Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D01243g6.23ON31131116550.0
SAKL0E01342g6.23ON34130411141e-153
ZYRO0C07722g6.23ON37329710981e-150
TDEL0G044606.23ON36929810541e-143
KAFR0A050806.23ON31130010341e-141
NCAS0D021706.23ON31029910231e-139
CAGL0I08151gsingletonON38230210201e-138
TPHA0M002806.23ON30329810111e-138
CAGL0F01815gsingletonON31430510121e-138
NCAS0H008406.23ON36029910121e-137
Kwal_56.224396.23ON32030310061e-137
Kpol_385.5singletonON3062929971e-136
Kpol_1061.27singletonON3062959921e-135
KNAG0M011906.23ON3803019971e-134
KNAG0D02240singletonON3593009821e-133
KNAG0K01400singletonON3092979721e-132
NDAI0C026206.23ON3113059611e-130
KLTH0C11154g6.23ON3053009591e-130
NDAI0D008306.23ON3743019581e-129
KAFR0G026806.23ON3832969341e-125
YNL169C (PSD1)2.83ON500129702.8
KLTH0D00198gsingletonON46973702.8
Suva_10.975.204ON33782675.4
CAGL0H05093g4.240ON133225685.6
Skud_12.855.204ON33782667.9
Smik_12.805.204ON33782659.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D01243g
         (311 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D01243g Chr4 complement(108848..109783) [936 bp, 311 aa] {O...   642   0.0  
SAKL0E01342g Chr5 (101847..102872) [1026 bp, 341 aa] {ON} conser...   433   e-153
ZYRO0C07722g Chr3 (585947..587068) [1122 bp, 373 aa] {ON} conser...   427   e-150
TDEL0G04460 Chr7 (809440..810549) [1110 bp, 369 aa] {ON}              410   e-143
KAFR0A05080 Chr1 complement(1009747..1010682) [936 bp, 311 aa] {...   402   e-141
NCAS0D02170 Chr4 complement(403949..404881) [933 bp, 310 aa] {ON...   398   e-139
CAGL0I08151g Chr9 (793917..795065) [1149 bp, 382 aa] {ON} highly...   397   e-138
TPHA0M00280 Chr13 complement(55778..56689) [912 bp, 303 aa] {ON}...   394   e-138
CAGL0F01815g Chr6 complement(179470..180414) [945 bp, 314 aa] {O...   394   e-138
NCAS0H00840 Chr8 complement(153671..154753) [1083 bp, 360 aa] {O...   394   e-137
Kwal_56.22439 s56 complement(129210..130172) [963 bp, 320 aa] {O...   392   e-137
Kpol_385.5 s385 (12788..13708) [921 bp, 306 aa] {ON} (12788..137...   388   e-136
Kpol_1061.27 s1061 (79476..80396) [921 bp, 306 aa] {ON} (79476.....   386   e-135
KNAG0M01190 Chr13 complement(216456..217598) [1143 bp, 380 aa] {...   388   e-134
KNAG0D02240 Chr4 complement(385803..386882) [1080 bp, 359 aa] {O...   382   e-133
KNAG0K01400 Chr11 complement(280379..281308) [930 bp, 309 aa] {O...   379   e-132
NDAI0C02620 Chr3 (608649..609584) [936 bp, 311 aa] {ON} Anc_6.23      374   e-130
KLTH0C11154g Chr3 (916374..917291) [918 bp, 305 aa] {ON} conserv...   374   e-130
NDAI0D00830 Chr4 complement(188085..189209) [1125 bp, 374 aa] {O...   373   e-129
KAFR0G02680 Chr7 (553335..554486) [1152 bp, 383 aa] {ON} Anc_6.23     364   e-125
YNL169C Chr14 complement(316169..317671) [1503 bp, 500 aa] {ON} ...    32   2.8  
KLTH0D00198g Chr4 complement(12199..13608) [1410 bp, 469 aa] {ON...    32   2.8  
Suva_10.97 Chr10 (183697..184710) [1014 bp, 337 aa] {ON} YLR017W...    30   5.4  
CAGL0H05093g Chr8 complement(490310..494308) [3999 bp, 1332 aa] ...    31   5.6  
Skud_12.85 Chr12 (169420..170433) [1014 bp, 337 aa] {ON} YLR017W...    30   7.9  
Smik_12.80 Chr12 (164445..165458) [1014 bp, 337 aa] {ON} YLR017W...    30   9.2  

>KLLA0D01243g Chr4 complement(108848..109783) [936 bp, 311 aa] {ON}
           conserved hypothetical protein
          Length = 311

 Score =  642 bits (1655), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/311 (100%), Positives = 311/311 (100%)

Query: 1   MGLNVVSKVRSVLKHFVAIEQSEGAGALVKRSIGTIQMRNFPPFLMLDNFDVSPPAGFPE 60
           MGLNVVSKVRSVLKHFVAIEQSEGAGALVKRSIGTIQMRNFPPFLMLDNFDVSPPAGFPE
Sbjct: 1   MGLNVVSKVRSVLKHFVAIEQSEGAGALVKRSIGTIQMRNFPPFLMLDNFDVSPPAGFPE 60

Query: 61  HPHHGQETITYVLRGMMAHEDFTGSKGVLRSGDLQFMTAGKAIVHSEIPVKMDNGESTQG 120
           HPHHGQETITYVLRGMMAHEDFTGSKGVLRSGDLQFMTAGKAIVHSEIPVKMDNGESTQG
Sbjct: 61  HPHHGQETITYVLRGMMAHEDFTGSKGVLRSGDLQFMTAGKAIVHSEIPVKMDNGESTQG 120

