the most distal Golgi compartment ras-like
           GTPase highly homologous to YPT31
          Length = 221

 Score = 99.4 bits (246), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 103/186 (55%), Gaps = 16/186 (8%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           + K++++GDSGVGK++L+ R+  ++++ + K+TIG +F T+ + V   K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTNEFNMESKSTIGVEFATRTIEVEGKKIKA-QIWDTAG 71

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANX 126
           QER++++  A+YRGA   ++VYD++   S++N   W  E   +A+    E     ++ N 
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSNSYENCNHWLTELRENAD----ENVAVGLIGN- 126

Query: 127 XXXXXXXXXXXXXXAQEQAKSLG--NVPLFF-TSAKDSINVQDAFEEIARSALQ---QSQ 180
                           ++AK+    N  LF  TSA +S NV  AF E+  +  Q   + Q
Sbjct: 127 ----KSDLAHLRAVPTDEAKNFAQENQLLFTETSALNSENVDLAFRELITAIYQMVSKHQ 182

Query: 181 SDADAY 186
            D + Y
Sbjct: 183 VDLNEY 188

>Smik_15.269 Chr15 complement(451402..452034) [633 bp, 210 aa] {ON}
           YOR089C (REAL)
          Length = 210

 Score = 99.0 bits (245), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 59/164 (35%), Positives = 90/164 (54%), Gaps = 10/164 (6%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
           +K+++LG++ VGK+S++ R+V++ +++  + TIGA FLT+ V +N+  V   ++WDTAGQ
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVTINEHTV-KFEIWDTAGQ 66

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXX 127
           ERF SL   +YR A   ++VYDVT  +SF   + W  E  +H   S       +I     
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKE--LHEQASK----DIIIALVGN 120

Query: 128 XXXXXXXXXXXXXAQEQAKSLGNVP--LFF-TSAKDSINVQDAF 168
                        A+E+ + L      LFF TSAK   NV D F
Sbjct: 121 KIDMLQEGGERKVAREEGEKLAEEKGLLFFETSAKTGENVNDVF 164

>Suva_8.142 Chr8 complement(247554..248183) [630 bp, 209 aa] {ON}
           YOR089C (REAL)
          Length = 209

 Score = 99.0 bits (245), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 59/164 (35%), Positives = 91/164 (55%), Gaps = 10/164 (6%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
           +K+++LG++ VGK+S++ R+V++ +++  + TIGA FLT+ V +N+  V   ++WDTAGQ
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVTINEHTV-KFEIWDTAGQ 66

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXX 127
           ERF SL   +YR A   ++VYDVT  +SF   + W  E  +H   S       +I     
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKE--LHEQASK----DIIIALVGN 120

Query: 128 XXXXXXXXXXXXXAQEQAKSLG--NVPLFF-TSAKDSINVQDAF 168
                        A+E+ + L   N  LFF TSAK   NV + F
Sbjct: 121 KIDMLQEDGERKVAREEGEKLAEENGLLFFETSAKTGENVNNVF 164

>TBLA0C02780 Chr3 complement(668605..669267) [663 bp, 220 aa] {ON}
           Anc_1.289 YKR014C
          Length = 220

 Score = 99.0 bits (245), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 68/99 (68%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
            K+++LGDS VGK+S+++R+V D + +  ++TIGA FL++ + + +  V   ++WDTAGQ
Sbjct: 4   FKLVLLGDSSVGKSSIVNRFVKDSFDELRESTIGAAFLSQTITLKNKTVIKFEIWDTAGQ 63

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEF 106
           ER++SL   +YR A+  ++VYD+T   S    +SW DE 
Sbjct: 64  ERYKSLAPMYYRNANAALVVYDITENDSLMKAQSWVDEL 102

>Kpol_423.12 s423 (26761..27423) [663 bp, 220 aa] {ON}
           (26761..27423) [663 nt, 221 aa]
          Length = 220

 Score = 99.0 bits (245), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 97/174 (55%), Gaps = 13/174 (7%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           + K++++GDSGVGK++L+ R+  D++  + K+TIG +F T+ + V+  K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTDEFHLESKSTIGVEFATRTIDVDGKKIKA-QIWDTAG 71

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANX 126
           QER++++  A+YRGA   ++VYD++   S++N   W  E   +A+    +     ++ N 
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKQSSYENCNHWLAELRENAD----DNVAVGLIGN- 126

Query: 127 XXXXXXXXXXXXXXAQEQAKSLG--NVPLFF-TSAKDSINVQDAFEEIARSALQ 177
                           ++AK     N  LF  TSA +S NV  AF E+  S  Q
Sbjct: 127 ----KSDLSHLRAVPTDEAKKFAQENQLLFTETSALNSENVDQAFRELITSIYQ 176

>TPHA0I02780 Chr9 complement(614605..615231) [627 bp, 208 aa] {ON}
           Anc_1.289 YKR014C
          Length = 208

 Score = 98.6 bits (244), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 63/208 (30%), Positives = 110/208 (52%), Gaps = 14/208 (6%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDD-KVATMQVWDTAG 66
            K+++LGDS VGK+S+++R+V D + +  ++TIGA FL++ + + ++ +V   ++WDTAG
Sbjct: 4   FKLVLLGDSSVGKSSIVYRFVKDSFDEFRESTIGAAFLSQTITLEENNQVIKFEIWDTAG 63

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANX 126
           QER++SL   +YR A+  ++VYDVT   S    KSW +E  +   V + E    + L   
Sbjct: 64  QERYKSLAPMYYRNANAALVVYDVTAPDSLMKAKSWIEE--LKKKVGNEEL--VICLVGN 119

Query: 127 XXXXXXXXXXXXXXAQEQAKSLG---NVPLFFTSAKDSINVQDAFEEIARSALQQSQSDA 183
                           E+AK      N+  +  SAK   NV++ F++I     +  +++ 
Sbjct: 120 KVDICEEDDTKRKIEFEEAKDWANDENLLFYEVSAKTGYNVKEVFQKIGEQLYEYKKAEQ 179

Query: 184 --DAYEDDLSEAINIQLD----GEPSSC 205
                +D+ +   NI+L       P+SC
Sbjct: 180 ANKGTQDNSNITSNIRLQEPQASNPTSC 207

>Ecym_1207 Chr1 (420728..420773,421159..421766) [654 bp, 217 aa]
           {ON} similar to Ashbya gossypii AER434C  1-intron
          Length = 217

 Score = 98.6 bits (244), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 72/105 (68%), Gaps = 1/105 (0%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           + K++++GDSGVGK++L+ R+  D+++   K+TIG +F T+ + V   KV   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTDEFNVNSKSTIGVEFATRTIEVEGKKVKA-QIWDTAG 71

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHAN 111
           QER++++  A+YRGA   ++VYD++   S++N   W  E   +A+
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLAELRENAD 116

>KNAG0I01080 Chr9 (207327..208088) [762 bp, 253 aa] {ON} Anc_2.196
           YNL093W
          Length = 253

 Score = 99.0 bits (245), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 95/179 (53%), Gaps = 9/179 (5%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
           +K+++LG+  VGK+S++ R+V++ +++  + TIGA FLT+ V +N+  +   ++WDTAGQ
Sbjct: 8   IKLVLLGEVAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVNINEHTI-KFEIWDTAGQ 66

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXX 127
           ERF SL   +YR A   ++VYDVT  +SF   + W  E  +H   S       + L    
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKE--LHEQASKD---IIIALVGNK 121

Query: 128 XXXXXXXXXXXXXAQEQAKSLG---NVPLFFTSAKDSINVQDAFEEIARSALQQSQSDA 183
                        A+E+ + L    N+  F TSAK   NV + F +I  +   +  +D 
Sbjct: 122 IDMLDEDPTERKVAREEGEKLAQEENLLFFETSAKTGANVNEVFLKIGENVPLKQAADG 180

>TBLA0B01820 Chr2 complement(415800..416438) [639 bp, 212 aa] {ON}
           Anc_2.196 YNL093W
          Length = 212

 Score = 97.8 bits (242), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 65/210 (30%), Positives = 103/210 (49%), Gaps = 15/210 (7%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
           +K+++LG++ VGK+S++ R+V++ +S+  + TIGA FLT+ V + +  +   ++WDTAGQ
Sbjct: 8   VKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVNIGNHTI-KFEIWDTAGQ 66

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXX 127
           ERF SL   +YR A   ++VYDVT  +SF   + W  E    AN    +     ++ N  
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELQEQAN----KGIIIALVGNKA 122

Query: 128 XXXXXXXXXXXXXAQEQAKSLGNVPLFF-TSAKDSINVQDAFEEIARSALQQSQSDADAY 186
                         + +  +     LFF TSAK   NV + F  I      ++ S A+  
Sbjct: 123 DIIEDGEERKVAREEAEKLAEEEGLLFFETSAKTGNNVNETFLAIGEKIPLKNSSSANDQ 182

Query: 187 EDDLSEAIN--IQLDGEP-------SSCNC 207
             D +   N  I LD  P         C+C
Sbjct: 183 HHDTNNNNNQRIDLDNNPVDAASNAPGCSC 212

>Skud_15.253 Chr15 complement(446672..447301) [630 bp, 209 aa] {ON}
           YOR089C (REAL)
          Length = 209

 Score = 97.8 bits (242), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 101/186 (54%), Gaps = 11/186 (5%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
           +K+++LG++ VGK+S++ R+V++ +++  + TIGA FLT+ V +N+  V   ++WDTAGQ
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVTINEHTV-KFEIWDTAGQ 66

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXX 127
           ERF SL   +YR A   ++VYDVT  +SF   + W  E  +H   S       +I     
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKE--LHEQASK----DIIIALVGN 120

Query: 128 XXXXXXXXXXXXXAQEQAKSLGNVP--LFF-TSAKDSINVQDAFEEIA-RSALQQSQSDA 183
                        A+E+ + L      LFF TSAK   NV + F  I  +  L++++   
Sbjct: 121 KIDVLQDGGERKVAKEEGEKLAEEKGLLFFETSAKTGENVNNVFLGIGEKIPLKKAEEQN 180

Query: 184 DAYEDD 189
           +A E +
Sbjct: 181 NANEGE 186

>SAKL0D05940g Chr4 (485575..486198) [624 bp, 207 aa] {ON} highly
           similar to uniprot|Q75F92 Ashbya gossypii AAL176C
           AAL176Cp and similar to YKR014C uniprot|P36018
           Saccharomyces cerevisiae YKR014C YPT52 rab5-like GTPase
           involved in vacuolar protein sorting and endocytosis
           probable purine nucleotide-binding protein
          Length = 207

 Score = 97.4 bits (241), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 44/101 (43%), Positives = 69/101 (68%), Gaps = 2/101 (1%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVND--DKVATMQVWDTA 65
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + + D  D V   ++WDTA
Sbjct: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTA 63

Query: 66  GQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEF 106
           GQER++SL   +YR A+  ++VYDVT   S    ++W DE 
Sbjct: 64  GQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDEL 104

>Ecym_6328 Chr6 complement(629586..630203) [618 bp, 205 aa] {ON}
           similar to Ashbya gossypii AAL176C
          Length = 205

 Score = 97.1 bits (240), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 43/101 (42%), Positives = 69/101 (68%), Gaps = 2/101 (1%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVN--DDKVATMQVWDTA 65
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + +   DD +   ++WDTA
Sbjct: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLAEYDDTMIKFEIWDTA 63

Query: 66  GQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEF 106
           GQER++SL   +YR A+  ++VYDVT   S    +SW +E 
Sbjct: 64  GQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNEL 104

>TBLA0C04910 Chr3 complement(1193590..1194285) [696 bp, 231 aa] {ON}
           Anc_3.521 YER031C
          Length = 231

 Score = 97.8 bits (242), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 74/105 (70%), Gaps = 1/105 (0%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           + K++++GDSGVGK++L+ R+  ++++ + K+TIG +F T+ + V   K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTNEFNLESKSTIGVEFATRTIEVEGKKIKA-QIWDTAG 71

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHAN 111
           QER++++  A+YRGA   ++VYD++   S++N + W  E   +A+
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKPSSYENCQHWLTELRGNAD 116

>TDEL0D01570 Chr4 (310454..311107) [654 bp, 217 aa] {ON} Anc_1.289
           YKR014C
          Length = 217

 Score = 97.4 bits (241), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 64/215 (29%), Positives = 110/215 (51%), Gaps = 20/215 (9%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVND-----DKVATMQVW 62
            K+++LGDS VGK+S+++R+V + + +  ++TIGA FL++ + V +     + V   ++W
Sbjct: 4   FKLVLLGDSSVGKSSIVYRFVKNSFDEFRESTIGAAFLSQTIKVKESDDGEETVIKFEIW 63

Query: 63  DTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVI 122
           DTAGQER++SL   +YR A+  ++VYDVT   S    +SW +E     N    +     +
Sbjct: 64  DTAGQERYKSLAPMYYRNANAALVVYDVTQQDSLVKAQSWVNEL---KNKVGDDDLVICL 120

Query: 123 LANXXXX-XXXXXXXXXXXAQEQAKSLGNVP--LFF-TSAKDSINVQDAFEEIARSALQQ 178
           + N                  E+A+S  N    LF+  SAK  +NVQ  F+ I     + 
Sbjct: 121 VGNKVDLCDEDAEDNKRAVGTEEARSYANEQNLLFYEVSAKTGLNVQQIFQSIGEKLFET 180

Query: 179 SQSDADAYED----DLSEAINIQLD----GEPSSC 205
              +  A ++      ++ +N+QL      +P+SC
Sbjct: 181 KSEEIAAAKNRQIGSSNDHVNVQLQRASTNDPTSC 215

>CAGL0C02453g Chr3 (247493..248149) [657 bp, 218 aa] {ON} highly
           similar to uniprot|P38555 Saccharomyces cerevisiae
           YER031c YPT31
          Length = 218

 Score = 97.1 bits (240), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 57/175 (32%), Positives = 99/175 (56%), Gaps = 13/175 (7%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           + K++++GDSGVGK++L+ R+  ++++   K+TIG +F T+ + V+  K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTNEFNIDSKSTIGVEFATRTIDVDGKKIKA-QIWDTAG 71

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANX 126
           QER++++  A+YRGA   ++VYD++   S++N   W  E   +A+    +     ++ N 
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSSSYENCHHWLSELRENAD----DNVAVGLIGN- 126

Query: 127 XXXXXXXXXXXXXXAQEQAKSLG--NVPLFF-TSAKDSINVQDAFEEIARSALQQ 178
                           E+AK     N  LF  TSA +S NV  AF+E+  +  Q+
Sbjct: 127 ----KSDLAHLRAVPTEEAKQFASENQLLFTETSALNSDNVDLAFKELITAIHQK 177

>NCAS0B07360 Chr2 complement(1389230..1389907) [678 bp, 225 aa] {ON}
           Anc_1.338
          Length = 225

 Score = 97.1 bits (240), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 57/169 (33%), Positives = 90/169 (53%), Gaps = 12/169 (7%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEV-IVNDDKV--ATMQVWDT 64
           LK+++LG+S VGKTS++ R+   K+ Q+  ATIGA FL K +  V++D +    +++WDT
Sbjct: 23  LKLVLLGESSVGKTSIVTRFTTGKF-QRNNATIGAAFLNKNIRWVDEDNIYEVDLEIWDT 81

Query: 65  AGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILA 124
           AGQER++SL   +YR  D  ++V+DVT+  +F   +SW DE   + +    +     ++ 
Sbjct: 82  AGQERYRSLAPIYYRNTDVALIVFDVTSSNTFQKARSWVDELRSYLDNEQGKEIQLYLIG 141

Query: 125 NXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIAR 173
           N                    K +        SAK    +Q+ FEEIAR
Sbjct: 142 NKCDLEHESIAKTAILDMCTFKEV--------SAKRDEGIQELFEEIAR 182

>ZYRO0E08492g Chr5 complement(676074..676684,676766..676811) [657
           bp, 218 aa] {ON} highly similar to uniprot|P51996
           Saccharomyces cerevisiae YGL210W YPT32 probably involved
           in intra-Golgi transport or in the formation of
           transport vesicles at the most distal Golgi compartment;
           ras-like GTPase, highly homologous to YPT31
          Length = 218

 Score = 97.1 bits (240), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 72/105 (68%), Gaps = 1/105 (0%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           + K++++GDSGVGK++L+ R+  + ++ + K+TIG +F T+ + V   K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTNDFNMESKSTIGVEFATRTIEVEGKKIKA-QIWDTAG 71

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHAN 111
           QER++++  A+YRGA   ++VYD++   S++N   W  E   +A+
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKPSSYENCNHWLTELRENAD 116

>NDAI0I02910 Chr9 complement(688721..689380) [660 bp, 219 aa] {ON}
           Anc_3.521
          Length = 219