Query: 121 LQLWVDLPNDIKNVEPRYRDLRREEIPLATPSDNLIVKVISGESYGVKSLTELAYTPVEF 180
           LQLWVDLPNDIKNVEPRYRDLRREEIPLATPSDNLIVKVISGESYGVKSLTELAYTPVEF
Sbjct: 121 LQLWVDLPNDIKNVEPRYRDLRREEIPLATPSDNLIVKVISGESYGVKSLTELAYTPVEF 180

Query: 181 YHFIANKKNTEFAQPFSDDFSSFIYIMKGSISISDQEYPESSAIFFKNDGDGIRGFTTSD 240
           YHFIANKKNTEFAQPFSDDFSSFIYIMKGSISISDQEYPESSAIFFKNDGDGIRGFTTSD
Sbjct: 181 YHFIANKKNTEFAQPFSDDFSSFIYIMKGSISISDQEYPESSAIFFKNDGDGIRGFTTSD 240

Query: 241 NAEFAIIAGKYFNQKVVQYGPFVESSRENIVDVIQNYQNGVNGFENARTWSPVIKNGVTE 300
           NAEFAIIAGKYFNQKVVQYGPFVESSRENIVDVIQNYQNGVNGFENARTWSPVIKNGVTE
Sbjct: 241 NAEFAIIAGKYFNQKVVQYGPFVESSRENIVDVIQNYQNGVNGFENARTWSPVIKNGVTE 300

Query: 301 AEVQQYLPKGN 311
           AEVQQYLPKGN
Sbjct: 301 AEVQQYLPKGN 311

>SAKL0E01342g Chr5 (101847..102872) [1026 bp, 341 aa] {ON} conserved
           hypothetical protein
          Length = 341

 Score =  433 bits (1114), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 197/304 (64%), Positives = 246/304 (80%)

Query: 4   NVVSKVRSVLKHFVAIEQSEGAGALVKRSIGTIQMRNFPPFLMLDNFDVSPPAGFPEHPH 63
           N +SKVR++ KHFVA+EQSEG GA V+RSIGT Q+RNF PFLMLD+F+V+PPAGFP+HPH
Sbjct: 35  NRMSKVRTIYKHFVAVEQSEGVGARVRRSIGTTQLRNFTPFLMLDHFNVTPPAGFPDHPH 94

Query: 64  HGQETITYVLRGMMAHEDFTGSKGVLRSGDLQFMTAGKAIVHSEIPVKMDNGESTQGLQL 123
           HGQETITYVL GMMAHEDFTGSKGVLR GDLQFMTAGK IVHSEIPVKM++GE T GLQL
Sbjct: 95  HGQETITYVLGGMMAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEIPVKMESGEPTVGLQL 154

Query: 124 WVDLPNDIKNVEPRYRDLRREEIPLATPSDNLIVKVISGESYGVKSLTELAYTPVEFYHF 183
           WVDLP  +KN EPRYRDLR  E P+A P  NL V+VISGESYGV+S +ELAYTPV FYHF
Sbjct: 155 WVDLPERLKNCEPRYRDLRGAETPIAEPHQNLKVRVISGESYGVQSRSELAYTPVHFYHF 214

Query: 184 IANKKNTEFAQPFSDDFSSFIYIMKGSISISDQEYPESSAIFFKNDGDGIRGFTTSDNAE 243
           I++KK T F Q F +DF+ F+Y++KGS++++ + +P+ SAIFFKNDG+G+ G   SD+ E
Sbjct: 215 ISSKKGTPFEQKFPEDFNVFMYVLKGSLTLNSKNFPQYSAIFFKNDGEGVEGIAASDDTE 274

Query: 244 FAIIAGKYFNQKVVQYGPFVESSRENIVDVIQNYQNGVNGFENARTWSPVIKNGVTEAEV 303
           FA++ G    Q VVQ+GPFVE+S+E ++ V Q+YQ G+NGFE A  W   I +G+++   
Sbjct: 275 FALVGGSILEQPVVQHGPFVETSKERMIQVFQDYQFGMNGFERAHNWKSSISDGISQQNA 334

Query: 304 QQYL 307
           ++ L
Sbjct: 335 EKQL 338

>ZYRO0C07722g Chr3 (585947..587068) [1122 bp, 373 aa] {ON} conserved
           hypothetical protein
          Length = 373

 Score =  427 bits (1098), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 194/297 (65%), Positives = 245/297 (82%)

Query: 9   VRSVLKHFVAIEQSEGAGALVKRSIGTIQMRNFPPFLMLDNFDVSPPAGFPEHPHHGQET 68
           VRSVLK+F+AIEQ EG GA V+RSIGT++MR FPPFLMLD+F V PPAGFP+HPHHGQET
Sbjct: 73  VRSVLKNFIAIEQEEGVGARVRRSIGTMKMRRFPPFLMLDDFFVKPPAGFPDHPHHGQET 132

Query: 69  ITYVLRGMMAHEDFTGSKGVLRSGDLQFMTAGKAIVHSEIPVKMDNGESTQGLQLWVDLP 128
           ITY L+GM+AHEDFTGSKGVL  GDLQFMTAGK IVHSEIPV +++G ++ GLQLWVDLP
Sbjct: 133 ITYNLKGMIAHEDFTGSKGVLFPGDLQFMTAGKGIVHSEIPVSLEDGSASNGLQLWVDLP 192

Query: 129 NDIKNVEPRYRDLRREEIPLATPSDNLIVKVISGESYGVKSLTELAYTPVEFYHFIANKK 188
            ++KN EPRYRDLR+++ P    +DNL V+VISG+SYGV S+ ELAYTPV FYHFI +KK
Sbjct: 193 AELKNCEPRYRDLRKKQTPEVKVNDNLTVRVISGKSYGVDSVQELAYTPVHFYHFITSKK 252

Query: 189 NTEFAQPFSDDFSSFIYIMKGSISISDQEYPESSAIFFKNDGDGIRGFTTSDNAEFAIIA 248
            TEFAQ F  DF+ F YI+KGS++++DQ +PE SA+FF  DG+G+ G + SD+AEF +I 
Sbjct: 253 GTEFAQEFPKDFNVFFYILKGSLAVNDQVFPEHSAVFFDTDGEGVAGTSVSDDAEFVLIG 312

Query: 249 GKYFNQKVVQYGPFVESSRENIVDVIQNYQNGVNGFENARTWSPVIKNGVTEAEVQQ 305
           GK  +Q+V+Q+GPFVE+SRE ++DV +NYQ G+NGFENA +W   I  G++EAE ++
Sbjct: 313 GKILDQEVLQHGPFVETSRERMIDVFRNYQYGMNGFENAHSWDSKIAGGISEAEARK 369

>TDEL0G04460 Chr7 (809440..810549) [1110 bp, 369 aa] {ON} 
          Length = 369

 Score =  410 bits (1054), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 183/298 (61%), Positives = 236/298 (79%)

Query: 8   KVRSVLKHFVAIEQSEGAGALVKRSIGTIQMRNFPPFLMLDNFDVSPPAGFPEHPHHGQE 67
           +VRS++K+FVA +Q EG GA V+RSIGT+QMR F PFLMLD+F VSPPAGFP+HPHHGQE
Sbjct: 63  QVRSIIKNFVATQQEEGVGATVRRSIGTMQMRRFSPFLMLDHFTVSPPAGFPDHPHHGQE 122

Query: 68  TITYVLRGMMAHEDFTGSKGVLRSGDLQFMTAGKAIVHSEIPVKMDNGESTQGLQLWVDL 127
           TITY+L GM+AHEDF+ SKG+L  GDLQFMTAGKAI+HSEIPVKMD+G+   GLQLWVDL
Sbjct: 123 TITYMLGGMLAHEDFSNSKGILSPGDLQFMTAGKAIIHSEIPVKMDSGQPAVGLQLWVDL 182

Query: 128 PNDIKNVEPRYRDLRREEIPLATPSDNLIVKVISGESYGVKSLTELAYTPVEFYHFIANK 187
           P  +KN EPRYRDL+ ++IP+  PS++L V VISG SYGV+S  +LAYTPV +YHF  +K
Sbjct: 183 PEKLKNCEPRYRDLKAKDIPVIKPSEHLKVTVISGTSYGVQSARDLAYTPVHYYHFATSK 242

Query: 188 KNTEFAQPFSDDFSSFIYIMKGSISISDQEYPESSAIFFKNDGDGIRGFTTSDNAEFAII 247
           K TEF Q F   F++F+YI+KGSI I ++ +P+ S +FF  DGD + GF+ SDNAEF +I
Sbjct: 243 KGTEFVQEFPRVFNAFMYILKGSIGIGEKLFPQFSTVFFDTDGDAVEGFSASDNAEFVLI 302

Query: 248 AGKYFNQKVVQYGPFVESSRENIVDVIQNYQNGVNGFENARTWSPVIKNGVTEAEVQQ 305
            G+  +Q VVQ+GPFVE++RE +++V  NYQN +NGF+  R W   I  G+TE+E ++
Sbjct: 303 GGEILHQDVVQHGPFVETNRERLIEVFHNYQNSINGFDRGRNWRSTIAGGITESEAKK 360

>KAFR0A05080 Chr1 complement(1009747..1010682) [936 bp, 311 aa] {ON}
           Anc_6.23
          Length = 311

 Score =  402 bits (1034), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 181/300 (60%), Positives = 240/300 (80%)

Query: 7   SKVRSVLKHFVAIEQSEGAGALVKRSIGTIQMRNFPPFLMLDNFDVSPPAGFPEHPHHGQ 66
           +  R++ KHFVA+EQ EG GA V+RS+G+++ RNF PFL+LD+F VS PAGFP+HPHHGQ
Sbjct: 8   TTFRTINKHFVAVEQEEGVGARVRRSVGSMRQRNFTPFLLLDHFTVSHPAGFPDHPHHGQ 67

Query: 67  ETITYVLRGMMAHEDFTGSKGVLRSGDLQFMTAGKAIVHSEIPVKMDNGESTQGLQLWVD 126
           ETITYV  GM+AHEDFTGSKG+LR GDLQFMTAGK I+HSEIPV M+NG++  GLQLWVD
Sbjct: 68  ETITYVRNGMIAHEDFTGSKGILRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVD 127

Query: 127 LPNDIKNVEPRYRDLRREEIPLATPSDNLIVKVISGESYGVKSLTELAYTPVEFYHFIAN 186
           LP ++K+ EPRYR+LR  EIP+  P+++L VKVISG SYGV+S+ ELAYTPV+FYHFI+N
Sbjct: 128 LPQEMKDCEPRYRNLRGGEIPIVEPNEHLKVKVISGRSYGVESVKELAYTPVDFYHFISN 187

Query: 187 KKNTEFAQPFSDDFSSFIYIMKGSISISDQEYPESSAIFFKNDGDGIRGFTTSDNAEFAI 246
           KK T+F Q   ++F+ F+Y+MKGS+ I D+ +P+ S IFF  DG+GI+G  + D+ EFAI
Sbjct: 188 KKGTDFVQQTPENFNFFLYVMKGSVKIGDETFPQYSTIFFNADGNGIKGVVSDDDTEFAI 247