 Score = 97.1 bits (240), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 99/174 (56%), Gaps = 13/174 (7%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           + K++++GDSGVGK++L+ R+  ++++ + K+TIG +F T+ + V   K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTNEFNIESKSTIGVEFATRTIEVEGKKIKA-QIWDTAG 71

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANX 126
           QER++++  A+YRGA   ++VYD++   +++N   W  E   +A+    +     ++ N 
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSSTYENCNHWLTELKENAD----DNVAVGLIGN- 126

Query: 127 XXXXXXXXXXXXXXAQEQAK--SLGNVPLFF-TSAKDSINVQDAFEEIARSALQ 177
                           ++AK  +L N  LF  TSA +S NV  AF E+  +  Q
Sbjct: 127 ----KSDLAHLRAVPTDEAKNFALENQLLFTETSALNSENVDQAFRELITAIYQ 176

>Smik_11.271 Chr11 complement(452840..453544) [705 bp, 234 aa] {ON}
           YKR014C (REAL)
          Length = 234

 Score = 97.1 bits (240), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 43/106 (40%), Positives = 70/106 (66%), Gaps = 7/106 (6%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIV--ND-----DKVATMQ 60
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + +  ND     D +   +
Sbjct: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGGEVKDVIIKFE 63

Query: 61  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEF 106
           +WDTAGQER++SL   +YR A+  ++VYD+T   S    ++W DE 
Sbjct: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDEL 109

>Skud_11.247 Chr11 complement(445982..446686) [705 bp, 234 aa] {ON}
           YKR014C (REAL)
          Length = 234

 Score = 97.1 bits (240), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 70/106 (66%), Gaps = 7/106 (6%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIV--ND-----DKVATMQ 60
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + +  ND     D V   +
Sbjct: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNGAKDVVIKFE 63

Query: 61  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEF 106
           +WDTAGQER++SL   +YR A+  ++VYD+T   S    ++W DE 
Sbjct: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDEL 109

>YKR014C Chr11 complement(465367..466071) [705 bp, 234 aa] {ON}
           YPT52Rab family GTPase, similar to Ypt51p and Ypt53p and
           to mammalian rab5; required for vacuolar protein sorting
           and endocytosis
          Length = 234

 Score = 97.1 bits (240), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 70/106 (66%), Gaps = 7/106 (6%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIV--ND-----DKVATMQ 60
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + +  ND     D V   +
Sbjct: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFE 63

Query: 61  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEF 106
           +WDTAGQER++SL   +YR A+  ++VYD+T   S    ++W DE 
Sbjct: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDEL 109

>KNAG0B00580 Chr2 (94797..95474) [678 bp, 225 aa] {ON} Anc_3.521
           YER031C
          Length = 225

 Score = 96.7 bits (239), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 73/105 (69%), Gaps = 1/105 (0%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           + K++++GDSGVGK++L+ R+  ++++ + K+TIG +F T+ + V   K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTNEFNIESKSTIGVEFATRTIEVEGKKIKA-QIWDTAG 71

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHAN 111
           QER++++  A+YRGA   ++VYD++   +++N   W  E   +A+
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSSTYENCNHWLTELRENAD 116

>NCAS0B07630 Chr2 complement(1443664..1444314) [651 bp, 216 aa] {ON}
           Anc_1.289
          Length = 216

 Score = 96.3 bits (238), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 69/104 (66%), Gaps = 5/104 (4%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVN-----DDKVATMQVW 62
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + +      +D V   ++W
Sbjct: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63

Query: 63  DTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEF 106
           DTAGQER++SL   +YR A+  ++VYD+T   S    +SW +E 
Sbjct: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEEL 107

>ZYRO0B09152g Chr2 complement(714608..715279) [672 bp, 223 aa] {ON}
           similar to uniprot|P36019 Saccharomyces cerevisiae
           YNL093W YPT53 Involved in vacuolar protein sorting and
           endocytosis GTP-binding protein of the rab family
          Length = 223

 Score = 96.3 bits (238), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 61/203 (30%), Positives = 100/203 (49%), Gaps = 19/203 (9%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEV-IVNDDKVA---TMQVWD 63
           LK+++LG+S VGKTS++ RY    Y Q+  ATIGA F TK + + ++D V     +++WD
Sbjct: 35  LKLVLLGESSVGKTSIVTRYTTGNY-QKTNATIGAAFFTKAINVPSEDGVVRKVNVEIWD 93

Query: 64  TAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPET-FPFVI 122
           TAGQER++SL   +YR  D   +V+DVT  +S +   SW +E   + +   PE     ++
Sbjct: 94  TAGQERYRSLTPVYYRNTDAAFIVFDVTKPESLEKAHSWIEELNEYCSSDRPENEINTIV 153

Query: 123 LANXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQSD 182
           + N                 +      ++     SAK    +   FE++A+S L +    
Sbjct: 154 VGNKIDL-------------DHGPFETDLQYVLVSAKTGEGIVKLFEKLAQSVLNEKYVR 200

Query: 183 ADAYEDDLSEAINIQLDGEPSSC 205
            +  ED   +   ++   E  SC
Sbjct: 201 EETLEDLPKDPFKMKRRKETCSC 223

>KNAG0C01600 Chr3 (317298..317942) [645 bp, 214 aa] {ON} Anc_1.289
           YKR014C
          Length = 214

 Score = 95.9 bits (237), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 43/103 (41%), Positives = 69/103 (66%), Gaps = 4/103 (3%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDK----VATMQVWD 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + V  +     V   ++WD
Sbjct: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTIKVESEDQQEVVIKFEIWD 63

Query: 64  TAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEF 106
           TAGQER++SL   +YR A+  ++VYDVT   S +  K+W +E 
Sbjct: 64  TAGQERYKSLAPMYYRNANAALVVYDVTQEDSLNKAKAWVEEL 106

>ACL084C Chr3 complement(199020..199643) [624 bp, 207 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR089C
           (VPS21) and YNL093W (YPT53)
          Length = 207

 Score = 95.9 bits (237), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 67/99 (67%), Gaps = 1/99 (1%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
           +K+++LG++ VGK+S++ R+V++ +S+  + TIGA FLT+ V + D K    ++WDTAGQ
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVNM-DSKTIKFEIWDTAGQ 66

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEF 106
           ERF SL   +YR A   ++VYD+T  +SF   + W  E 
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDITKPQSFIKARHWVKEL 105

>Kwal_14.2394 s14 (738645..739268) [624 bp, 207 aa] {ON} YKR014C
           (YPT52) - probable purine nucleotide-binding protein
           [contig 225] FULL
          Length = 207

 Score = 95.9 bits (237), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 42/101 (41%), Positives = 69/101 (68%), Gaps = 2/101 (1%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIV--NDDKVATMQVWDTA 65
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + +  ++D     ++WDTA
Sbjct: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63

Query: 66  GQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEF 106
           GQER++SL   +YR A+  ++VYDVT   S    +SW +E 
Sbjct: 64  GQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEEL 104

>NCAS0E00600 Chr5 (102956..103615) [660 bp, 219 aa] {ON} Anc_3.521
          Length = 219

 Score = 95.9 bits (237), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 70/100 (70%), Gaps = 1/100 (1%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           + K++++GDSGVGK++L+ R+  ++++ + K+TIG +F T+ + V   K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTNEFNIESKSTIGVEFATRTIEVEGKKIKA-QIWDTAG 71

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEF 106
           QER++++  A+YRGA   ++VYD++   +++N   W  E 
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSGTYENCNHWLKEL 111

>TDEL0C04660 Chr3 complement(845203..845838) [636 bp, 211 aa] {ON}
           Anc_2.196 YNL093W
          Length = 211

 Score = 95.5 bits (236), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 68/99 (68%), Gaps = 1/99 (1%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
           +K+++LG++ VGK+S++ R+V++ +++  + TIGA FLT+ V + D+ V   ++WDTAGQ
Sbjct: 8   VKLVLLGEAAVGKSSIVLRFVSNDFTENKEPTIGAAFLTQRVNIGDETV-KFEIWDTAGQ 66

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEF 106
           ERF SL   +YR A   ++VYDVT  +SF   + W  E 
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKEL 105

>Suva_11.246 Chr11 complement(449412..450122) [711 bp, 236 aa] {ON}
           YKR014C (REAL)
          Length = 236

 Score = 95.9 bits (237), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 44/108 (40%), Positives = 70/108 (64%), Gaps = 9/108 (8%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIV--ND-------DKVAT 58
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + +  ND       D V  
Sbjct: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNEANAKDVVIK 63

Query: 59  MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEF 106
            ++WDTAGQER++SL   +YR A+  ++VYD+T   S    ++W DE 
Sbjct: 64  FEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDEL 111

>Kpol_1029.16 s1029 (30724..31359) [636 bp, 211 aa] {ON}
           (30724..31359) [636 nt, 212 aa]
          Length = 211

 Score = 95.1 bits (235), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 67/99 (67%), Gaps = 1/99 (1%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
           +K+++LG++ VGK+S++ R+V++ +S+  + TIGA FLT+ V + DD     ++WDTAGQ
Sbjct: 8   VKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVNI-DDHTVKFEIWDTAGQ 66

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEF 106
           ERF SL   +YR A   ++VYDV+  +SF   + W  E 
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDVSKPQSFIKARHWVKEL 105

>NDAI0B04980 Chr2 complement(1216833..1217516) [684 bp, 227 aa] {ON}
           Anc_1.289
          Length = 227

 Score = 95.5 bits (236), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 66/104 (63%), Gaps = 5/104 (4%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVA-----TMQVW 62
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL + + + D +         ++W
Sbjct: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLAQTIKIKDTETQEDIDIKFEIW 63

Query: 63  DTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEF 106
           DTAGQER++SL   +YR A+  ++VYD+T   S     SW DE 
Sbjct: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKNSLSKAMSWVDEL 107

>KAFR0F04160 Chr6 complement(819022..819759) [738 bp, 245 aa] {ON}
           Anc_3.521 YER031C
          Length = 245

 Score = 95.5 bits (236), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 55/174 (31%), Positives = 99/174 (56%), Gaps = 13/174 (7%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           + K++++GDSGVGK++L+ R+  ++++ + K+TIG +F T+ + +   K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTNEFNIESKSTIGVEFATRTIEMEGKKIKA-QIWDTAG 71

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANX 126
           QER++++  A+YRGA   ++VYD++   +++N   W  E   +A+    +     ++ N 
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSSTYENCNHWLSELRENAD----DNVAVGLIGN- 126

Query: 127 XXXXXXXXXXXXXXAQEQAK--SLGNVPLFF-TSAKDSINVQDAFEEIARSALQ 177
                           ++AK  +L N  LF  TSA +S NV  AF E+  +  Q
Sbjct: 127 ----KSDLAHLRAVPTDEAKNFALENQLLFTETSALNSENVDQAFRELITAIYQ 176

>KLLA0B00671g Chr2 complement(50393..51006,51417..51462) [660 bp,
           219 aa] {ON} highly similar to uniprot|P51996
           Saccharomyces cerevisiae YGL210W YPT32 probably involved
           in intra-Golgi transport or in the formation of
           transport vesicles at the most distal Golgi compartment;
           ras-like GTPase, highly homologous to YPT31
          Length = 219

 Score = 94.7 bits (234), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 67/100 (67%), Gaps = 1/100 (1%)

Query: 7   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAG 66
           + K++++GDSGVGK++L+ R+  ++++   K TIG +F T+ + V   K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTANEFNLDSKTTIGVEFATRTIEVEGKKIKA-QIWDTAG 71

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEF 106
           QER++++  A+YR A   ++VYD+T   S++N   W  E 
Sbjct: 72  QERYRAITTAYYRAAVGALIVYDITKSSSYENCNHWLAEL 111

>KLTH0H09768g Chr8 (840625..841314) [690 bp, 229 aa] {ON} similar to
           uniprot|P36018 Saccharomyces cerevisiae YKR014C YPT52
           rab5-like GTPase involved in vacuolar protein sorting
           and endocytosis probable purine nucleotide- binding
           protein
          Length = 229

 Score = 94.7 bits (234), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 42/101 (41%), Positives = 68/101 (67%), Gaps = 2/101 (1%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIV--NDDKVATMQVWDTA 65
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + +  + D     ++WDTA
Sbjct: 26  FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHPDVTIKFEIWDTA 85

Query: 66  GQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEF 106
           GQER++SL   +YR A+  ++VYDVT   S    +SW +E 
Sbjct: 86  GQERYKSLAPMYYRNANAALIVYDVTQPGSLVKAQSWVEEL 126

>TDEL0D05890 Chr4 complement(1067167..1067856) [690 bp, 229 aa] {ON}
           Anc_3.521 YER031C
          Length = 229

 Score = 94.7 bits (234), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 41/106 (38%), Positives = 72/106 (67%), Gaps = 1/106 (0%)

Query: 6   NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTA 65
           N + V+++GDSGVGK++L+ R+  + ++ + K+TIG +F T+ + V   K+   Q+WDTA
Sbjct: 24  NWVIVVLIGDSGVGKSNLLSRFTTNDFNMESKSTIGVEFATRTIEVEGKKIKA-QIWDTA 82

Query: 66  GQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHAN 111
           GQER++++  A+YRGA   ++VYD++   S++N   W  E   +A+
Sbjct: 83  GQERYRAITSAYYRGAVGALIVYDISKPSSYENCNHWLTELRENAD 128

>ZYRO0C15554g Chr3 complement(1218190..1218825) [636 bp, 211 aa]
           {ON} highly similar to uniprot|P36017 Saccharomyces
           cerevisiae YOR089C VPS21 Rab5-like GTPase involved in
           vacuolar protein sorting and endocytosis post vesicle
           internalization geranylgeranylated geranylgeranylation
           required for membrane association
          Length = 211

 Score = 93.6 bits (231), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 67/99 (67%), Gaps = 1/99 (1%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
           +K+++LG++ VGK+S++ R+V++ +S+  + TIGA FLT+ V + +  V   ++WDTAGQ
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVNIGEQTV-KFEIWDTAGQ 66

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEF 106
           ERF SL   +YR A   ++VYD+T  +SF   + W  E 
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDITKPQSFIKARHWVKEL 105

>ZYRO0G21384g Chr7 complement(1763055..1763711) [657 bp, 218 aa]
           {ON} highly similar to uniprot|Q75F92 Ashbya gossypii
           AAL176C AAL176Cp and similar to YKR014C uniprot|P36018
           Saccharomyces cerevisiae YKR014C YPT52 rab5-like GTPase
           involved in vacuolar protein sorting and endocytosis
           probable purine nucleotide-binding protein
          Length = 218

 Score = 93.6 bits (231), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 68/104 (65%), Gaps = 5/104 (4%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVND-----DKVATMQVW 62
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + + D     + V   ++W
Sbjct: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKIEDKGSQQEVVIKFEIW 63

Query: 63  DTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEF 106
           DTAGQER++SL   +YR A+  ++VYDVT   S    + W +E 
Sbjct: 64  DTAGQERYKSLAPMYYRNANAALVVYDVTQQDSLAKAQGWVNEL 107

>TPHA0I02590 Chr9 complement(571327..572004) [678 bp, 225 aa] {ON}
           Anc_1.338 YBR264C
          Length = 225

 Score = 92.4 bits (228), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 58/171 (33%), Positives = 94/171 (54%), Gaps = 6/171 (3%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIV----NDDKVATMQVWD 63
           LK+++LG+S VGK+S++ RYV  K+++   ATIGA F+TKE+       + +V  +++WD
Sbjct: 15  LKLVLLGESSVGKSSVVSRYVTGKFNKT-NATIGAAFITKEIKFVSEEGEHRVVNLEIWD 73

Query: 64  TAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVIL 123
           TAGQER++SL   +YR  D  V+V+D+T   S     +W DE L +      E     ++
Sbjct: 74  TAGQERYRSLAPMYYRNTDVAVIVFDLTVPDSAAKALAWVDELLSYVEKERREEIVITVV 133

Query: 124 ANXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARS 174
            N                Q+ A +L   P++  SAK    +++ F++I RS
Sbjct: 134 GNKNDLIEGDDKIDSAMEQDIA-TLAKRPIWRVSAKTGEGIEELFQDIVRS 183

>AEL187C Chr5 complement(284984..285610) [627 bp, 208 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR264C
           (YPT10)
          Length = 208

 Score = 91.7 bits (226), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 69/109 (63%), Gaps = 11/109 (10%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDD----------KVA 57
           +K+++LG+S VGK+S++ R+   ++ +  +ATIGA F T+ V   +D          +  
Sbjct: 9   VKLVLLGESSVGKSSIVTRFTTGEFRKN-QATIGAAFTTRSVQWEEDAGDGSDAKEVRSV 67

Query: 58  TMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEF 106
           T ++WDTAGQER++SL   +YR  D  ++VYDVT  +SF N +SW DE 
Sbjct: 68  TFEIWDTAGQERYRSLAPMYYRNTDVALVVYDVTEQQSFQNARSWIDEL 116