Query: 247 IAGKYFNQKVVQYGPFVESSRENIVDVIQNYQNGVNGFENARTWSPVIKNGVTEAEVQQY 306
           I G   +Q V+Q+GPF+ES+RE +++V QN+Q G+NGFE A  W   I+NG+ E +V ++
Sbjct: 248 IGGLILDQPVIQHGPFIESTREKLIEVFQNFQYGINGFERAVGWKSSIRNGILEKDVPKF 307

>NCAS0D02170 Chr4 complement(403949..404881) [933 bp, 310 aa] {ON}
           Anc_6.23
          Length = 310

 Score =  398 bits (1023), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 178/299 (59%), Positives = 238/299 (79%)

Query: 8   KVRSVLKHFVAIEQSEGAGALVKRSIGTIQMRNFPPFLMLDNFDVSPPAGFPEHPHHGQE 67
           + RSVLK FVAIEQ EG GA V+RSIG+++ RNF PFL++DNF VS PAGFP+HPHHGQE
Sbjct: 6   QFRSVLKSFVAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDNFTVSHPAGFPDHPHHGQE 65

Query: 68  TITYVLRGMMAHEDFTGSKGVLRSGDLQFMTAGKAIVHSEIPVKMDNGESTQGLQLWVDL 127
           TITYVL+GM+AHEDFTGS+GVLR GDLQFMTAGKAI+HSEIPV+M+NG++  G+QLWVDL
Sbjct: 66  TITYVLKGMIAHEDFTGSRGVLRPGDLQFMTAGKAIMHSEIPVQMNNGDAGIGIQLWVDL 125

Query: 128 PNDIKNVEPRYRDLRREEIPLATPSDNLIVKVISGESYGVKSLTELAYTPVEFYHFIANK 187
           P  +KN EPRYR+LR  EIP+  P+D+L V+V+SG+SYGV+S+ +LAYTP+++Y     K
Sbjct: 126 PKKLKNCEPRYRNLRATEIPIVKPNDDLTVRVVSGKSYGVESVKDLAYTPIDYYFMNTKK 185

Query: 188 KNTEFAQPFSDDFSSFIYIMKGSISISDQEYPESSAIFFKNDGDGIRGFTTSDNAEFAII 247
             TEF Q F  DF+ F+YI+KGS+ I+D  +P+ S IFFK DGD I+G + S++ EF ++
Sbjct: 186 TGTEFVQEFPADFNVFLYIIKGSVKINDTVHPQYSTIFFKTDGDAIKGCSASEDTEFVLV 245

Query: 248 AGKYFNQKVVQYGPFVESSRENIVDVIQNYQNGVNGFENARTWSPVIKNGVTEAEVQQY 306
            G+  +Q ++Q+GPFVES RE++++V +NYQ  +NGFE AR W   I +G+ E +V+ +
Sbjct: 246 GGQILDQPIIQHGPFVESDRESLLEVFKNYQYCINGFERARGWRSRIADGIHEDDVEAF 304

>CAGL0I08151g Chr9 (793917..795065) [1149 bp, 382 aa] {ON} highly
           similar to KLLA0D01243g Kluyveromyces lactis and
           DEHA0E07447g Debaryomyces hansenii and YALI0E33297g
           Yarrowia lipolytica and CA2891|CaIFS4 Candida albicans
          Length = 382

 Score =  397 bits (1020), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 184/302 (60%), Positives = 234/302 (77%)

Query: 2   GLNVVSKVRSVLKHFVAIEQSEGAGALVKRSIGTIQMRNFPPFLMLDNFDVSPPAGFPEH 61
           G+N     RS+L HF+A EQ EG GA V+RS+GT QMR F PFLMLD+F V+PP GFP+H
Sbjct: 75  GINDDRIYRSILTHFIAGEQEEGVGARVRRSVGTYQMRRFTPFLMLDDFTVAPPNGFPDH 134

Query: 62  PHHGQETITYVLRGMMAHEDFTGSKGVLRSGDLQFMTAGKAIVHSEIPVKMDNGESTQGL 121
           PHHGQETITYV  GM+AHED TGSKGVL  GDLQFMTAGK IVHSEIPV   +G+  +GL
Sbjct: 135 PHHGQETITYVTDGMIAHEDITGSKGVLLKGDLQFMTAGKGIVHSEIPVTTKDGKPCRGL 194

Query: 122 QLWVDLPNDIKNVEPRYRDLRREEIPLATPSDNLIVKVISGESYGVKSLTELAYTPVEFY 181
           QLWVDLP+D+KN++PRYR+LR  E P+A P++NL V+VISG+SYGV+SL +LAYTPV  Y
Sbjct: 195 QLWVDLPSDMKNIDPRYRNLRGNETPVAYPNENLEVRVISGKSYGVESLRDLAYTPVHLY 254

Query: 182 HFIANKKNTEFAQPFSDDFSSFIYIMKGSISISDQEYPESSAIFFKNDGDGIRGFTTSDN 241
           HF+ANK  TEF Q   +DF+ FIY+MKGSI ++D E    S+ FF  DG+ IRG   S++
Sbjct: 255 HFLANKTGTEFVQDIPEDFNVFIYVMKGSIQVNDVELTTFSSAFFDVDGNAIRGKALSED 314

Query: 242 AEFAIIAGKYFNQKVVQYGPFVESSRENIVDVIQNYQNGVNGFENARTWSPVIKNGVTEA 301
           A+FAIIAG+  +Q+V+Q+GPFVE++RE +++V +NYQ   NGFENA +W   I +G++E 
Sbjct: 315 AQFAIIAGRILDQEVIQHGPFVETNREKLMEVFRNYQEEKNGFENAHSWRSSIHDGISEE 374

Query: 302 EV 303
           E 
Sbjct: 375 EA 376

>TPHA0M00280 Chr13 complement(55778..56689) [912 bp, 303 aa] {ON}
           Anc_6.23
          Length = 303

 Score =  394 bits (1011), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 177/298 (59%), Positives = 232/298 (77%)

Query: 9   VRSVLKHFVAIEQSEGAGALVKRSIGTIQMRNFPPFLMLDNFDVSPPAGFPEHPHHGQET 68
            RS+LKHF+A EQ+EG GA V+RSIGT +MR F PFLMLD+F+V PPAGFP+HPHHGQET
Sbjct: 5   TRSILKHFIAQEQAEGVGARVRRSIGTAKMRKFSPFLMLDHFNVIPPAGFPDHPHHGQET 64

Query: 69  ITYVLRGMMAHEDFTGSKGVLRSGDLQFMTAGKAIVHSEIPVKMDNGESTQGLQLWVDLP 128
           ITYV +GM+AHEDFTGSKG+LR GDLQFMTAGKA+ HSE+PV M+NGE   GLQLWVDLP
Sbjct: 65  ITYVRKGMVAHEDFTGSKGILRPGDLQFMTAGKAVCHSEMPVLMENGEILDGLQLWVDLP 124

Query: 129 NDIKNVEPRYRDLRREEIPLATPSDNLIVKVISGESYGVKSLTELAYTPVEFYHFIANKK 188
            ++KN EPRYRDL +E IP+A P +NL ++VISG+SYG++S+ +LAYTPV+FY + A KK
Sbjct: 125 TNLKNTEPRYRDLHKENIPIAKPDENLEIEVISGKSYGIESVKDLAYTPVDFYVYKARKK 184

Query: 189 NTEFAQPFSDDFSSFIYIMKGSISISDQEYPESSAIFFKNDGDGIRGFTTSDNAEFAIIA 248
            + F Q FS D++ F+YI+KGS++I ++ +P+ S+IFF  DGD ++G   SD+ EFAII 
Sbjct: 185 GSAFTQDFSRDYNVFLYIVKGSVAIGNEVFPQHSSIFFNTDGDNVQGIVGSDDTEFAIIG 244

Query: 249 GKYFNQKVVQYGPFVESSRENIVDVIQNYQNGVNGFENARTWSPVIKNGVTEAEVQQY 306
           G+   Q+ VQ+GPFVE + E +V V  NY++   GFE A  W   I+NG+ E++   +
Sbjct: 245 GQILRQETVQHGPFVEETVEKLVKVFHNYESYTGGFERALNWRSSIRNGIDESQAANH 302

>CAGL0F01815g Chr6 complement(179470..180414) [945 bp, 314 aa] {ON}
           similar to KLLA0D01243g Kluyveromyces lactis and
           DEHA0E07447g Debaryomyces hansenii
          Length = 314

 Score =  394 bits (1012), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 174/305 (57%), Positives = 236/305 (77%)

Query: 6   VSKVRSVLKHFVAIEQSEGAGALVKRSIGTIQMRNFPPFLMLDNFDVSPPAGFPEHPHHG 65
           ++  RS+ KHF+  EQ EG GA V+RS+GT++ R F PFLMLD+F V  PAGFP+HPHHG
Sbjct: 1   MTTYRSIQKHFMTFEQEEGVGARVRRSVGTMKQRMFSPFLMLDDFYVKHPAGFPDHPHHG 60

Query: 66  QETITYVLRGMMAHEDFTGSKGVLRSGDLQFMTAGKAIVHSEIPVKMDNGESTQGLQLWV 125
           QETITYVL GM+AHEDFTG+KGVL  GDLQFMTAGK IVHSEIPV+M++GE+  GLQ WV
Sbjct: 61  QETITYVLNGMVAHEDFTGAKGVLGKGDLQFMTAGKGIVHSEIPVQMESGEACHGLQFWV 120

Query: 126 DLPNDIKNVEPRYRDLRREEIPLATPSDNLIVKVISGESYGVKSLTELAYTPVEFYHFIA 185
           DLP D+K  EPRYR+LR ++IP+  P++NL VKVISG+SYGV S+ +LAYTP+  YH++ 
Sbjct: 121 DLPKDLKWCEPRYRNLRGDKIPVVRPNENLTVKVISGKSYGVDSVRDLAYTPIHMYHYLT 180

Query: 186 NKKNTEFAQPFSDDFSSFIYIMKGSISISDQEYPESSAIFFKNDGDGIRGFTTSDNAEFA 245
           NK  T++ Q F  +F+ F+Y+MKG +S+ DQ +PE +A+FF  DGD ++G   +D+A+FA
Sbjct: 181 NKAGTQWEQEFPKNFNVFMYVMKGKVSVGDQVFPEHTAVFFNTDGDAVKGEFATDDAQFA 240

Query: 246 IIAGKYFNQKVVQYGPFVESSRENIVDVIQNYQNGVNGFENARTWSPVIKNGVTEAEVQQ 305
           I+ G+  +Q+ +Q+GPFVE+ RE+++ V  NYQ G+NGFE A+ W   I +G+TE +V++
Sbjct: 241 IMGGQILDQQTIQHGPFVETDRESLMKVFMNYQYGINGFERAKGWQSSIIHGITEKQVRE 300

Query: 306 YLPKG 310
              KG
Sbjct: 301 NEAKG 305

>NCAS0H00840 Chr8 complement(153671..154753) [1083 bp, 360 aa] {ON}
           Anc_6.23
          Length = 360

 Score =  394 bits (1012), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 179/299 (59%), Positives = 233/299 (77%)