>Suva_4.526 Chr4 complement(909423..910019) [597 bp, 198 aa] {ON}
           YBR264C (REAL)
          Length = 198

 Score = 90.5 bits (223), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 66/100 (66%), Gaps = 5/100 (5%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVAT-----MQVW 62
           +KV++LGDS VGKTS++ R  + K+ +++ ATIGA F+TK + V     +T     M++W
Sbjct: 5   IKVVLLGDSSVGKTSIVTRLKSGKFPEKHAATIGAAFVTKTIEVPTSDTSTEKRIHMEIW 64

Query: 63  DTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSW 102
           DTAGQER++SL   +YR A+  +LV+++ N  S     +W
Sbjct: 65  DTAGQERYKSLVPMYYRDANIALLVFELNNAASLQCAMTW 104

>Smik_2.408 Chr2 complement(723817..724416) [600 bp, 199 aa] {ON}
           YBR264C (REAL)
          Length = 199

 Score = 89.0 bits (219), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 61/205 (29%), Positives = 97/205 (47%), Gaps = 15/205 (7%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVAT-----MQVW 62
           +KV++LGDS VGKTS++ R  + K+  ++ ATIGA F+TK + +  D   T     M++W
Sbjct: 5   IKVVLLGDSSVGKTSVVTRLKSGKFLAKHAATIGAAFITKTIEIPSDDTTTDKRIHMEIW 64

Query: 63  DTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVI 122
           DTAGQER++SL   +YR A+  +LV+++ +  S    K+W  +    A  +       ++
Sbjct: 65  DTAGQERYKSLVPMYYRDANIALLVFELGDISSLQCAKTWFQDLQDRAQGTQ-----VIL 119

Query: 123 LANXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQSD 182
           + N                 E    L ++P    SAK   N  D    I  S + +SQ  
Sbjct: 120 VGNKYDLVREEHLDEVTIPAE----LQDLPYVLVSAKTGYNF-DTLNGIIISLVPESQFK 174

Query: 183 ADAYEDDLSEAINIQLDGEPSSCNC 207
               +D+    + I       SC C
Sbjct: 175 RLLKDDEQGNKLEISKKKSGGSCIC 199

>CAGL0I09306g Chr9 complement(897357..897977) [621 bp, 206 aa] {ON}
           similar to uniprot|P38146 Saccharomyces cerevisiae
           YBR264c GTP-binding protein
          Length = 206

 Score = 89.4 bits (220), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 73/121 (60%), Gaps = 4/121 (3%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEV-IVNDDKV--ATMQVWDT 64
           LKV++LG+S VGK++++ R+   KY +   ATIGA ++TK++  + D  V    +++WDT
Sbjct: 11  LKVVLLGESAVGKSAIVTRFSTGKYLRN-NATIGAAYVTKDLEYIRDGDVYQVRLEIWDT 69

Query: 65  AGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILA 124
           AGQER++SL   +YR  D  ++V+DV+N +S      W DE   +      E    V++ 
Sbjct: 70  AGQERYRSLTPMYYRNTDVAIVVFDVSNLRSLSMAHKWIDELNTYVENKGRERINIVLVG 129

Query: 125 N 125
           N
Sbjct: 130 N 130

>TDEL0D02060 Chr4 (403098..403706) [609 bp, 202 aa] {ON} Anc_1.338
           YBR264C
          Length = 202

 Score = 89.0 bits (219), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 52/168 (30%), Positives = 87/168 (51%), Gaps = 16/168 (9%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTK--EVIVNDDKVA--TMQVWD 63
           LK+++LG+S VGK+S++ RYV   + Q+  ATIGA F T+  EV   D  +    +++WD
Sbjct: 13  LKLVLLGESSVGKSSIVMRYVTGSF-QKTNATIGAAFTTRTFEVPQCDGSIKRINLEIWD 71

Query: 64  TAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVIL 123
           TAGQER++SL   ++R  D  ++V+DVT  +S    +SW +E   +      +     ++
Sbjct: 72  TAGQERYRSLAPMYFRNTDIALVVFDVTKPESLRKAQSWIEELNSYVEEDRRDDLRIKVI 131

Query: 124 ANXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEI 171
            N                 +   ++  +PLF  SAK    + + FE +
Sbjct: 132 GNKKDLE-----------HDPVGTIEGLPLFTVSAKTGEGIDELFESL 168

>SAKL0D06490g Chr4 complement(531028..531684) [657 bp, 218 aa] {ON}
           similar to uniprot|P36019 Saccharomyces cerevisiae
           YNL093W YPT53 Involved in vacuolar protein sorting and
           endocytosis GTP-binding protein of the rab family
          Length = 218

 Score = 88.2 bits (217), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 47/113 (41%), Positives = 69/113 (61%), Gaps = 10/113 (8%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTK----EVIVND-----DKVAT 58
           LK+++LG+S VGK+S++ R+    + +   ATIGA F TK    E IV +     DK   
Sbjct: 9   LKLVLLGESSVGKSSIVTRFTTGNFHRS-NATIGAAFTTKTLSLESIVPETGETIDKKIK 67

Query: 59  MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHAN 111
           +++WDTAGQER++SL   +YR  D  ++V+DVTN  S    +SW DE   + N
Sbjct: 68  LEIWDTAGQERYRSLAPMYYRNTDVALIVFDVTNKDSIARAQSWIDELNRYIN 120

>YBR264C Chr2 complement(737770..738369) [600 bp, 199 aa] {ON}
           YPT10Rab family GTP-binding protein that contains the
           PEST signal sequence specific for proteolytic enzymes;
           may be involved in vesicular transport; overexpression
           leads to accumulation of Golgi-like cisternae with
           budding vesicles
          Length = 199

 Score = 87.0 bits (214), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 63/205 (30%), Positives = 99/205 (48%), Gaps = 15/205 (7%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTK--EVIVND---DKVATMQVW 62
           +KV++LGDS VGKTS++ R  + K+  ++ ATIGA F+TK  EV  ND   +K   M++W
Sbjct: 5   IKVVLLGDSSVGKTSIVTRLKSGKFLAKHAATIGAAFITKTIEVPSNDSSTEKRIHMEIW 64

Query: 63  DTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVI 122
           DTAGQER++SL   +YR A+  ++V+++ +  S    K+W  +    A  +       +I
Sbjct: 65  DTAGQERYKSLVPMYYRDANIALIVFELGDVSSLQCAKTWFQDLQDRAQGTQ-----VII 119

Query: 123 LANXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQSD 182
           + N                 E    L  +P    SAK   N  D   +I  S + +SQ  
Sbjct: 120 VGNKYDLVCEEHSGEVTIPAE----LQGLPYVAVSAKTGYNF-DTLNKIIISLVPESQFK 174

Query: 183 ADAYEDDLSEAINIQLDGEPSSCNC 207
             +  ++    + I      S C C
Sbjct: 175 TLSKNNEQGNILEINKKKSGSGCIC 199

>NDAI0B04680 Chr2 complement(1157279..1157950) [672 bp, 223 aa] {ON}
           Anc_1.338
          Length = 223

 Score = 86.7 bits (213), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 63/213 (29%), Positives = 104/213 (48%), Gaps = 15/213 (7%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDK--------VATM 59
           LKV++LG+S VGKTS++ +    K+ Q+  ATIGA F TK++  N+ +          ++
Sbjct: 13  LKVVLLGESSVGKTSIVTKISTGKF-QKGAATIGAAFTTKQIQFNEIEENGVEQCFKVSI 71

Query: 60  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSP--ET 117
           ++WDTAGQER++SL   +YR  D  ++V+D+T   S    +SW DE   + + SS   + 
Sbjct: 72  EIWDTAGQERYRSLTPMYYRNTDVALIVFDLTQEASLKKARSWIDELKSYLDSSSRRDKH 131

Query: 118 FPFVILANXXXXXXXXXXXXXXXAQ-EQAKSLGNVPLFFTSAKDSINVQDAFEEIARSAL 176
              +++AN                  E        PL   SAK +  + + F++I +   
Sbjct: 132 ISMILVANKVDLVAKNDGTFDINQYLENWDIPSEYPLKIVSAKTNEGINELFDDIIKKIP 191

Query: 177 --QQSQSDADAYEDDLSEAINIQLDGEPSSCNC 207
             Q  + DA A      + +N  +    + CNC
Sbjct: 192 KDQFVKEDAQARRPSTIQ-LNSSIADNSTGCNC 223

>Ecym_6309 Chr6 (585998..586624) [627 bp, 208 aa] {ON} similar to
           Ashbya gossypii AEL187C
          Length = 208

 Score = 85.1 bits (209), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 74/129 (57%), Gaps = 12/129 (9%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDD-----------KV 56
           LK+++LG+S VGK+S++ R+   ++ +  +ATIGA F T+ +   ++           K 
Sbjct: 9   LKLVLLGESSVGKSSIVTRFTTGEFHKN-QATIGAAFTTRTISWKENPTNRSSEELITKS 67

Query: 57  ATMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPE 116
              ++WDTAGQER++SL   +YR  D  ++V+D+T+  S +  +SW DE   + + S  +
Sbjct: 68  VNFEIWDTAGQERYRSLAPMYYRNTDVALIVFDITDESSLEKAQSWIDELNTYVDESRQK 127

Query: 117 TFPFVILAN 125
                I+ N
Sbjct: 128 QIVIKIVGN 136

>Skud_2.397 Chr2 complement(706771..707370) [600 bp, 199 aa] {ON}
           YBR264C (REAL)
          Length = 199

 Score = 83.2 bits (204), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 66/100 (66%), Gaps = 5/100 (5%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTK--EVIVND---DKVATMQVW 62
           +KV++LGDS VGKTS++ R  + K+  ++ ATIGA F+TK  EV   D   +K   M++W
Sbjct: 5   IKVVLLGDSSVGKTSIVTRLKSGKFLAKHAATIGAAFVTKTIEVPCGDAAIEKRIHMEIW 64

Query: 63  DTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSW 102
           DTAGQER++SL   +YR A+  +LV+++ +  S     +W
Sbjct: 65  DTAGQERYKSLVPMYYRDANIALLVFELGDTASLRCAMTW 104

>KLTH0H10274g Chr8 complement(882443..883048) [606 bp, 201 aa] {ON}
           weakly similar to uniprot|P36018 Saccharomyces
           cerevisiae YKR014C YPT52 rab5-like GTPase involved in
           vacuolar protein sorting and endocytosis; probable
           purine nucleotide-binding protein
          Length = 201

 Score = 83.2 bits (204), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 62/102 (60%), Gaps = 4/102 (3%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDD---KVATMQVWDT 64
           LK+++LG+S VGK++L+ R+    + +   ATIGA F TK V    +   K    ++WDT
Sbjct: 10  LKLVLLGESSVGKSALVTRFTTGAFHKN-NATIGAAFTTKVVSWETNEAIKQVKFEIWDT 68

Query: 65  AGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEF 106
           AGQER++SL   +YR  D   +V+DVT+  +F    SW DE 
Sbjct: 69  AGQERYRSLTPMYYRKTDVAFVVFDVTDDATFSKAGSWIDEL 110

>KLLA0A04499g Chr1 complement(404732..405376) [645 bp, 214 aa] {ON}
           highly similar to uniprot|P32836 Saccharomyces
           cerevisiae YOR185C GSP2 GTP binding protein (mammalian
           Ranp homolog) involved in the maintenance of nuclear
           organization RNA processing and transport interacts with
           Kap121p Kap123p and Pdr6p (karyophilin betas) Gsp1p
           homolog that is not required for viability
          Length = 214

 Score = 82.0 bits (201), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 84/182 (46%), Gaps = 10/182 (5%)

Query: 1   MSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQ 60
           MS +    K++++GD G GKT+ + R++  ++ ++Y ATIG +        N  ++    
Sbjct: 1   MSAEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFYTNFGEIK-FD 59

Query: 61  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPF 120
           VWDTAGQE+F  L   +Y  A C ++++DVT+  ++ NV +W  +      V   E  P 
Sbjct: 60  VWDTAGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPI 114

Query: 121 VILANXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQ 180
           V+  N                  +     N+  +  SAK + N +  F  +AR      Q
Sbjct: 115 VLCGNKVDVKERKVKAKTITFHRKK----NLQYYDISAKSNYNFEKPFLWLARKLAGNPQ 170

Query: 181 SD 182
            D
Sbjct: 171 LD 172

>KLLA0C05126g Chr3 complement(463657..464301) [645 bp, 214 aa] {ON}
           highly similar to uniprot|P32836 Saccharomyces
           cerevisiae YOR185C GSP2 GTP binding protein (mammalian
           Ranp homolog) involved in the maintenance of nuclear
           organization RNA processing and transport interacts with
           Kap121p Kap123p and Pdr6p (karyophilin betas) Gsp1p
           homolog that is not required for viability
          Length = 214

 Score = 82.0 bits (201), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 84/182 (46%), Gaps = 10/182 (5%)

Query: 1   MSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQ 60
           MS +    K++++GD G GKT+ + R++  ++ ++Y ATIG +        N  ++    
Sbjct: 1   MSAEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFYTNFGEIK-FD 59

Query: 61  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPF 120
           VWDTAGQE+F  L   +Y  A C ++++DVT+  ++ NV +W  +      V   E  P 
Sbjct: 60  VWDTAGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPI 114

Query: 121 VILANXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQ 180
           V+  N                  +     N+  +  SAK + N +  F  +AR      Q
Sbjct: 115 VLCGNKVDVKERKVKAKTITFHRKK----NLQYYDISAKSNYNFEKPFLWLARKLAGNPQ 170

Query: 181 SD 182
            D
Sbjct: 171 LD 172

>Kpol_1066.11 s1066 complement(18137..18865) [729 bp, 242 aa] {ON}
           complement(18137..18865) [729 nt, 243 aa]
          Length = 242

 Score = 82.4 bits (202), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 68/124 (54%), Gaps = 18/124 (14%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDD------------- 54
           LK+++LGDS VGKTS++ R     +     ATIGA F+T  + V+D+             
Sbjct: 19  LKLVLLGDSSVGKTSIVGRLTTGNFINS-NATIGAAFVTTTIEVDDEEMINGGNNGMSSK 77

Query: 55  ----KVATMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHA 110
               K    ++WDTAGQER++SL   +YR  D  ++V+D++  +SF   +SW +E   + 
Sbjct: 78  RSIKKRVNFEIWDTAGQERYRSLAPMYYRNTDVALIVFDLSRPQSFKGAQSWIEELNSYV 137

Query: 111 NVSS 114
             SS
Sbjct: 138 EESS 141

>ZYRO0D14784g Chr4 complement(1247520..1248164) [645 bp, 214 aa]
           {ON} highly similar to uniprot|P32836 Saccharomyces
           cerevisiae YOR185C GSP2 GTP binding protein (mammalian
           Ranp homolog) involved in the maintenance of nuclear
           organization RNA processing and transport interacts with
           Kap121p Kap123p and Pdr6p (karyophilin betas) Gsp1p
           homolog that is not required for viability
          Length = 214

 Score = 80.9 bits (198), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 83/180 (46%), Gaps = 10/180 (5%)

Query: 1   MSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQ 60
           MS +    K++++GD G GKT+ + R++  ++ ++Y ATIG +        N  ++    
Sbjct: 1   MSAEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIK-FD 59

Query: 61  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPF 120
           VWDTAGQE+F  L   +Y  A C ++++DVT+  ++ NV +W  +      V   E  P 
Sbjct: 60  VWDTAGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPI 114

Query: 121 VILANXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQ 180
           V+  N                  +     N+  +  SAK + N +  F  +AR      Q
Sbjct: 115 VLCGNKVDVKERKVKAKTITFHRKK----NLQYYDISAKSNYNFEKPFLWLARKLAGNPQ 170

>SAKL0A07744g Chr1 (688406..689050) [645 bp, 214 aa] {ON} highly
           similar to uniprot|P32835 Saccharomyces cerevisiae
           YLR293C GSP1 GTP binding protein (mammalian Ranp
           homolog) involved in the maintenance of nuclear
           organization RNA processing and transport regulated by
           Prp20p Rna1p Yrb1p Yrb2p Yrp4p Yrb30p Cse1p and Kap95p
           yeast Gsp2p homolog
          Length = 214

 Score = 80.9 bits (198), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 83/180 (46%), Gaps = 10/180 (5%)

Query: 1   MSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQ 60
           MS +    K++++GD G GKT+ + R++  ++ ++Y ATIG +        N  ++    
Sbjct: 1   MSAEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFYTNFGEIK-FD 59

Query: 61  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPF 120
           VWDTAGQE+F  L   +Y  A C ++++DVT+  ++ NV +W  +      V   E  P 
Sbjct: 60  VWDTAGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPI 114

Query: 121 VILANXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQ 180
           V+  N                  +     N+  +  SAK + N +  F  +AR      Q
Sbjct: 115 VLCGNKVDVKERKVKAKTITFHRKK----NLQYYDISAKSNYNFEKPFLWLARKLAGNPQ 170