Query: 8   KVRSVLKHFVAIEQSEGAGALVKRSIGTIQMRNFPPFLMLDNFDVSPPAGFPEHPHHGQE 67
           K RS+LKHF+A EQSEG GA V+RS+G+ QM  F PFLMLD+F V+PP GFP+HPHHGQE
Sbjct: 60  KERSILKHFIAEEQSEGDGATVRRSVGSYQMTRFSPFLMLDDFKVTPPEGFPDHPHHGQE 119

Query: 68  TITYVLRGMMAHEDFTGSKGVLRSGDLQFMTAGKAIVHSEIPVKMDNGESTQGLQLWVDL 127
           TITYV  G++AHEDFTGSKGVL  GDLQFMTAGK IVH E+PV M++   + GLQ WVDL
Sbjct: 120 TITYVTGGILAHEDFTGSKGVLYPGDLQFMTAGKGIVHCEMPVTMNDSAVSTGLQFWVDL 179

Query: 128 PNDIKNVEPRYRDLRREEIPLATPSDNLIVKVISGESYGVKSLTELAYTPVEFYHFIANK 187
           P D+KN EPRYR+LR + IP+   +DNL VKVISG+SY V+S+ +LAYTP++FY+FI+NK
Sbjct: 180 PADLKNCEPRYRNLRADTIPVVQVNDNLNVKVISGKSYDVESVKDLAYTPIDFYYFISNK 239

Query: 188 KNTEFAQPFSDDFSSFIYIMKGSISISDQEYPESSAIFFKNDGDGIRGFTTSDNAEFAII 247
             TEFAQ    DF++FIY+ KG+I+I ++ +   S++FF+ DG+ IRGFT SDN EFA+I
Sbjct: 240 AGTEFAQEIPPDFNAFIYVTKGAITIGEEVFKVHSSVFFQTDGNFIRGFTASDNTEFAVI 299

Query: 248 AGKYFNQKVVQYGPFVESSRENIVDVIQNYQNGVNGFENARTWSPVIKNGVTEAEVQQY 306
            GK  +Q+VVQ+GPFVE++RE +++V  NY+ G+NGFE A  W   I NG+ E   +++
Sbjct: 300 GGKILDQQVVQHGPFVETTREKLIEVFDNYRAGINGFEKALGWKSSISNGIDEQTAREW 358

>Kwal_56.22439 s56 complement(129210..130172) [963 bp, 320 aa] {ON}
           [contig 185] FULL
          Length = 320

 Score =  392 bits (1006), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 170/303 (56%), Positives = 239/303 (78%)

Query: 5   VVSKVRSVLKHFVAIEQSEGAGALVKRSIGTIQMRNFPPFLMLDNFDVSPPAGFPEHPHH 64
           ++ K RS+LK+F A+EQSEG GA V+RSIGT ++RNF PFLMLD+F ++PPAGFP+HPHH
Sbjct: 14  LMKKARSILKYFTALEQSEGVGAKVRRSIGTQKLRNFTPFLMLDHFTIAPPAGFPDHPHH 73

Query: 65  GQETITYVLRGMMAHEDFTGSKGVLRSGDLQFMTAGKAIVHSEIPVKMDNGESTQGLQLW 124
           GQET+T++LRG +AHEDFTGSKGVLR+GDLQFMTAGK  VHSEIPV++++G+ T+G+QLW
Sbjct: 74  GQETVTHILRGAVAHEDFTGSKGVLRAGDLQFMTAGKGTVHSEIPVQLESGDPTEGIQLW 133

Query: 125 VDLPNDIKNVEPRYRDLRREEIPLATPSDNLIVKVISGESYGVKSLTELAYTPVEFYHFI 184
           VDLP  +K+ +PRYRDL+R+ IP A   + L + VISG+SYGV S+ ELAYT V +YH++
Sbjct: 134 VDLPARLKDCQPRYRDLKRDRIPTARSKNGLNISVISGQSYGVDSIQELAYTSVHYYHYV 193

Query: 185 ANKKNTEFAQPFSDDFSSFIYIMKGSISISDQEYPESSAIFFKNDGDGIRGFTTSDNAEF 244
            ++ N  F Q F  DF+ F+Y++KG ++I+ QE+ + S+IFFK DG  + GF+ S++ EF
Sbjct: 194 FSEANISFEQVFPTDFNVFLYVLKGRLNIAGQEFSKHSSIFFKTDGSHVSGFSGSNDLEF 253

Query: 245 AIIAGKYFNQKVVQYGPFVESSRENIVDVIQNYQNGVNGFENARTWSPVIKNGVTEAEVQ 304
            +  G+  +Q +VQYGPFVE+S+E +++V QNYQ+G NGFE A  W+  I NG+ E+++ 
Sbjct: 254 ILAGGQILDQPIVQYGPFVETSKERMMEVFQNYQSGTNGFEKAAGWTSSIANGIVESDIS 313

Query: 305 QYL 307
            ++
Sbjct: 314 DFV 316

>Kpol_385.5 s385 (12788..13708) [921 bp, 306 aa] {ON} (12788..13708)
           [921 nt, 307 aa]
          Length = 306

 Score =  388 bits (997), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 176/292 (60%), Positives = 227/292 (77%)

Query: 9   VRSVLKHFVAIEQSEGAGALVKRSIGTIQMRNFPPFLMLDNFDVSPPAGFPEHPHHGQET 68
           +RS+ KHF+A EQ+EG GA V+RSIGT+ +R F PFLMLD+F+V+P AGFP+HPHHGQET
Sbjct: 7   LRSIFKHFIAREQAEGVGARVRRSIGTMLLRKFSPFLMLDHFNVAPGAGFPDHPHHGQET 66