>Ecym_3097 Chr3 (181482..182126) [645 bp, 214 aa] {ON} similar to
           Ashbya gossypii AGR294C
          Length = 214

 Score = 80.9 bits (198), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 84/182 (46%), Gaps = 10/182 (5%)

Query: 1   MSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQ 60
           M+ +    K++++GD G GKT+ + R++  ++ ++Y ATIG +        N  ++    
Sbjct: 1   MAAEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFYTNFGEIK-FD 59

Query: 61  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPF 120
           VWDTAGQE+F  L   +Y  A C ++++DVT+  ++ NV +W  +      V   E  P 
Sbjct: 60  VWDTAGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPI 114

Query: 121 VILANXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQ 180
           V+  N                  +     N+  +  SAK + N +  F  +AR      Q
Sbjct: 115 VLCGNKVDVKERKVKAKTITFHRKK----NLQYYDISAKSNYNFEKPFLWLARKLAGNPQ 170

Query: 181 SD 182
            D
Sbjct: 171 LD 172

>AGR294C Chr7 complement(1287036..1287680) [645 bp, 214 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR185C
           (GSP2) and YLR293C (GSP1)
          Length = 214

 Score = 80.9 bits (198), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 84/182 (46%), Gaps = 10/182 (5%)

Query: 1   MSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQ 60
           M+ +    K++++GD G GKT+ + R++  ++ ++Y ATIG +        N  ++    
Sbjct: 1   MAAEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFYTNFGEIK-FD 59

Query: 61  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPF 120
           VWDTAGQE+F  L   +Y  A C ++++DVT+  ++ NV +W  +      V   E  P 
Sbjct: 60  VWDTAGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPI 114

Query: 121 VILANXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQ 180
           V+  N                  +     N+  +  SAK + N +  F  +AR      Q
Sbjct: 115 VLCGNKVDVKERKVKAKTITFHRKK----NLQYYDISAKSNYNFEKPFLWLARKLAGNPQ 170

Query: 181 SD 182
            D
Sbjct: 171 LD 172

>CAGL0I00594g Chr9 (44835..45479) [645 bp, 214 aa] {ON} highly
           similar to uniprot|P32835 Saccharomyces cerevisiae
           YLR293c GSP1
          Length = 214

 Score = 80.5 bits (197), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 83/180 (46%), Gaps = 10/180 (5%)

Query: 1   MSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQ 60
           MS +    K++++GD G GKT+ + R++  ++ ++Y ATIG +        N  ++    
Sbjct: 1   MSAEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFHTNFGEIK-FD 59

Query: 61  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPF 120
           VWDTAGQE+F  L   +Y  A C ++++DVT+  ++ NV +W  +      V   E  P 
Sbjct: 60  VWDTAGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPI 114

Query: 121 VILANXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQ 180
           V+  N                  +     N+  +  SAK + N +  F  +AR      Q
Sbjct: 115 VLCGNKVDVKERKVKAKTITFHRKK----NLQYYDISAKSNYNFEKPFLWLARKLAGNPQ 170

>Suva_10.389 Chr10 complement(681930..682589) [660 bp, 219 aa] {ON}
           YLR293C (REAL)
          Length = 219

 Score = 80.1 bits (196), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 80/173 (46%), Gaps = 10/173 (5%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        N  ++    VWDTAGQ
Sbjct: 13  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIK-FDVWDTAGQ 71

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXX 127
           E+F  L   +Y  A C ++++DVT+  ++ NV +W  +      V   E  P V+  N  
Sbjct: 72  EKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKV 126

Query: 128 XXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQ 180
                           +     N+  +  SAK + N +  F  +AR      Q
Sbjct: 127 DVKERKVKAKTITFHRKK----NLQYYDISAKSNYNFEKPFLWLARKLAGNPQ 175

>Skud_12.375 Chr12 complement(661797..662456) [660 bp, 219 aa] {ON}
           YLR293C (REAL)
          Length = 219

 Score = 80.1 bits (196), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 80/173 (46%), Gaps = 10/173 (5%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        N  ++    VWDTAGQ
Sbjct: 13  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIK-FDVWDTAGQ 71

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXX 127
           E+F  L   +Y  A C ++++DVT+  ++ NV +W  +      V   E  P V+  N  
Sbjct: 72  EKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKV 126

Query: 128 XXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQ 180
                           +     N+  +  SAK + N +  F  +AR      Q
Sbjct: 127 DVKERKVKAKTITFHRKK----NLQYYDISAKSNYNFEKPFLWLARKLAGNPQ 175

>Smik_12.371 Chr12 complement(658971..659630) [660 bp, 219 aa] {ON}
           YLR293C (REAL)
          Length = 219

 Score = 80.1 bits (196), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 80/173 (46%), Gaps = 10/173 (5%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        N  ++    VWDTAGQ
Sbjct: 13  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIK-FDVWDTAGQ 71

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXX 127
           E+F  L   +Y  A C ++++DVT+  ++ NV +W  +      V   E  P V+  N  
Sbjct: 72  EKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKV 126

Query: 128 XXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQ 180
                           +     N+  +  SAK + N +  F  +AR      Q
Sbjct: 127 DVKERKVKAKTITFHRKK----NLQYYDISAKSNYNFEKPFLWLARKLAGNPQ 175

>YLR293C Chr12 complement(720771..721430) [660 bp, 219 aa] {ON}
           GSP1Ran GTPase, GTP binding protein (mammalian Ranp
           homolog) involved in the maintenance of nuclear
           organization, RNA processing and transport; regulated by
           Srm1p, Rna1p, Yrb1p, Yrb2p, Yrp4p, Yrb30p, Cse1p and
           Kap95p; yeast Gsp2p homolog
          Length = 219

 Score = 80.1 bits (196), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 80/173 (46%), Gaps = 10/173 (5%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        N  ++    VWDTAGQ
Sbjct: 13  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIK-FDVWDTAGQ 71

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXX 127
           E+F  L   +Y  A C ++++DVT+  ++ NV +W  +      V   E  P V+  N  
Sbjct: 72  EKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKV 126

Query: 128 XXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQ 180
                           +     N+  +  SAK + N +  F  +AR      Q
Sbjct: 127 DVKERKVKAKTITFHRKK----NLQYYDISAKSNYNFEKPFLWLARKLAGNPQ 175

>KLTH0G14850g Chr7 (1304240..1304884) [645 bp, 214 aa] {ON} highly
           similar to uniprot|P32835 Saccharomyces cerevisiae
           YLR293C GSP1 GTP binding protein (mammalian Ranp
           homolog) involved in the maintenance of nuclear
           organization RNA processing and transport regulated by
           Prp20p Rna1p Yrb1p Yrb2p Yrp4p Yrb30p Cse1p and Kap95p
           yeast Gsp2p homolog
          Length = 214

 Score = 79.7 bits (195), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 83/182 (45%), Gaps = 10/182 (5%)

Query: 1   MSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQ 60
           MS +    K++++GD G GKT+ + R++  ++ ++Y ATIG + +       D       
Sbjct: 1   MSGEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVE-VHPLSFYTDFGELKFD 59

Query: 61  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPF 120
           VWDTAGQE+F  L   +Y  A C ++++DVT+  ++ NV +W  +      V   E  P 
Sbjct: 60  VWDTAGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPI 114

Query: 121 VILANXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQ 180
           V+  N                  +     N+  +  SAK + N +  F  +AR      Q
Sbjct: 115 VLCGNKVDVKERKVKAKTITFHRKK----NLQYYDISAKSNYNFEKPFLWLARKLAGNPQ 170

Query: 181 SD 182
            D
Sbjct: 171 LD 172

>Kwal_56.23361 s56 complement(508046..508690) [645 bp, 214 aa] {ON}
           YLR293C (GSP1) - GTP-binding protein [contig 181] FULL
          Length = 214

 Score = 79.7 bits (195), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 83/182 (45%), Gaps = 10/182 (5%)

Query: 1   MSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQ 60
           MS +    K++++GD G GKT+ + R++  ++ ++Y ATIG + +       D       
Sbjct: 1   MSGEVPSFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVE-VHPLAFYTDFGELKFD 59

Query: 61  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPF 120
           VWDTAGQE+F  L   +Y  A C ++++DVT+  ++ NV +W  +      V   E  P 
Sbjct: 60  VWDTAGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPI 114

Query: 121 VILANXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQ 180
           V+  N                  +     N+  +  SAK + N +  F  +AR      Q
Sbjct: 115 VLCGNKVDVKERKVKAKTITFHRKK----NLQYYDISAKSNYNFEKPFLWLARKLAGNPQ 170

Query: 181 SD 182
            D
Sbjct: 171 LD 172

>YOR185C Chr15 complement(681444..682106) [663 bp, 220 aa] {ON}
           GSP2GTP binding protein (mammalian Ranp homolog)
           involved in the maintenance of nuclear organization, RNA
           processing and transport; interacts with Kap121p,
           Kap123p and Pdr6p (karyophilin betas); Gsp1p homolog
           that is not required for viability
          Length = 220

 Score = 79.7 bits (195), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 80/173 (46%), Gaps = 10/173 (5%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        N  ++    VWDTAGQ
Sbjct: 14  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIK-FDVWDTAGQ 72

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXX 127
           E+F  L   +Y  A C ++++DVT+  ++ NV +W  +      V   E  P V+  N  
Sbjct: 73  EKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKV 127

Query: 128 XXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQ 180
                           +     N+  +  SAK + N +  F  +AR      Q
Sbjct: 128 DVKERKVKAKTITFHRKK----NLQYYDISAKSNYNFEKPFLWLARKLAGNPQ 176

>Suva_8.241 Chr8 complement(432445..433107) [663 bp, 220 aa] {ON}
           YOR185C (REAL)
          Length = 220

 Score = 79.7 bits (195), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 80/173 (46%), Gaps = 10/173 (5%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        N  ++    VWDTAGQ
Sbjct: 14  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIK-FDVWDTAGQ 72

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXX 127
           E+F  L   +Y  A C ++++DVT+  ++ NV +W  +      V   E  P V+  N  
Sbjct: 73  EKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKV 127

Query: 128 XXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQ 180
                           +     N+  +  SAK + N +  F  +AR      Q
Sbjct: 128 DVKERKVKAKTITFHRKK----NLQYYDISAKSNYNFEKPFLWLARKLAGNPQ 176

>Skud_15.352 Chr15 complement(632241..632903) [663 bp, 220 aa] {ON}
           YOR185C (REAL)
          Length = 220

 Score = 79.7 bits (195), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 80/173 (46%), Gaps = 10/173 (5%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        N  ++    VWDTAGQ
Sbjct: 14  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIK-FDVWDTAGQ 72

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXX 127
           E+F  L   +Y  A C ++++DVT+  ++ NV +W  +      V   E  P V+  N  
Sbjct: 73  EKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKV 127

Query: 128 XXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQ 180
                           +     N+  +  SAK + N +  F  +AR      Q
Sbjct: 128 DVKERKVKAKTITFHRKK----NLQYYDISAKSNYNFEKPFLWLARKLAGNPQ 176

>Smik_15.370 Chr15 complement(637457..638119) [663 bp, 220 aa] {ON}
           YOR185C (REAL)
          Length = 220

 Score = 79.7 bits (195), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 80/173 (46%), Gaps = 10/173 (5%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        N  ++    VWDTAGQ
Sbjct: 14  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIK-FDVWDTAGQ 72

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXX 127
           E+F  L   +Y  A C ++++DVT+  ++ NV +W  +      V   E  P V+  N  
Sbjct: 73  EKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKV 127

Query: 128 XXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQ 180
                           +     N+  +  SAK + N +  F  +AR      Q
Sbjct: 128 DVKERKVKAKTITFHRKK----NLQYYDISAKSNYNFEKPFLWLARKLAGNPQ 176

>TDEL0G03810 Chr7 (699414..700082) [669 bp, 222 aa] {ON} Anc_6.90
           YLR293C
          Length = 222

 Score = 79.3 bits (194), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 80/173 (46%), Gaps = 10/173 (5%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        N  ++    VWDTAGQ
Sbjct: 16  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEI-KFDVWDTAGQ 74

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXX 127
           E+F  L   +Y  A C ++++DVT+  ++ NV +W  +      V   E  P V+  N  
Sbjct: 75  EKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKV 129

Query: 128 XXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQ 180
                           +     N+  +  SAK + N +  F  +AR      Q
Sbjct: 130 DVKERKVKAKTITFHRKK----NLQYYDISAKSNYNFEKPFLWLARKLAGNPQ 178

>TPHA0K01060 Chr11 (219078..219719) [642 bp, 213 aa] {ON} Anc_6.90
           YLR293C
          Length = 213

 Score = 78.6 bits (192), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 80/173 (46%), Gaps = 10/173 (5%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        N  ++     WDTAGQ
Sbjct: 7   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFFTNFGEIK-FDCWDTAGQ 65

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXX 127
           E+F  L   +Y  A C ++++DVT+  ++ NV +W  +      V   E  P V+  N  
Sbjct: 66  EKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKV 120

Query: 128 XXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQ 180
                           +     N+  +  SAK + N +  F  +AR     +Q
Sbjct: 121 DVKERKVKAKTITFHRKK----NLQYYDISAKSNYNFEKPFLWLARKLAGNAQ 169

>Kpol_1009.9 s1009 complement(23990..24631) [642 bp, 213 aa] {ON}
           complement(23990..24631) [642 nt, 214 aa]
          Length = 213

 Score = 78.2 bits (191), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 79/173 (45%), Gaps = 10/173 (5%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        N  ++     WDTAGQ
Sbjct: 7   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFFTNFGEIK-FDCWDTAGQ 65

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXX 127
           E+F  L   +Y  A C ++++DVT+  ++ NV +W  +      V   E  P V+  N  
Sbjct: 66  EKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKV 120

Query: 128 XXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQ 180
                           +     N+  +  SAK + N +  F  +AR      Q
Sbjct: 121 DVKERKVKAKTITFHRKK----NLQYYDISAKSNYNFEKPFLWLARKLAGNPQ 169

>NCAS0F00440 Chr6 complement(79004..79663) [660 bp, 219 aa] {ON}
           Anc_6.90 YLR293C
          Length = 219

 Score = 78.2 bits (191), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 79/173 (45%), Gaps = 10/173 (5%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        N  ++     WDTAGQ
Sbjct: 13  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFFTNYGEIK-FDCWDTAGQ 71

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXX 127
           E+F  L   +Y  A C ++++DVT+  ++ NV +W  +      V   E  P V+  N  
Sbjct: 72  EKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKV 126

Query: 128 XXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQ 180
                           +     N+  +  SAK + N +  F  +AR      Q
Sbjct: 127 DVKERKVKAKTITFHRKK----NLQYYDISAKSNYNFEKPFLWLARKLAGNPQ 175

>KAFR0A04800 Chr1 (954630..955289) [660 bp, 219 aa] {ON} Anc_6.90
           YLR293C
          Length = 219

 Score = 77.8 bits (190), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 79/173 (45%), Gaps = 10/173 (5%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        N  ++     WDTAGQ
Sbjct: 13  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIK-FDCWDTAGQ 71

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXX 127
           E+F  L   +Y  A C ++++DVT+  ++ NV +W  +      V   E  P V+  N  
Sbjct: 72  EKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKV 126

Query: 128 XXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQ 180
                           +     N+  +  SAK + N +  F  +AR      Q
Sbjct: 127 DVKERKVKAKTITFHRKK----NLQYYDISAKSNYNFEKPFLWLARKLAGNPQ 175

>NDAI0D02670 Chr4 (618909..619571) [663 bp, 220 aa] {ON} Anc_6.90
          Length = 220

 Score = 77.4 bits (189), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 78/167 (46%), Gaps = 10/167 (5%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        N  ++     WDTAGQ
Sbjct: 14  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNYGEI-KFDCWDTAGQ 72

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXX 127
           E+F  L   +Y  A C ++++DVT+  ++ NV +W  +      V   E  P V+  N  
Sbjct: 73  EKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKV 127

Query: 128 XXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARS 174
                           +     N+  +  SAK + N +  F  +AR 
Sbjct: 128 DVKERKVKAKTITFHRKK----NLQYYDISAKSNYNFEKPFLWLARK 170

>TBLA0E00980 Chr5 (224289..224954) [666 bp, 221 aa] {ON} Anc_6.90
           YLR293C
          Length = 221

 Score = 77.4 bits (189), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 79/173 (45%), Gaps = 10/173 (5%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        N  ++     WDTAGQ
Sbjct: 15  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIK-FDCWDTAGQ 73

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXX 127
           E+F  L   +Y  A C ++++DVT+  ++ NV +W  +      V   E  P V+  N  
Sbjct: 74  EKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKV 128

Query: 128 XXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQ 180
                           +     N+  +  SAK + N +  F  +AR      Q
Sbjct: 129 DVKERKVKAKTITFHRKK----NLQYYDISAKSNYNFEKPFLWLARKLAGNPQ 177

>KNAG0F03180 Chr6 complement(598089..598973) [885 bp, 294 aa] {ON}
           Anc_6.90 YLR293C
          Length = 294

 Score = 78.6 bits (192), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 78/166 (46%), Gaps = 10/166 (6%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        N  ++     WDTAGQ
Sbjct: 88  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIK-FDCWDTAGQ 146

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXX 127
           E+F  L   +Y  A C ++++DVT+  ++ NV +W  +      V   E  P V+  N  
Sbjct: 147 EKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKV 201

Query: 128 XXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIAR 173
                           +     N+  +  SAK + N +  F  +AR
Sbjct: 202 DVKERKVKAKTITFHRKK----NLQYYDISAKSNYNFEKPFLWLAR 243

>Kwal_14.2484 s14 complement(777938..778549) [612 bp, 203 aa] {ON}
           YOR089C (VPS21) - small GTP-binding protein;
           geranylgeranylated; geranylgeranylation required for
           membrane association; also involved in endocytosis post
           vesicle internalization [contig 224] FULL
          Length = 203

 Score = 76.6 bits (187), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 50/169 (29%), Positives = 79/169 (46%), Gaps = 17/169 (10%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDD---KVATMQVWDT 64
           LK+++LG+S VGK++L+ R+    +  +  ATIGA F TK +    +   K    ++WDT
Sbjct: 10  LKLVLLGESSVGKSALVTRFTTGSF-HKSNATIGAAFTTKVISWETETARKEVKFEIWDT 68

Query: 65  AGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILA 124
           AGQER+++L   +YR  D   +V+DVT   +     SW  E   +            ++ 
Sbjct: 69  AGQERYRALTPMYYRNTDVAFVVFDVTEESTSLKADSWVQELKSYMEGEEAHNIVIKLIG 128

Query: 125 NXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIAR 173
           N                +   + +G  P+   SAK    V D FE +AR
Sbjct: 129 NKIDLLD----------EVPPRKVGWTPV---SAKTGEGVADLFESVAR 164

>KLLA0F01232g Chr6 complement(114430..115062) [633 bp, 210 aa] {ON}
           similar to uniprot|P36019 Saccharomyces cerevisiae
           YNL093W YPT53 Involved in vacuolar protein sorting and
           endocytosis GTP-binding protein of the rab family
          Length = 210

 Score = 75.5 bits (184), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 64/104 (61%), Gaps = 6/104 (5%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTK--EVIVNDDKV---ATMQVW 62
           +K+++LG+S VGK++++ R+   ++      TIGA F TK  E + ++D +      ++W
Sbjct: 10  VKLVLLGESSVGKSTIVTRFTTGEFHIN-SPTIGAAFSTKAMEWVDSEDGIKRRVNFEIW 68

Query: 63  DTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEF 106
           DTAGQER++SL   +YR  D  ++V+DVT   S    +SW DE 
Sbjct: 69  DTAGQERYRSLAPMYYRNTDVALIVFDVTQLASEKKAQSWIDEL 112

>Kwal_47.19055 s47 complement(1078494..1079033) [540 bp, 179 aa]
           {ON} YGL210W (YPT32) - ras-like GTPase, highly
           homologous to YPT31 [contig 188] FULL
          Length = 179

 Score = 72.8 bits (177), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 55/179 (30%), Positives = 89/179 (49%), Gaps = 19/179 (10%)

Query: 37  KATIGADFLTKEVIVNDDKVATMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSF 96
           K+TIG +F T+ + V   K+   Q+WDTAGQER++++  A+YRGA   ++VYD++   S+
Sbjct: 4   KSTIGVEFATRTIEVEGKKIKA-QIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSY 62

Query: 97  DNVKSWRDEFLVHANVSSPETFPFVILANXXXXXXXXXXXXXXXAQEQAKSLG--NVPLF 154
           +N   W  E   +A+    E     ++ N                 ++AK+    N  LF
Sbjct: 63  ENCNHWLTELRENAD----ENVAVGLIGN-----KSDLAHLRAVPTDEAKNFAQENQLLF 113

Query: 155 F-TSAKDSINVQDAFEEIARSALQ---QSQSDADAYEDDLSEA---INIQLDGEPSSCN 206
             TSA +S NV  AF E+  +  Q   + Q D + Y ++  +A     I L   P++ N
Sbjct: 114 TETSALNSENVDQAFRELISAIYQMVSKHQVDLNEYGNNAGQAPKGPTISLTPAPANKN 172

>Kpol_1029.8 s1029 complement(15899..16816) [918 bp, 305 aa] {ON}
           complement(15899..16816) [918 nt, 306 aa]
          Length = 305

 Score = 73.9 bits (180), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 57/190 (30%), Positives = 88/190 (46%), Gaps = 21/190 (11%)

Query: 20  KTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQERFQSLGVAFYR 79
           K++L  + +  ++  +Y  TI   +  ++ IV DD VA + + DTAGQE + ++   + R
Sbjct: 23  KSALTIQLIQSQFVDEYDPTIEDSY--RKQIVLDDSVAILDILDTAGQEEYSAMREQYMR 80

Query: 80  GADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXXXXXXXXXXXXXX 139
             +  +LVY VT+  S++ + S+  +      V   E  P V++ N              
Sbjct: 81  TGEGFLLVYSVTSRNSYEELMSYYQQI---QRVKDTEYIPVVVVGN-----KSDLETERQ 132

Query: 140 XAQEQAKSLG---NVPLFFTSAKDSINVQDAFEEIARSALQQSQSDADAYEDDLSEAINI 196
            + E+  SL    N P   TSAK  INVQDAF  +AR      + +   Y   L   IN 
Sbjct: 133 VSYEEGMSLAKQMNAPFLETSAKQDINVQDAFYNLARLV----RDEGGRYNAQLMSTIN- 187

Query: 197 QLDGEPSSCN 206
              GEP S N
Sbjct: 188 ---GEPISSN 194

>CAGL0J05632g Chr10 complement(539466..540032) [567 bp, 188 aa] {ON}
           highly similar to uniprot|P06781 Saccharomyces
           cerevisiae YNL090w RHO2
          Length = 188

 Score = 71.6 bits (174), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 89/181 (49%), Gaps = 12/181 (6%)

Query: 1   MSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQ 60
           MS K    K++I+GD   GKTSL++ +   K+ +QY  T+  +++T +  V+  KV ++ 
Sbjct: 1   MSEKAIRRKLVIIGDGACGKTSLLYVFTLGKFPEQYHPTVFENYVT-DCRVDGIKV-SLA 58

Query: 61  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKS-WRDEFLVHANVSSPETFP 119
           +WDTAGQE ++ L    Y GAD  ++ + V N +S  N ++ W +E   +     P+  P
Sbjct: 59  LWDTAGQEEYERLRPFSYSGADVILIAFSVDNVESLHNARTKWAEEAFRYC----PDA-P 113

Query: 120 FVILANXXXXXXXXXX----XXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSA 175
            +++                     A++ AK++G       SA     V D FE   RS+
Sbjct: 114 VILVGLKEDLRKSKQEGIVFVNREDAEQVAKAIGAKKYLECSALTGEGVDDVFELATRSS 173

Query: 176 L 176
           L
Sbjct: 174 L 174

>NCAS0G02730 Chr7 (491357..491920) [564 bp, 187 aa] {ON} 
          Length = 187

 Score = 70.9 bits (172), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 52/180 (28%), Positives = 90/180 (50%), Gaps = 11/180 (6%)

Query: 1   MSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQ 60
           MS K    K++I+GD   GKTSL++ +   K+ Q+Y  T+  +++T +  V+  KV ++ 
Sbjct: 1   MSEKAVRRKLVIIGDGACGKTSLLYVFTLGKFPQEYHPTVFENYVT-DCRVDGIKV-SLT 58

Query: 61  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKS-WRDEFLVHANVSSPETFP 119
           +WDTAGQE ++ L    Y  AD  ++ + + + +S DN ++ W +E L +     PE  P
Sbjct: 59  LWDTAGQEEYERLRPFSYSKADIILIGFAINDTESLDNARNKWTEEALRYC----PEA-P 113

Query: 120 FVILA---NXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSAL 176
            +++    +               AQ+ A+ +G       SA     V D FE   R++L
Sbjct: 114 IILVGLKKDLRQKQDGVEMVKPEDAQQVARIIGAKKYVECSALTGEGVDDVFELATRTSL 173

>KAFR0D02040 Chr4 complement(412576..413382,413464..413481) [825 bp,
           274 aa] {ON} Anc_2.182 YNL098C
          Length = 274

 Score = 72.0 bits (175), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 82/164 (50%), Gaps = 7/164 (4%)

Query: 10  VIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQER 69
           + ++G  G+GK+++  R++  +++ +Y  TI  D   K++ V++ K  T+ + DTAGQE 
Sbjct: 16  IAVVGSGGIGKSAITIRFIQSRFTDEYDPTI-EDSYRKQLTVDNAKY-TIDILDTAGQEE 73

Query: 70  FQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXXXX 129
           +  +   + R  D  +LVY +++ +S+D + ++  + L    V   E  P V++ N    
Sbjct: 74  YYMMREQYMRNCDGFLLVYSISSMQSYDELLNFYHQIL---RVKEVEYIPIVVIGNKSDL 130

Query: 130 XXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIAR 173
                       Q      G  P F TSAK  +N+  AF+ + R
Sbjct: 131 ESERQVSFKEGEQMGCNISG--PFFETSAKYGLNIDVAFQSLVR 172

>Kpol_520.36 s520 complement(90395..91072) [678 bp, 225 aa] {ON}
           complement(90395..91072) [678 nt, 226 aa]
          Length = 225

 Score = 71.2 bits (173), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 79/160 (49%), Gaps = 7/160 (4%)

Query: 12  ILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQERFQ 71
           ++GD+ VGKTSLM +YV + ++ +Y  T+G +FL ++V V    +    + D  GQ+ F 
Sbjct: 19  LVGDAQVGKTSLMVKYVQNIFNDEYTQTLGVNFLKRKVSVRSTDIV-FSILDLGGQKEFI 77

Query: 72  SLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXXXXXX 131
           ++      G+   + ++D+T  ++ +++K W  +    AN  + +  P ++         
Sbjct: 78  NMLPIASIGSSAIIFLFDLTRPETLNSIKEWYRQ----ANGLNDQAIPILVGTKYDLFID 133

Query: 132 XXXXXXXXXAQ--EQAKSLGNVPLFFTSAKDSINVQDAFE 169
                    ++   Q   + N PL FTS   SINVQ  F+
Sbjct: 134 LDQSTQEKISRIAMQYAQVMNAPLIFTSTAKSINVQKIFK 173

>KAFR0J01240 Chr10 complement(229638..230201) [564 bp, 187 aa] {ON}
           Anc_2.200 YNL090W
          Length = 187

 Score = 69.3 bits (168), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 89/179 (49%), Gaps = 9/179 (5%)

Query: 1   MSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQ 60
           MS K    K++I+GD   GKTSL++ +   K+ ++Y  T+  +++T +  V+  KV ++ 
Sbjct: 1   MSEKAIRRKLVIIGDGACGKTSLLYVFTLGKFPEEYHPTVFENYVT-DCRVDGIKV-SLA 58

Query: 61  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPF 120
           +WDTAGQE ++ L    Y  AD  ++ + V + +S +N    RD++ V A    PE  P 
Sbjct: 59  LWDTAGQEEYERLRPFSYSNADVILIAFAVDDVESLENT---RDKWAVEALRYCPEV-PI 114

Query: 121 VILA---NXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSAL 176
           +++    +                Q+ A+++G       SA     V D FE   R++L
Sbjct: 115 ILVGLKKDLRQANNKNRMVRPEDVQKIARAVGAKNYMECSALTGEGVDDVFEVATRTSL 173

>Ecym_5365 Chr5 (743477..744046) [570 bp, 189 aa] {ON} similar to
           Ashbya gossypii ACL087C
          Length = 189

 Score = 68.2 bits (165), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 81/173 (46%), Gaps = 11/173 (6%)

Query: 9   KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQE 68
           K++I+GD   GKTSL+H +   K+ ++Y+ TI  +++T   +  D     + +WDTAGQE
Sbjct: 9   KLVIIGDGACGKTSLLHVFTLGKFPEEYQPTIFENYVTDCRV--DGIRVQLALWDTAGQE 66

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILA---- 124
            ++ L    Y  AD  ++ + + + +S  N    R+++ V A    P   P +++     
Sbjct: 67  EYERLRPMSYSKADIILIGFAIDDAESLLNA---REKWTVEALRYCPSA-PIILVGLKKD 122

Query: 125 -NXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSAL 176
                            AQE AK++G       SA     V D FE   R++L
Sbjct: 123 LRKSNSIDRAEMVNLSQAQEVAKAIGAKKYMECSALTGEGVDDVFELATRTSL 175

>KNAG0M01830 Chr13 complement(339904..340464) [561 bp, 186 aa] {ON} 
          Length = 186

 Score = 67.8 bits (164), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 52/179 (29%), Positives = 87/179 (48%), Gaps = 10/179 (5%)

Query: 1   MSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQ 60
           MS K    K++I+GD   GKTSL++ +   ++ Q+Y+ T+  +++T +  V+  KV  + 
Sbjct: 1   MSEKAIRRKLVIIGDGACGKTSLLYVFTLGQFPQEYQPTVFENYVT-DCRVDGIKV-MLA 58

Query: 61  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVK-SWRDEFLVHANVSSPETFP 119
           +WDTAGQE ++ L    Y  AD  V+ + V +  S +N +  W  E   +     P+  P
Sbjct: 59  LWDTAGQEEYERLRPFSYSKADIIVIGFAVDDEDSLENARDKWAQEVFRYC----PDA-P 113

Query: 120 FVI--LANXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSAL 176
            V+  L N               A++ A+++G       SA     V D FE   R++L
Sbjct: 114 IVLVGLKNDLRNNVDAKLVSPQMAEQVARAIGAKKYMECSALTGEGVDDVFEVATRTSL 172

>Suva_14.250 Chr14 (455251..455829) [579 bp, 192 aa] {ON} YNL090W
           (REAL)
          Length = 192

 Score = 67.8 bits (164), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 53/185 (28%), Positives = 89/185 (48%), Gaps = 16/185 (8%)

Query: 1   MSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQ 60
           MS K    K++I+GD   GKTSL++ +   K+ +QY  T+  +++T +  V+  KV ++ 
Sbjct: 1   MSEKAVRRKLVIIGDGACGKTSLLYVFTLGKFPEQYHPTVFENYVT-DCRVDGIKV-SLT 58

Query: 61  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKS-WRDEFLVHANVSSPETFP 119
           +WDTAGQE ++ L    Y  AD  ++ + V N +S  N ++ W DE L +     P+  P
Sbjct: 59  LWDTAGQEEYERLRPFSYSKADIILIGFAVDNSESLINARTKWADEALRYC----PDA-P 113

Query: 120 FVILA--------NXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEI 171
            V++                         A++ A+++G       SA     V D FE  
Sbjct: 114 IVLVGLKKDLRQEAHFKENAVDEMVPAEDAKQVARAIGAKKYMECSALTGEGVDDVFEVA 173

Query: 172 ARSAL 176
            R++L
Sbjct: 174 TRTSL 178

>NCAS0A06070 Chr1 (1197908..1198585) [678 bp, 225 aa] {ON} Anc_4.326
          Length = 225

 Score = 67.8 bits (164), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 81/165 (49%), Gaps = 9/165 (5%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
           L++ ++GD+ VGKTSLM +YV + + ++Y  T+G +FL ++V ++   +    + D  GQ
Sbjct: 21  LQIGLVGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKVKLHSTDIV-FSLMDLGGQ 79

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXX 127
           + F ++      G+   V ++D+T  ++ +++K W  +     +++ P     +++    
Sbjct: 80  KEFINMLPIAAVGSSVIVFLFDLTRPETLNSIKDWYRQVKGLNDIAIP-----ILVGTKY 134

Query: 128 XXXXXXXXXXXXXAQEQAKSLGNV---PLFFTSAKDSINVQDAFE 169
                            A    NV   PL F S  +SINVQ  F+
Sbjct: 135 DLLINLSAEYQEQISTAAIDYANVMDAPLIFCSTAESINVQKIFK 179

>KLTH0G08294g Chr7 (678358..678921) [564 bp, 187 aa] {ON} highly
           similar to uniprot|P06781 Saccharomyces cerevisiae
           YNL090W RHO2 Non-essential small GTPase of the Rho/Rac
           subfamily of Ras-like proteins involved in the
           establishment of cell polarity and in microtubule
           assembly
          Length = 187

 Score = 67.0 bits (162), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 88/172 (51%), Gaps = 11/172 (6%)