Query: 69  ITYVLRGMMAHEDFTGSKGVLRSGDLQFMTAGKAIVHSEIPVKMDNGESTQGLQLWVDLP 128
           ITYV  GM+AHEDFTG KGVL  GDLQFMTAGKAI H+E+PV+ ++GE   GLQLWVDLP
Sbjct: 67  ITYVNEGMIAHEDFTGCKGVLYKGDLQFMTAGKAICHAEMPVQSNSGEHVVGLQLWVDLP 126

Query: 129 NDIKNVEPRYRDLRREEIPLATPSDNLIVKVISGESYGVKSLTELAYTPVEFYHFIANKK 188
            D+KN EPRYRDL+ +EIP A P+D+L V+VISG SYGV S+ +LAYTP++FY +   K 
Sbjct: 127 TDMKNTEPRYRDLKNKEIPRANPTDDLEVEVISGNSYGVDSVKDLAYTPIDFYMYRGKKA 186

Query: 189 NTEFAQPFSDDFSSFIYIMKGSISISDQEYPESSAIFFKNDGDGIRGFTTSDNAEFAIIA 248
            TEF Q FS DF+ FIY+++G+I+I DQ +P+ S+IFF  DGD + G   +DN EFAII 
Sbjct: 187 GTEFTQNFSRDFNVFIYVLQGAITIGDQVFPQYSSIFFNTDGDAVGGTIAADNTEFAIIG 246

Query: 249 GKYFNQKVVQYGPFVESSRENIVDVIQNYQNGVNGFENARTWSPVIKNGVTE 300
           GK  +Q+ VQ+GPFVE ++E ++ V  +YQ+  NGFE AR W   I++G+ E
Sbjct: 247 GKILDQQTVQHGPFVEETKEKLIKVFYDYQSYSNGFERARNWKSSIRDGIKE 298

>Kpol_1061.27 s1061 (79476..80396) [921 bp, 306 aa] {ON}
           (79476..80396) [921 nt, 307 aa]
          Length = 306

 Score =  386 bits (992), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 174/295 (58%), Positives = 228/295 (77%)

Query: 9   VRSVLKHFVAIEQSEGAGALVKRSIGTIQMRNFPPFLMLDNFDVSPPAGFPEHPHHGQET 68
           +RS+ KHF++ EQSEG GA V+RSIGT+ +R F PFLMLD+F+V+P AGFP+HPHHGQET
Sbjct: 7   LRSIFKHFISREQSEGVGARVRRSIGTMLLRKFSPFLMLDHFNVAPGAGFPDHPHHGQET 66

Query: 69  ITYVLRGMMAHEDFTGSKGVLRSGDLQFMTAGKAIVHSEIPVKMDNGESTQGLQLWVDLP 128
           ITYV  GM+AHEDFTG KGVL  GDLQFMTAGKAI H+E+PV+ ++GE   GLQLWVDLP
Sbjct: 67  ITYVNEGMIAHEDFTGCKGVLGKGDLQFMTAGKAICHAEMPVQSNSGEHVVGLQLWVDLP 126

Query: 129 NDIKNVEPRYRDLRREEIPLATPSDNLIVKVISGESYGVKSLTELAYTPVEFYHFIANKK 188
            D+KN EPRYRDLR ++IP A P+D+L ++VISG SYGV S+ +LAYTP++FY +   K 
Sbjct: 127 TDMKNTEPRYRDLRNKDIPRANPTDDLEIEVISGNSYGVDSVKDLAYTPIDFYMYRGKKA 186

Query: 189 NTEFAQPFSDDFSSFIYIMKGSISISDQEYPESSAIFFKNDGDGIRGFTTSDNAEFAIIA 248
            TEF Q FS DF+ FIY++KG+++I DQ +P+ S+IFF  DGD + G   +D+ EFAII 
Sbjct: 187 GTEFTQKFSRDFNVFIYVLKGAVNIGDQVFPQYSSIFFNTDGDAVGGTVAADDTEFAIIG 246

Query: 249 GKYFNQKVVQYGPFVESSRENIVDVIQNYQNGVNGFENARTWSPVIKNGVTEAEV 303
           GK  +Q+ VQ+GPFVE ++E ++ V  +YQ+  NGFE AR W   I++G+ E + 
Sbjct: 247 GKILDQETVQHGPFVEETKEKLIKVFYDYQSYSNGFERARNWRSSIRDGIKEDDA 301

>KNAG0M01190 Chr13 complement(216456..217598) [1143 bp, 380 aa] {ON}
           Anc_6.23
          Length = 380

 Score =  388 bits (997), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 175/301 (58%), Positives = 232/301 (77%)

Query: 10  RSVLKHFVAIEQSEGAGALVKRSIGTIQMRNFPPFLMLDNFDVSPPAGFPEHPHHGQETI 69
           R++ KHF+A EQ EG GA V+RS+G+++ RNF PFL+LD+F VS PAGFP+HPHHGQETI
Sbjct: 76  RTIQKHFIAGEQEEGVGARVRRSVGSMRQRNFSPFLLLDHFTVSHPAGFPDHPHHGQETI 135

Query: 70  TYVLRGMMAHEDFTGSKGVLRSGDLQFMTAGKAIVHSEIPVKMDNGESTQGLQLWVDLPN 129
           TYV  GM+AHEDF GSKGVLR GDLQFMTAGK I+HSEIPV M+NG++  GLQLWVDLP 
Sbjct: 136 TYVREGMIAHEDFLGSKGVLRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVDLPK 195

Query: 130 DIKNVEPRYRDLRREEIPLATPSDNLIVKVISGESYGVKSLTELAYTPVEFYHFIANKKN 189
           D+K+  PRYR+LR  EIP+A P+++L +KVISG+S+G+ S+ ELAYTPV+FYH+I++KK 
Sbjct: 196 DMKDCAPRYRNLRGTEIPIAEPNEHLKIKVISGKSHGIDSVKELAYTPVDFYHYISDKKG 255