Query: 9   KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQE 68
           K++I+GD   GKTSL++ +   K+ ++Y  T+  +++T +  V+  KV ++ +WDTAGQE
Sbjct: 9   KLVIIGDGACGKTSLLYVFALGKFPKEYHPTVFENYVT-DCRVDGIKV-SLALWDTAGQE 66

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKS-WRDEFLVHANVSSPETFPFVILA--- 124
            ++ L    Y  A+  ++ + + + +S  N ++ W +E L +     PE  P V++    
Sbjct: 67  EYERLRPFSYSKANVILIGFAIDDAESLLNARTKWTEEALRYC----PEA-PIVLVGLKR 121

Query: 125 NXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSAL 176
           +               A++ A+++G       SA D   V D FE   R++L
Sbjct: 122 DLRKSESSHKFVTREEAEQVARAIGAKKYMECSALDGSGVDDVFELATRTSL 173

>NCAS0G01910 Chr7 complement(342761..343636) [876 bp, 291 aa] {ON}
           Anc_2.75
          Length = 291

 Score = 68.6 bits (166), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 64/127 (50%), Gaps = 16/127 (12%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGAD----------FLTKEVIVNDD--- 54
           +K +I+GD  VGKTSL+  Y  + + Q Y  T+  +          FL++E + N++   
Sbjct: 4   IKTVIVGDGAVGKTSLLISYTTNTFPQDYIPTVFDNYSTTISLRDPFLSRESLANENEND 63

Query: 55  --KVATMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDN-VKSWRDEFLVHAN 111
             ++  + +WDTAGQE +  L    Y   D  ++ + V    SF+N V  W  E   +AN
Sbjct: 64  HLELFKLNLWDTAGQEEYDRLRPLSYPQTDVFLICFSVAELSSFENVVDKWLPEIKQNAN 123

Query: 112 VSSPETF 118
           V S E F
Sbjct: 124 VESSELF 130

>CAGL0B04521g Chr2 complement(439732..440751) [1020 bp, 339 aa] {ON}
           similar to uniprot|P01120 Saccharomyces cerevisiae
           YNL098c RAS2 GTP-binding protein or uniprot|P01119
           Saccharomyces cerevisiae YOR101w RAS1
          Length = 339

 Score = 68.6 bits (166), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 49/154 (31%), Positives = 77/154 (50%), Gaps = 7/154 (4%)

Query: 20  KTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQERFQSLGVAFYR 79
           K++L  + V+  +  +Y  TI  D   K+V++ DDKV  + + DTAGQE + ++   + R
Sbjct: 21  KSALTIQLVHSHFVDEYDPTI-EDSYRKQVVI-DDKVTILDILDTAGQEEYSAMREQYMR 78

Query: 80  GADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXXXXXXXXXXXXXX 139
             +  +LVY VT+  SF+ + ++  +      V   E  P V++ N              
Sbjct: 79  TGEGFLLVYSVTSRTSFEELITYYQQI---QRVKDVEYIPVVVVGNKSDLETERQVSFEE 135

Query: 140 XAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIAR 173
            A   AK L N P   TSAK +INV+DAF  + R
Sbjct: 136 GA-SLAKQL-NAPFLETSAKQAINVEDAFYTLVR 167

>NDAI0B05400 Chr2 (1326549..1327436) [888 bp, 295 aa] {ON} Anc_1.215
          Length = 295

 Score = 68.2 bits (165), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 50/179 (27%), Positives = 84/179 (46%), Gaps = 4/179 (2%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
           LK++++GD  VGKT L+  YVN+++   Y  T+  +++T  V + + +V  + +WDTAGQ
Sbjct: 73  LKIVVVGDGNVGKTCLLISYVNNEFPTDYIPTVFENYVT-SVNMPNREVIELALWDTAGQ 131

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKS-WRDEFLVHANVSSPETFPFVILANX 126
           E +  L    Y   D  ++ Y V N  S ++V+  W  E + H    +P      + ++ 
Sbjct: 132 EEYNRLRPLSYTDVDVLMVCYSVDNKTSLEHVEELWFPE-VRHFCGKTPVML-IGLKSDL 189

Query: 127 XXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQSDADA 185
                         A+  AK +G       SAK   NV++ F +     L  S+ D  A
Sbjct: 190 YAEDKGEGLVETKHAELIAKKMGAFVHLQCSAKSRDNVEEVFNKAIEIVLGDSRGDGKA 248

>YNL090W Chr14 (456565..457143) [579 bp, 192 aa] {ON}
           RHO2Non-essential small GTPase of the Rho/Rac subfamily
           of Ras-like proteins, involved in the establishment of
           cell polarity and in microtubule assembly
          Length = 192

 Score = 66.6 bits (161), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 53/185 (28%), Positives = 89/185 (48%), Gaps = 16/185 (8%)

Query: 1   MSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQ 60
           MS K    K++I+GD   GKTSL++ +   K+ +QY  T+  +++T +  V+  KV ++ 
Sbjct: 1   MSEKAVRRKLVIIGDGACGKTSLLYVFTLGKFPEQYHPTVFENYVT-DCRVDGIKV-SLT 58

Query: 61  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKS-WRDEFLVHANVSSPETFP 119
           +WDTAGQE ++ L    Y  AD  ++ + V N +S  N ++ W DE L +     P+  P
Sbjct: 59  LWDTAGQEEYERLRPFSYSKADIILIGFAVDNFESLINARTKWADEALRYC----PDA-P 113

Query: 120 FVILA--------NXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEI 171
            V++                         A++ A+++G       SA     V D FE  
Sbjct: 114 IVLVGLKKDLRQEAHFKENATDEMVPIEDAKQVARAIGAKKYMECSALTGEGVDDVFEVA 173

Query: 172 ARSAL 176
            R++L
Sbjct: 174 TRTSL 178

>Kwal_47.16983 s47 complement(197253..197924) [672 bp, 223 aa] {ON}
           YML064C (TEM1) - GTP-binding protein, RAS superfamily
           [contig 218] FULL
          Length = 223

 Score = 67.0 bits (162), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 79/164 (48%), Gaps = 7/164 (4%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
           LK+ ++GD+ VGKTSLM +YV + + ++Y  T+G + L+K++ +   ++    + D  GQ
Sbjct: 19  LKIGLIGDAQVGKTSLMVKYVENVFDEEYTQTLGVNCLSKKITLGSAEI-LFYIMDLGGQ 77

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXX 127
             F ++      GA   + ++D+T  ++  ++K W  +    A   + +  P ++     
Sbjct: 78  REFINMLPLASEGAKAIIFLFDLTRPETLKSIKEWHRQ----ATGFNEQAVPLLVGTKYD 133

Query: 128 XXXXXXXXXXXXXAQEQAK--SLGNVPLFFTSAKDSINVQDAFE 169
                        +++  +     + PL F S   SINVQ  F+
Sbjct: 134 LFVNLDPEYQAQISKQSMRYAQAMDAPLIFCSTSHSINVQKIFK 177

>Smik_14.237 Chr14 (436872..437450) [579 bp, 192 aa] {ON} YNL090W
           (REAL)
          Length = 192

 Score = 66.6 bits (161), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 64/108 (59%), Gaps = 3/108 (2%)

Query: 1   MSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQ 60
           MS K    K++I+GD   GKTSL++ +   K+ +QY  T+  +++T +  V+  KV ++ 
Sbjct: 1   MSEKAVRRKLVIIGDGACGKTSLLYVFTLGKFPEQYHPTVFENYVT-DCRVDGIKV-SLT 58

Query: 61  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKS-WRDEFL 107
           +WDTAGQE ++ L    Y  AD  ++ + V N +S  N ++ W DE L
Sbjct: 59  LWDTAGQEEYERLRPFSYSKADIILIGFAVDNFESLINARTKWADEAL 106

>Kwal_33.14452 s33 complement(679084..679866) [783 bp, 260 aa] {ON}
           YLR229C (CDC42) - member of the Rho subfamily of
           Ras-like proteins [contig 103] FULL
          Length = 260

 Score = 67.0 bits (162), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 42/117 (35%), Positives = 58/117 (49%), Gaps = 7/117 (5%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQV-----W 62
           +K +I+GD  VGKTSL+  Y  + + Q Y  T+  D  T  + +ND   A  QV     W
Sbjct: 4   VKCVIVGDGAVGKTSLLISYTTNTFPQDYIPTV-FDNYTTTIALNDGDSAEPQVFRLNLW 62

Query: 63  DTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVK-SWRDEFLVHANVSSPETF 118
           DTAGQE +  L    Y   D  +L + +    SF+NVK  W  E   + N  + E F
Sbjct: 63  DTAGQEEYDRLRPLSYPQTDIFLLCFSINEPNSFENVKDKWFPEIRHNTNYENLELF 119

>CAGL0L11242g Chr12 (1199371..1200135) [765 bp, 254 aa] {ON} highly
           similar to uniprot|P38987 Saccharomyces cerevisiae
           YML064c TEM1 GTP-binding protein of the RAS superfamily
          Length = 254

 Score = 66.6 bits (161), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 81/164 (49%), Gaps = 7/164 (4%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
           ++V ++GD+ VGKTSLM +YV + + ++Y  T+G +FL ++V +    +    + D  GQ
Sbjct: 29  IQVGLIGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKVSIRSTDIV-FSLMDLGGQ 87

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXX 127
             F ++      G+   +L++D+T  ++ +++K W  + L   N S+    P ++     
Sbjct: 88  REFINMLPIATLGSSVIILLFDLTRPETLNSIKEWYRQAL-GLNDSA---IPILVGTKYD 143

Query: 128 XXXXXXXXXXXXXAQEQAK--SLGNVPLFFTSAKDSINVQDAFE 169
                        ++   K   + + PL F S   SIN+Q  F+
Sbjct: 144 LFIDLEEEYQEKVSKTSMKYAQVMDAPLIFCSTAKSINIQKIFK 187

>Kwal_26.8387 s26 (763564..764442) [879 bp, 292 aa] {ON} YNL098C
           (RAS2) - Small, GTP-binding protein [contig 60] FULL
          Length = 292

 Score = 67.0 bits (162), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/157 (29%), Positives = 78/157 (49%), Gaps = 13/157 (8%)

Query: 20  KTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQERFQSLGVAFYR 79
           K++L  + +   +  +Y  TI  D   K+V++ DDKV+ + + DTAGQE + ++   + R
Sbjct: 29  KSALTIQLIQSHFVDEYDPTI-EDSYRKQVVI-DDKVSILDILDTAGQEEYSAMREQYMR 86

Query: 80  GADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXXXXXXXXXXXXXX 139
             +  +LVY VT+  SFD + ++  + L    V   +  P  ++ N              
Sbjct: 87  TGEGFLLVYSVTSRTSFDELMTYYQQIL---RVKDADYVPVFLVGN-----KSDLEDERQ 138

Query: 140 XAQEQAKSLG---NVPLFFTSAKDSINVQDAFEEIAR 173
            A E+  SL    N P   TSAK +INV+D+F  + R
Sbjct: 139 VAYEEGVSLAKQFNAPFMETSAKQAINVEDSFYGLVR 175

>ACL087C Chr3 complement(191573..192136) [564 bp, 187 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL090W
           (RHO2)
          Length = 187

 Score = 65.5 bits (158), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 82/171 (47%), Gaps = 9/171 (5%)

Query: 9   KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQE 68
           K++I+GD   GKTSL+H +   K+ ++Y  T+  +++T +  V+  KV  + +WDTAGQE
Sbjct: 9   KLVIIGDGACGKTSLLHVFTLGKFPEEYLPTVFENYVT-DCRVDGIKV-QLALWDTAGQE 66

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILA---N 125
            ++ L    Y  AD  ++ + + +  S  N    R+++ V A    P   P +++    +
Sbjct: 67  EYERLRPMSYSKADIILIGFAIDDPGSLSNA---REKWTVEALRYCPNA-PIILVGLKKD 122

Query: 126 XXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSAL 176
                          AQE  +++G       SA     V D FE   R++L
Sbjct: 123 LRRPGTQCAMVAPSQAQEVVRAIGAKKYMECSALTGEGVDDVFELATRTSL 173

>KLTH0D16236g Chr4 (1344371..1345048) [678 bp, 225 aa] {ON} similar
           to uniprot|P38987 Saccharomyces cerevisiae YML064C TEM1
           Gtp-binding protein of the ras superfamily involved in
           termination of M-phase GTP-binding protein RAS
           superfamily
          Length = 225

 Score = 66.2 bits (160), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 78/164 (47%), Gaps = 7/164 (4%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
           LK+ ++GD+ VGKTSLM +YV + + ++Y  T+G + L+K++ +    +    + D  GQ
Sbjct: 21  LKIGLIGDAQVGKTSLMVKYVENVFDEEYTQTLGVNCLSKKITLGSADI-LFYIMDLGGQ 79

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXX 127
             F ++      GA   + ++D+T  ++  ++K W  +    A   + +  P ++     
Sbjct: 80  REFINMLPLASEGAKAIIFLFDLTRPETLKSIKEWHRQ----ATGFNEQAVPLLVGTKYD 135

Query: 128 XXXXXXXXXXXXXAQEQAK--SLGNVPLFFTSAKDSINVQDAFE 169
                        +++  +     + PL F S   SINVQ  F+
Sbjct: 136 LFVNLDPEYQAQISKQSMRYAQAMDAPLIFCSTSHSINVQKIFK 179

>KAFR0F03670 Chr6 complement(726736..727527) [792 bp, 263 aa] {ON}
           Anc_4.73 YGR152C
          Length = 263

 Score = 66.6 bits (161), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 81/169 (47%), Gaps = 6/169 (3%)

Query: 9   KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQE 68
           K+++LG  GVGK+ L  ++V   Y   Y  TI   +  ++ I  D+KV  +++ DTAG  
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSY--RKTIEIDNKVFDLEILDTAGVA 62

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXXX 128
           +F ++   + +     +LVY VT+ +S D +   R++ L    +   +  P V++ N   
Sbjct: 63  QFTAMRELYIKSGMGFLLVYSVTDQRSLDELMELREQVL---RIKDSDKVPMVLVGNKAD 119

Query: 129 XXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQ 177
                        +  +K  G VP + TSA    NV + F ++ R  ++
Sbjct: 120 LTDERVISVEDGIEISSK-WGKVPFYETSALLRSNVDEVFVDVVRQIIR 167

>NCAS0B08090 Chr2 (1545134..1546003) [870 bp, 289 aa] {ON} Anc_1.215
          Length = 289

 Score = 67.0 bits (162), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 56/189 (29%), Positives = 84/189 (44%), Gaps = 17/189 (8%)

Query: 1   MSRKKNI----LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKV 56
           M R  N+    +K++I+GD GVGKT L+  YV  ++      T+  +++T +    D +V
Sbjct: 53  MKRTNNLPDFHVKIVIVGDEGVGKTCLLISYVQREFPTGDIPTVFENYVT-DFEGPDGEV 111

Query: 57  ATMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVK-SWRDEFLVHANVSSP 115
             + +WDTA QE +  L    Y   D  ++ Y V N  S  N+K SW  E + H    +P
Sbjct: 112 VELALWDTAAQEDYNRLRPLSYTDVDILLVCYSVANPTSLKNIKRSWIPE-VKHFCYKTP 170

Query: 116 ETFPFVILANXX-----XXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEE 170
                VIL                      A++ A+ LG +     SAK   NV+D F  
Sbjct: 171 -----VILVGLKSDLYDSNENTDTLVDPKEAEQLAEKLGALAHLQCSAKTRQNVEDVFTV 225

Query: 171 IARSALQQS 179
             R+ L  S
Sbjct: 226 AIRTVLAGS 234

>KLLA0B05038g Chr2 complement(457608..458279) [672 bp, 223 aa] {ON}
           similar to uniprot|P38987 Saccharomyces cerevisiae
           YML064C TEM1 Gtp-binding protein of the ras superfamily
           involved in termination of M-phase GTP-binding protein
           RAS superfamily
          Length = 223

 Score = 65.9 bits (159), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 58/100 (58%), Gaps = 1/100 (1%)

Query: 3   RKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVW 62
           R +  +KV ++GD+ VGKTSLM +YV + + ++Y  T+G  +L ++V++    V    + 
Sbjct: 12  RHQVKVKVGLIGDAQVGKTSLMVKYVQNVFDEEYTQTLGVHYLERKVVLGSTDV-IFSIM 70

Query: 63  DTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSW 102
           D  GQ  F ++      GA   V ++D+T  ++ +++K W
Sbjct: 71  DLGGQREFINMLPLVSEGAVAIVFLFDLTRPETLNSIKEW 110

>KLLA0C13816g Chr3 (1183412..1183975) [564 bp, 187 aa] {ON} highly
           similar to uniprot|P06781 Saccharomyces cerevisiae
           YNL090W RHO2 Non-essential small GTPase of the Rho/Rac
           subfamily of Ras-like proteins involved in the
           establishment of cell polarity and in microtubule
           assembly
          Length = 187

 Score = 65.1 bits (157), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 87/172 (50%), Gaps = 11/172 (6%)

Query: 9   KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQE 68
           K++I+GD   GKTSL++ +   ++ ++Y  T+  +++T +  V+  KV  + +WDTAGQE
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGQFPEEYHPTVFENYVT-DCRVDGIKVQ-LTLWDTAGQE 66

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKS-WRDEFLVHANVSSPETFPFVILA--- 124
            ++ L    Y  AD  ++ + + + +S  N ++ W +E L +     PE  P V++    
Sbjct: 67  EYERLRPFSYSKADIILIGFAIDDPESLVNARNKWSEEVLRYC----PEA-PVVLVGLKK 121

Query: 125 NXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSAL 176
           +               A++ A+++G       SA    NV D FE   R++L
Sbjct: 122 DLRSPDNEHQMVTREQAEQVARAIGAKKYMECSALTGENVDDVFEVATRTSL 173

>KNAG0C01260 Chr3 complement(243934..244833) [900 bp, 299 aa] {ON}
           Anc_1.215 YKR055W
          Length = 299

 Score = 66.6 bits (161), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 53/99 (53%), Gaps = 2/99 (2%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
           LK++++GD  VGKTSL+  YV   +  +Y  T+  +++T  +    DK   + +WDTAGQ
Sbjct: 82  LKIVVVGDGTVGKTSLLMSYVQKTFPTEYVPTVFENYVTT-IEGPQDKCIELALWDTAGQ 140

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKS-WRDE 105
           E +  L    Y   D  ++ Y V N  SF N +  W  E
Sbjct: 141 EEYNRLRPLSYTNVDILMICYAVDNRNSFKNAEDIWYPE 179

>TBLA0B01750 Chr2 complement(392769..393890) [1122 bp, 373 aa] {ON}
           Anc_2.182 YNL098C
          Length = 373

 Score = 67.0 bits (162), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 76/154 (49%), Gaps = 7/154 (4%)

Query: 20  KTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQERFQSLGVAFYR 79
           K++L  R +   +  +Y  TI  D   K+V++ DDKV  + + DTAGQE + ++   + R
Sbjct: 23  KSALTIRLIQSHFVDEYDPTI-EDSYRKQVVI-DDKVTILDILDTAGQEEYSAMREQYMR 80

Query: 80  GADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXXXXXXXXXXXXXX 139
             +  +LVY VT+  SF+ + ++  +      V   +  P +++ N              
Sbjct: 81  TGEGFLLVYSVTSRNSFEELMNYYQQI---QRVKDTDYVPIMVVGN-KSDLEIERQVTFE 136

Query: 140 XAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIAR 173
                AK + N P   TSAK++INV+DAF  + R
Sbjct: 137 EGMTMAKQM-NSPFLETSAKEAINVEDAFYNLVR 169

>KLTH0B06996g Chr2 (565363..566142) [780 bp, 259 aa] {ON} weakly
           similar to uniprot|P53879 Saccharomyces cerevisiae
           YNL180C RHO5 Non-essential small GTPase of the Rho/Rac
           subfamily of Ras-like proteins likely involved in
           protein kinase C (Pkc1p)-dependent signal transduction
           pathway that controls cell integrity
          Length = 259

 Score = 65.9 bits (159), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 58/117 (49%), Gaps = 7/117 (5%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDK-----VATMQVW 62
           +K +I+GD  VGKTSL+  Y  + + Q Y  T+  D  T  + +ND K     V  + +W
Sbjct: 4   VKCVIVGDGAVGKTSLLISYTTNTFPQDYIPTV-FDNYTTTIALNDGKSIEPQVFRLNLW 62

Query: 63  DTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVK-SWRDEFLVHANVSSPETF 118
           DTAGQE +  L    Y   D  +L + +    SF NVK  W  E   + N  + E F
Sbjct: 63  DTAGQEEYDRLRPLSYPQTDIFLLCFSINEPNSFMNVKDKWFPEIRHNTNYDNLELF 119

>Skud_14.241 Chr14 (446886..447464) [579 bp, 192 aa] {ON} YNL090W
           (REAL)
          Length = 192

 Score = 65.1 bits (157), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/189 (27%), Positives = 90/189 (47%), Gaps = 16/189 (8%)

Query: 1   MSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQ 60
           MS K    K++I+GD   GKTSL++ +   K+ ++Y  T+  +++T +  V+  KV ++ 
Sbjct: 1   MSEKAVRRKLVIIGDGACGKTSLLYVFTLGKFPERYHPTVFENYVT-DCRVDGIKV-SLT 58

Query: 61  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKS-WRDEFLVHANVSSPETFP 119
           +WDTAGQE ++ L    Y  AD  ++ + V N +S  N ++ W DE L +     P+  P
Sbjct: 59  LWDTAGQEEYERLRPFSYSKADIILIGFAVDNFESLINARTKWADEALRYC----PDA-P 113

Query: 120 FVILANXXXXXXXXXXXXXXX--------AQEQAKSLGNVPLFFTSAKDSINVQDAFEEI 171
            V++                         A++ A+++G       SA     V D FE  
Sbjct: 114 IVLVGLKRDLREELHFKESAVDDMVPIEDAKQVARAIGAKKYMECSALTGEGVDDVFEVA 173

Query: 172 ARSALQQSQ 180
            R++L   +
Sbjct: 174 TRTSLLMKK 182

>YML064C Chr13 complement(145139..145876) [738 bp, 245 aa] {ON}
           TEM1GTP-binding protein of the ras superfamily involved
           in termination of M-phase; controls actomyosin and
           septin dynamics during cytokinesis
          Length = 245

 Score = 65.9 bits (159), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 77/164 (46%), Gaps = 7/164 (4%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
           ++V ++GD+ VGKTSLM +YV + Y ++Y  T+G +FL ++V +    +    + D  GQ
Sbjct: 21  VQVGLVGDAQVGKTSLMVKYVQNIYDKEYTQTLGVNFLKRKVSIRSTDI-IFSIMDLGGQ 79

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXX 127
             F ++      G+   + ++D+T  ++  ++K W  +    A   +    P ++     
Sbjct: 80  REFINMLPIATVGSSVIIFLFDLTRPETLSSIKEWYRQ----AYGLNDSAIPILVGTKYD 135

Query: 128 XXXXXXXXXXXXXAQEQAK--SLGNVPLFFTSAKDSINVQDAFE 169
                        ++   K   + N PL F S   SIN+Q  F+
Sbjct: 136 LLIDLDPEYQEQISRTSMKYAQVMNAPLIFCSTAKSINIQKIFK 179

>TPHA0B01720 Chr2 complement(384530..385420) [891 bp, 296 aa] {ON}
           Anc_4.326 YML064C
          Length = 296

 Score = 66.2 bits (160), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 85/171 (49%), Gaps = 9/171 (5%)

Query: 2   SRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQV 61
           SR +  ++V ++GD+ VGKTSLM +YV + ++++Y  T+G +FL + V V    +    +
Sbjct: 22  SRNQVEIQVGLIGDAQVGKTSLMVKYVQNIFNEEYTQTLGVNFLKRTVSVRSTDIV-FSL 80

Query: 62  WDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFV 121
            D  GQ+ F ++      G+   V ++D+T  ++ +++K+W  +    AN  +    P +
Sbjct: 81  LDLGGQKEFINMLPIATVGSAAIVFLFDLTRPETLNSIKNWYRQ----ANGLNEMAIPIL 136

Query: 122 ILANX---XXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFE 169
           +                     + E A+ + + PL F S   SINVQ  F+
Sbjct: 137 VGTKYDLFINLDKEHQDSISRLSMEIAQVMDS-PLVFCSTSKSINVQKIFK 186

>TBLA0B01800 Chr2 complement(408546..409136) [591 bp, 196 aa] {ON}
           Anc_2.200 YNL090W
          Length = 196

 Score = 64.7 bits (156), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 80/172 (46%), Gaps = 10/172 (5%)

Query: 9   KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQE 68
           K++I+GD   GKTSL+H +    + + Y  T+  +++T +  V+  KV ++ +WDTAGQE
Sbjct: 17  KLVIIGDGACGKTSLLHVFTLGTFPENYHPTVFENYVT-DCRVDGIKV-SLTLWDTAGQE 74

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKS-WRDEFLVHANVSSPETFPFVILANXX 127
            ++ L    Y  AD  ++ + V + +S +N K  W DE L +     P     ++     
Sbjct: 75  EYERLRPYSYTNADIILIGFAVNDQESLENAKGKWIDEVLRYC----PGARILLVGLKKD 130

Query: 128 XXXXXXXX---XXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSAL 176
                           AQ+ AK +G       SA     V D FE   RS+L
Sbjct: 131 LRKDVMNKDQLVKIEDAQQVAKIIGAKKYLECSALTGEGVDDVFELATRSSL 182

>TPHA0P00920 Chr16 complement(185904..186470) [567 bp, 188 aa] {ON}
           Anc_2.200 YNL090W
          Length = 188

 Score = 64.7 bits (156), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 62/100 (62%), Gaps = 3/100 (3%)

Query: 9   KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQE 68
           K++I+GD   GKTSL++++   K+ +QY  T+  +++T +  V+  KV+ + +WDTAGQE
Sbjct: 8   KLVIIGDGACGKTSLLYKFTLGKFPEQYHPTVFENYVT-DCFVDGIKVS-LTLWDTAGQE 65

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKS-WRDEFL 107
            ++ L    Y  AD  ++ + V + +S  N ++ W +E L
Sbjct: 66  EYERLRPFSYSKADIILIGFAVDDVESLHNARTKWTEEVL 105

>NDAI0B04180 Chr2 (1055285..1056274) [990 bp, 329 aa] {ON} Anc_2.182
          Length = 329

 Score = 66.2 bits (160), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/154 (29%), Positives = 76/154 (49%), Gaps = 7/154 (4%)

Query: 20  KTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQERFQSLGVAFYR 79
           K++L  + ++  +  +Y  TI  D   K+V++ DDKV  + V DTAGQE + ++   + R
Sbjct: 23  KSALTIQLIHSHFVDEYDPTI-EDSYRKQVVI-DDKVTVLDVLDTAGQEEYSAMREQYMR 80

Query: 80  GADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXXXXXXXXXXXXXX 139
             +  VLVY +T+  SF+ + ++  +      V   +  P VI+ N              
Sbjct: 81  TGEGFVLVYSITSKNSFEELMTYYQQI---QRVKDSDYIPVVIVGNKSDLEDERQVSYQA 137

Query: 140 XAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIAR 173
                AK + N P   TSAK +INV++AF  + R
Sbjct: 138 GVN-LAKQM-NAPFLETSAKQAINVEEAFYTLVR 169

>YOR101W Chr15 (515244..516173) [930 bp, 309 aa] {ON}  RAS1GTPase
           involved in G-protein signaling in the adenylate cyclase
           activating pathway, plays a role in cell proliferation;
           localized to the plasma membrane; homolog of mammalian
           RAS proto-oncogenes
          Length = 309

 Score = 66.2 bits (160), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/154 (30%), Positives = 77/154 (50%), Gaps = 7/154 (4%)

Query: 20  KTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQERFQSLGVAFYR 79
           K++L  +++   +  +Y  TI  D   K+V++ DDKV+ + + DTAGQE + ++   + R
Sbjct: 23  KSALTIQFIQSYFVDEYDPTI-EDSYRKQVVI-DDKVSILDILDTAGQEEYSAMREQYMR 80

Query: 80  GADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXXXXXXXXXXXXXX 139
             +  +LVY VT+  SFD + S+  +      V   +  P V++ N              
Sbjct: 81  TGEGFLLVYSVTSRNSFDELLSYYQQI---QRVKDSDYIPVVVVGNKLDLENERQVSYED 137

Query: 140 XAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIAR 173
             +  AK L N P   TSAK +INV +AF  + R
Sbjct: 138 GLR-LAKQL-NAPFLETSAKQAINVDEAFYSLIR 169

>SAKL0C06424g Chr3 complement(591532..592395) [864 bp, 287 aa] {ON}
           similar to uniprot|Q00246 Saccharomyces cerevisiae
           YKR055W RHO4 Non-essential small GTPase of the Rho/Rac
           subfamily of Ras-like proteins likely to be involved in
           the establishment of cell polarity
          Length = 287

 Score = 65.9 bits (159), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 55/99 (55%), Gaps = 2/99 (2%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
           LK++++GD  VGKT L+  Y   ++  +Y  TI  ++++K V    +KV  + +WDTAGQ
Sbjct: 78  LKIVVVGDGAVGKTCLLISYTQGRFPTEYVPTIFENYVSK-VQGPRNKVIELALWDTAGQ 136

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKS-WRDE 105
           E +  L    Y   D  ++ Y V +  SF NV+  W  E
Sbjct: 137 EEYNRLRPLSYTDVDILMVCYSVDSKTSFYNVQELWFPE 175

>Suva_13.93 Chr13 complement(147850..148587) [738 bp, 245 aa] {ON}
           YML064C (REAL)
          Length = 245

 Score = 65.5 bits (158), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 77/164 (46%), Gaps = 7/164 (4%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
           ++V ++GD+ VGKTSLM +YV + Y ++Y  T+G +FL ++V +    +    + D  GQ
Sbjct: 21  VQVGLVGDAQVGKTSLMVKYVQNIYDKEYTQTLGVNFLKRKVSIRSTDI-IFSIMDLGGQ 79

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXX 127
             F ++      G+   + ++D+T  ++  ++K W  +    A   +    P ++     
Sbjct: 80  REFINMLPIATVGSSVIIFLFDLTRPETLSSIKEWYRQ----AYGLNDSAIPILVGTKYD 135

Query: 128 XXXXXXXXXXXXXAQEQAK--SLGNVPLFFTSAKDSINVQDAFE 169
                        ++   K   + N PL F S   SIN+Q  F+
Sbjct: 136 LLIDLDPEYQEQISRTSMKYAQVMNAPLVFCSTAKSINIQKIFK 179

>Smik_9.51 Chr9 (117526..118221) [696 bp, 231 aa] {ON} YIL118W
           (REAL)
          Length = 231

 Score = 65.1 bits (157), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 55/103 (53%), Gaps = 3/103 (2%)

Query: 9   KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQE 68
           K++ILGD   GKTSL++ +    + + Y+ T+  +++    I  D K  T+ +WDTAGQE
Sbjct: 18  KIVILGDGACGKTSLLNVFTRGYFPEVYEPTVFENYIHD--IFVDSKHITLSLWDTAGQE 75

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKS-WRDEFLVHA 110
            F  L    Y    C +L + + +  S +NV++ W  E   H 
Sbjct: 76  EFDRLRSLSYSDTQCIMLCFSIDSRDSLENVQNKWVGEITDHC 118

>Ecym_3286 Chr3 (542469..543143) [675 bp, 224 aa] {ON} similar to
           Ashbya gossypii ADL252W
          Length = 224

 Score = 65.1 bits (157), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 55/205 (26%), Positives = 88/205 (42%), Gaps = 25/205 (12%)

Query: 9   KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQE 68
           K++ILGD   GKTSL++ +    + + Y+ T+  +++    I  D++  T+ +WDTAGQE
Sbjct: 17  KIVILGDGACGKTSLLNVFTRGYFPKVYEPTVFENYIHD--IFVDNQHITLSLWDTAGQE 74

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKS-WRDEFLVH------------ANVSSP 115
            F  L    Y      +L + V +  S +NVK+ W  E   H             ++ S 
Sbjct: 75  EFDRLRSLSYSDTHTIMLCFSVDSRDSLENVKNKWVGEIADHCEGVKLVLVALKCDLRSS 134

Query: 116 ETF-------PFVILANXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAF 168
           + +       P  I +                    AK +G +     SAK +  V +AF
Sbjct: 135 DEYGNENAITPGSIQSQKFSGGNGNGLIPYEEGLAMAKQIGALRYLECSAKMNRGVNEAF 194

Query: 169 EEIARSALQQSQSDADAYEDDLSEA 193
            E AR AL+ +   A    D + EA
Sbjct: 195 TEAARCALKATPKGA---RDSVHEA 216

>YIL118W Chr9 (139752..140447) [696 bp, 231 aa] {ON}
           RHO3Non-essential small GTPase of the Rho/Rac subfamily
           of Ras-like proteins involved in the establishment of
           cell polarity; GTPase activity positively regulated by
           the GTPase activating protein (GAP) Rgd1p
          Length = 231

 Score = 65.1 bits (157), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 55/103 (53%), Gaps = 3/103 (2%)

Query: 9   KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQE 68
           K++ILGD   GKTSL++ +    + + Y+ T+  +++    I  D K  T+ +WDTAGQE
Sbjct: 18  KIVILGDGACGKTSLLNVFTRGYFPEVYEPTVFENYIHD--IFVDSKHITLSLWDTAGQE 75

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKS-WRDEFLVHA 110
            F  L    Y    C +L + + +  S +NV++ W  E   H 
Sbjct: 76  EFDRLRSLSYSDTQCIMLCFSIDSRDSLENVQNKWVGEITDHC 118

>Suva_9.76 Chr9 (134573..135271) [699 bp, 232 aa] {ON} YIL118W
           (REAL)
          Length = 232

 Score = 65.1 bits (157), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 55/103 (53%), Gaps = 3/103 (2%)

Query: 9   KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQE 68
           K++ILGD   GKTSL++ +    + + Y+ T+  +++    I  D K  T+ +WDTAGQE
Sbjct: 18  KIVILGDGACGKTSLLNVFTRGYFPEVYEPTVFENYIHD--IFVDSKHITLSLWDTAGQE 75

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKS-WRDEFLVHA 110
            F  L    Y    C +L + + +  S +NV++ W  E   H 
Sbjct: 76  EFDRLRSLSYSDTQCIMLCFSIDSRDSLENVQNKWVGEITDHC 118

>NDAI0D03820 Chr4 complement(908209..909015) [807 bp, 268 aa] {ON}
           Anc_4.73
          Length = 268

 Score = 65.5 bits (158), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 80/169 (47%), Gaps = 6/169 (3%)

Query: 9   KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQE 68
           K+++LG  GVGK+ L  ++V   Y   Y  TI   +  ++ I  D+KV  +++ DTAG  
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSY--RKTIEIDNKVFDLEILDTAGVA 62

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXXX 128
           +F ++   + +     +LVY VT+ +S D +   R++ L    +      P V++ N   
Sbjct: 63  QFTAMRELYIKSGMGFLLVYSVTDRQSLDELMELREQVL---RIKDSSKVPMVLVGNKAD 119

Query: 129 XXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQ 177
                         E + + G VP + TSA    NV + F ++ R  ++
Sbjct: 120 LNDERVISVEEGI-EVSSTWGKVPFYETSALLRSNVDEVFVDLVRQIMR 167

>Skud_9.53 Chr9 (116575..117270) [696 bp, 231 aa] {ON} YIL118W
           (REAL)
          Length = 231

 Score = 64.7 bits (156), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 55/103 (53%), Gaps = 3/103 (2%)

Query: 9   KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQE 68
           K++ILGD   GKTSL++ +    + + Y+ T+  +++    I  D K  T+ +WDTAGQE
Sbjct: 18  KIVILGDGACGKTSLLNVFTRGYFPEVYEPTVFENYIHD--IFVDSKHITLSLWDTAGQE 75

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKS-WRDEFLVHA 110
            F  L    Y    C +L + + +  S +NV++ W  E   H 
Sbjct: 76  EFDRLRSLSYSDTQCIMLCFSIDSRDSLENVQNKWVGEITDHC 118

>TDEL0B05600 Chr2 complement(991741..992346) [606 bp, 201 aa] {ON}
           Anc_1.443 YCR027C
          Length = 201

 Score = 64.3 bits (155), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 83/182 (45%), Gaps = 12/182 (6%)

Query: 9   KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQE 68
           KV +LG   VGKTSL  R+V   + + Y  TI  +F   ++I       T+++ DTAGQ+
Sbjct: 12  KVAVLGARNVGKTSLTVRFVESHFVESYYPTIENEF--TKIIRFRKHNYTLEILDTAGQD 69

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXXX 128
            F  L +    G    VL Y VTN  SF+ +    D+ +   +    +  P V++AN   
Sbjct: 70  EFSLLNMQSLIGVKGIVLCYSVTNRNSFEMISVIWDKLV---DQLGKDNLPVVVVANKID 126

Query: 129 XXXXXXXXXXXXAQEQ-AKSL----GNVPLFFT--SAKDSINVQDAFEEIARSALQQSQS 181
                         E+ AK++    G +   F   SAKD+INV  A   + +   QQ   
Sbjct: 127 MRTGQSHCVTKEEGERLAKTIVSSDGKLHAGFIEGSAKDNINVDAAIMMLLKKMEQQELG 186

Query: 182 DA 183
           +A
Sbjct: 187 NA 188

>KLLA0A05643g Chr1 (528976..529632) [657 bp, 218 aa] {ON} similar to
           uniprot|Q00246 Saccharomyces cerevisiae YKR055W RHO4
           Non-essential small GTPase of the Rho/Rac subfamily of
           Ras-like proteins likely to be involved in the
           establishment of cell polarity
          Length = 218

 Score = 64.7 bits (156), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 81/172 (47%), Gaps = 8/172 (4%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
           LK++++GD  VGKTSL+  Y   K+ + Y  TI  +++T     N  K+  + +WDTAGQ
Sbjct: 32  LKIVVVGDGAVGKTSLLISYTQGKFPEDYVPTIFENYVTNLEGPN-GKIVELALWDTAGQ 90

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVIL---A 124
           E +  L    Y   D  ++ Y + +  SF N++   + +L       P+  P +I+   +
Sbjct: 91  EEYSRLRPLSYTDVDVLMICYAINSKVSFYNIE---EMWLPEVKHFCPDV-PIMIVGLKS 146

Query: 125 NXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSAL 176
           +               A+E AK +G       S+K    V++ F+    +AL
Sbjct: 147 DLYAEDNISDFVDAFKAEETAKRIGAFVHLQCSSKSQQKVREVFDTAITAAL 198

>NCAS0A01890 Chr1 complement(364746..365561) [816 bp, 271 aa] {ON}
           Anc_4.73
          Length = 271

 Score = 65.1 bits (157), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 81/169 (47%), Gaps = 6/169 (3%)

Query: 9   KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQE 68
           K+++LG  GVGK+ L  ++V   Y   Y  TI   +  ++ I  D+KV  +++ DTAG  
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGIYLDTYDPTIEDSY--RKTIEIDNKVFDLEILDTAGVA 62

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXXX 128
           +F ++   + +     +LVY VT+ +S D +   R++ L    +   +  P V++ N   
Sbjct: 63  QFTAMRELYIKSGMGFLLVYSVTDPQSLDELMELREQVL---RIKDTDRVPMVLVGNKAD 119

Query: 129 XXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQ 177
                        +  +K  G VP + TSA    NV + F ++ R  ++
Sbjct: 120 LTEDRVISVEEGIEVSSK-WGKVPFYETSALLRSNVDEVFVDLVRQIIR 167

>Smik_13.80 Chr13 complement(142681..143418) [738 bp, 245 aa] {ON}
           YML064C (REAL)
          Length = 245

 Score = 64.7 bits (156), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 76/164 (46%), Gaps = 7/164 (4%)

Query: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQ 67
           ++V ++GD+ VGKTSLM +YV + Y ++Y  T+G +FL ++V +    +    + D  GQ
Sbjct: 21  VQVGLVGDAQVGKTSLMVKYVQNIYDKEYTQTLGVNFLKRKVSIRSTDI-IFSIMDLGGQ 79

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXX 127
             F ++      G+   + ++D+T   +  ++K W  +    A   +    P ++     
Sbjct: 80  REFINMLPIATVGSSVIIFLFDLTRPDTLSSIKEWYRQ----AYGLNDSAIPILVGTKYD 135

Query: 128 XXXXXXXXXXXXXAQEQAK--SLGNVPLFFTSAKDSINVQDAFE 169
                        ++   K   + N PL F S   SIN+Q  F+
Sbjct: 136 LLIDLDPEYQEQISRTSMKYAQVMNAPLIFCSTAKSINIQKIFK 179

>TDEL0F02770 Chr6 complement(507090..507806) [717 bp, 238 aa] {ON}
           Anc_4.73 YGR152C
          Length = 238

 Score = 64.7 bits (156), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 82/179 (45%), Gaps = 6/179 (3%)

Query: 9   KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQE 68
           K+++LG  GVGK+ L  ++V   Y   Y  TI   +  ++ +  D+KVA +++ DTAG  
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGVYLDSYDPTIEDSY--RKTVEIDNKVADLEILDTAGVA 62

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXXX 128
           +F ++   + +     +LVY VT+ +S + +   R++ L    +      P V++ N   
Sbjct: 63  QFTAMRELYIKSGMGFLLVYSVTDRQSLEELLDLREQVL---RIKDMNRVPMVLVGNKAD 119

Query: 129 XXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQSDADAYE 187
                         E +   G VP + TSA    NV + F ++ R  ++       A E
Sbjct: 120 LKDERVISVEEGI-EVSSDWGKVPFYETSALLRSNVDEVFIDLVRQIIRNELESVTAPE 177

>Skud_14.232 Chr14 complement(429739..430710) [972 bp, 323 aa] {ON}
           YNL098C (REAL)
          Length = 323

 Score = 65.5 bits (158), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 44/154 (28%), Positives = 76/154 (49%), Gaps = 7/154 (4%)

Query: 20  KTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQERFQSLGVAFYR 79
           K++L  +     +  +Y  TI  D   K+V++ DD+V+ + + DTAGQE + ++   + R
Sbjct: 23  KSALTIQLTQSHFVDEYDPTI-EDSYRKQVVI-DDEVSILDILDTAGQEEYSAMREQYMR 80

Query: 80  GADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXXXXXXXXXXXXXX 139
             +  +LVY +T+  S D + ++  + L    V   +  P V++ N              
Sbjct: 81  NGEGFLLVYSITSKSSLDELMTYYQQIL---RVKDTDYVPIVVVGN-KSDLENEKQVSYQ 136

Query: 140 XAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIAR 173
                AK + N P   TSAK +INV++AF  +AR
Sbjct: 137 DGLNMAKQM-NAPFLETSAKQAINVEEAFYTLAR 169

>ZYRO0C15466g Chr3 complement(1208350..1208919) [570 bp, 189 aa]
           {ON} highly similar to uniprot|P06781 Saccharomyces
           cerevisiae YNL090W RHO2 Non-essential small GTPase of
           the Rho/Rac subfamily of Ras-like proteins involved in
           the establishment of cell polarity and in microtubule
           assembly
          Length = 189

 Score = 63.5 bits (153), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 87/182 (47%), Gaps = 13/182 (7%)

Query: 1   MSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQ 60
           MS +    K++I+GD   GKTSL++ +   ++ Q+Y  T+  +++T +  V+  KV T+ 
Sbjct: 1   MSEQAVRRKLVIIGDGACGKTSLLYVFALGQFPQEYHPTVFENYVT-DCRVDGIKV-TLT 58

Query: 61  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKS-WRDEFLVHANVSSPETFP 119
           +WDTAGQE ++ L    Y  AD  ++ + V + +S  N K+ W +E L       P+  P
Sbjct: 59  LWDTAGQEEYERLRPFSYANADILLMGFAVDDPESLLNSKTKWAEEALRFC----PDA-P 113

Query: 120 FVILA-----NXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARS 174
            +++                      AQ+ A+ +G       SA     V D FE   R+
Sbjct: 114 IILVGLKKDLRQIKGSLQNELVSIDEAQQVARHIGAKKYLECSALTGDGVDDVFEIATRT 173

Query: 175 AL 176
           +L
Sbjct: 174 SL 175

>KAFR0J01600 Chr10 complement(290538..291206) [669 bp, 222 aa] {ON}
           Anc_2.249 YIL118W
          Length = 222

 Score = 64.3 bits (155), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 53/204 (25%), Positives = 86/204 (42%), Gaps = 30/204 (14%)

Query: 9   KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQE 68
           K++ILGD   GKTSL++ +    + + Y+ T+  +++    I  D++  T+ +WDTAGQE
Sbjct: 18  KIVILGDGACGKTSLLNVFTRGYFPEVYEPTVFENYIHD--IFVDNRHITLSLWDTAGQE 75

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKS-WRDEFLVHANVSSPETFPFVILA--- 124
            F  L    Y      +L + + +  S +NV++ W  E   H      E    V++A   
Sbjct: 76  EFDRLRSLSYSDTHTIMLCFSIDSRDSLENVRNKWVGEITDHC-----EGVKLVLVALKC 130

Query: 125 ---------------NXXXXXXXXXXXXXXXAQEQ----AKSLGNVPLFFTSAKDSINVQ 165
                          N                 E+    AK +G +     SAK +  V 
Sbjct: 131 DLRNNDSENKAITPNNIHQNKNLNSSNNSLITYEEGLAMAKKIGALRYLECSAKSNKGVN 190

Query: 166 DAFEEIARSALQQSQSDADAYEDD 189
           +AF E AR AL      + + E+D
Sbjct: 191 EAFTEAARVALTAGPQVSASTEND 214

>YNL098C Chr14 complement(439602..440570) [969 bp, 322 aa] {ON}
           RAS2GTP-binding protein that regulates the nitrogen
           starvation response, sporulation, and filamentous
           growth; farnesylation and palmitoylation required for
           activity and localization to plasma membrane; homolog of
           mammalian Ras proto-oncogenes
          Length = 322

 Score = 65.1 bits (157), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 44/154 (28%), Positives = 76/154 (49%), Gaps = 7/154 (4%)

Query: 20  KTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQERFQSLGVAFYR 79
           K++L  +     +  +Y  TI  D   K+V++ DD+V+ + + DTAGQE + ++   + R
Sbjct: 23  KSALTIQLTQSHFVDEYDPTI-EDSYRKQVVI-DDEVSILDILDTAGQEEYSAMREQYMR 80

Query: 80  GADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXXXXXXXXXXXXXX 139
             +  +LVY +T+  S D + ++  + L    V   +  P V++ N              
Sbjct: 81  NGEGFLLVYSITSKSSLDELMTYYQQIL---RVKDTDYVPIVVVGN-KSDLENEKQVSYQ 136

Query: 140 XAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIAR 173
                AK + N P   TSAK +INV++AF  +AR
Sbjct: 137 DGLNMAKQM-NAPFLETSAKQAINVEEAFYTLAR 169

>ZYRO0E03608g Chr5 complement(279670..280272) [603 bp, 200 aa] {ON}
           similar to uniprot|P25378 Saccharomyces cerevisiae
           YCR027C RHB1 Putative Rheb-related GTPase involved in
           regulating canavanine resistance and arginine uptake
           member of the Ras superfamily of G-proteins
          Length = 200

 Score = 63.9 bits (154), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 54/189 (28%), Positives = 84/189 (44%), Gaps = 14/189 (7%)

Query: 9   KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVWDTAGQE 68
           K+ +LG   VGKT+L  R+V + + + Y  TI  DF TK V    +   T+++ DTAGQ+
Sbjct: 11  KIAVLGARNVGKTTLTVRFVEEHFVESYYPTIENDF-TKIVQFKGNNY-TLEILDTAGQD 68

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILANXXX 128
            F  L      G    VL Y V+N  SF+ +    D+ +   +    +  P V++AN   
Sbjct: 69  EFSLLNAKSLIGVKGIVLCYSVSNRPSFELIPVVWDKLV---DQLGRDDLPCVVVANKID 125

Query: 129 XXXXXXXXXXXXAQEQ---AKSLGNV------PLFFTSAKDSINVQDAFEEIARSALQQS 179
                       +QE    AK++G+            SAK  +NV+ A+  +     QQ 
Sbjct: 126 VRDSASSTEFISSQEGRELAKTIGSTDGKHKAGFVECSAKQDVNVEGAYRAVLEKMRQQE 185

Query: 180 QSDADAYED 188
               D+  D
Sbjct: 186 LGTGDSNGD 194

>TDEL0C04630 Chr3 complement(837302..837877) [576 bp, 191 aa] {ON}
           Anc_2.200 YNL090W
          Length = 191

 Score = 63.5 bits (153), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 88/184 (47%), Gaps = 15/184 (8%)

Query: 1   MSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQ 60
           MS      K++I+GD   GKTSL++ +   K+ ++Y  T+  +++T +  V+  KV ++ 
Sbjct: 1   MSENAVRRKLVIIGDGACGKTSLLYVFTLGKFPEEYHPTVFENYVT-DCRVDGIKV-SLT 58

Query: 61  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKS-WRDEFLVHANVSSPETFP 119
           +WDTAGQE ++ L    Y  AD  ++ + V + +S  N ++ W +E L +     P+  P
Sbjct: 59  LWDTAGQEEYERLRPFSYSKADIILIGFAVDDPESLINARTKWAEEALRYC----PDA-P 113

Query: 120 FVILA-------NXXXXXXXXXXXXXXXAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIA 172
            +++        +               AQ+ AK +G       SA     V D FE   
Sbjct: 114 IILVGLKKDLRRSHEENAQGEKFVSLADAQQIAKQIGAKKYLECSALSGEGVDDVFELAT 173

Query: 173 RSAL 176
           R++L
Sbjct: 174 RTSL 177

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.131    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 19,773,269
Number of extensions: 740374
Number of successful extensions: 4568
Number of sequences better than 10.0: 602
Number of HSP's gapped: 4019
Number of HSP's successfully gapped: 623
Length of query: 207
Length of database: 53,481,399
Length adjustment: 104
Effective length of query: 103
Effective length of database: 41,556,135
Effective search space: 4280281905
Effective search space used: 4280281905
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 63 (28.9 bits)