Query: 190 TEFAQPFSDDFSSFIYIMKGSISISDQEYPESSAIFFKNDGDGIRGFTTSDNAEFAIIAG 249
           T F Q    +F+ F+Y+MKG++ I  Q +P+ S +F+  +GD IRG    D+ EFAII G
Sbjct: 256 TGFVQEVPTNFNVFLYVMKGAVKIDGQVFPQYSTVFYNANGDAIRGMVDDDDTEFAIIGG 315

Query: 250 KYFNQKVVQYGPFVESSRENIVDVIQNYQNGVNGFENARTWSPVIKNGVTEAEVQQYLPK 309
              +Q V+Q+GPFVE++RE I++V QN+Q G+NGFE A  W   I+NG+ E +V  +   
Sbjct: 316 LILDQPVIQHGPFVETTREKIIEVFQNFQYGINGFERAVGWKSSIRNGILEKDVPAFEAA 375

Query: 310 G 310
           G
Sbjct: 376 G 376

>KNAG0D02240 Chr4 complement(385803..386882) [1080 bp, 359 aa] {ON} 
          Length = 359

 Score =  382 bits (982), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 171/300 (57%), Positives = 232/300 (77%)

Query: 8   KVRSVLKHFVAIEQSEGAGALVKRSIGTIQMRNFPPFLMLDNFDVSPPAGFPEHPHHGQE 67
           K+RS+  HF+  E +EG GA VKRS+G++Q R F PFLMLD+F V  P+GFP+HPHHGQE
Sbjct: 59  KLRSIANHFIPREVAEGVGARVKRSVGSMQQRRFTPFLMLDDFTVKSPSGFPDHPHHGQE 118

Query: 68  TITYVLRGMMAHEDFTGSKGVLRSGDLQFMTAGKAIVHSEIPVKMDNGESTQGLQLWVDL 127
           TITYV+ G++AHEDFTGSKGVLR GDLQFMTAGK IVHSE+PV+M++G   +GLQLWVDL
Sbjct: 119 TITYVIDGLIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMPVEMEDGRPARGLQLWVDL 178

Query: 128 PNDIKNVEPRYRDLRREEIPLATPSDNLIVKVISGESYGVKSLTELAYTPVEFYHFIANK 187
           P D+KN EPRYR+LR E+IP+  P +NL V+VISG+SYG +S+ +LAYTP++FY+ +A+K
Sbjct: 179 PKDLKNCEPRYRNLRSEDIPVVKPHENLEVRVISGKSYGTESVKDLAYTPIDFYYMLASK 238

Query: 188 KNTEFAQPFSDDFSSFIYIMKGSISISDQEYPESSAIFFKNDGDGIRGFTTSDNAEFAII 247
             TEFAQ    DF++F+Y+MKGS+ I+++ + +++AIFF  DG+G+ G   SD+ EFAII
Sbjct: 239 AGTEFAQEIPSDFNAFLYVMKGSVVINEKVFKQNTAIFFDTDGEGVAGQAGSDDTEFAII 298

Query: 248 AGKYFNQKVVQYGPFVESSRENIVDVIQNYQNGVNGFENARTWSPVIKNGVTEAEVQQYL 307
            GK  +Q +VQ+GPFVE+ +E + +   NY+    GFE A+ W   I +G+ E+E +Q L
Sbjct: 299 GGKILDQPLVQHGPFVETDQEKLYEAFMNYEGYTKGFERAKGWRSDIASGINESEAKQLL 358

>KNAG0K01400 Chr11 complement(280379..281308) [930 bp, 309 aa] {ON} 
          Length = 309

 Score =  379 bits (972), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 173/297 (58%), Positives = 231/297 (77%)

Query: 10  RSVLKHFVAIEQSEGAGALVKRSIGTIQMRNFPPFLMLDNFDVSPPAGFPEHPHHGQETI 69
           RSV K F A+EQ+EG GALV+RSIG  + RNF PFL+LD+F VS P+GFP+HPHHGQETI
Sbjct: 6   RSVQKAFRALEQAEGVGALVRRSIGVRRQRNFSPFLLLDHFTVSHPSGFPDHPHHGQETI 65

Query: 70  TYVLRGMMAHEDFTGSKGVLRSGDLQFMTAGKAIVHSEIPVKMDNGESTQGLQLWVDLPN 129
           TY+ +GM+AHEDFTGSKG+LR GDLQFMTAGK IVHSEIPV   + ++  GLQLWVDLP 
Sbjct: 66  TYIQQGMIAHEDFTGSKGILRPGDLQFMTAGKGIVHSEIPVLTKDAKAAVGLQLWVDLPK 125

Query: 130 DIKNVEPRYRDLRREEIPLATPSDNLIVKVISGESYGVKSLTELAYTPVEFYHFIANKKN 189
           ++K+  PRYR+LR  EIP+A P+++L VKVISG+SYGV+S+ ELAYTPV+FYH+I++K+ 
Sbjct: 126 NMKDCPPRYRNLRASEIPIAQPNEHLKVKVISGKSYGVESVKELAYTPVDFYHYISDKEG 185

Query: 190 TEFAQPFSDDFSSFIYIMKGSISISDQEYPESSAIFFKNDGDGIRGFTTSDNAEFAIIAG 249
             F Q   +++++F+Y+M+GS+ +  QEYP+ S IF+  +G+ I+G T   N EFAIIAG
Sbjct: 186 INFVQEIPENYNAFLYVMEGSVVVDGQEYPQYSTIFYNANGNAIKGVTGEKNTEFAIIAG 245

Query: 250 KYFNQKVVQYGPFVESSRENIVDVIQNYQNGVNGFENARTWSPVIKNGVTEAEVQQY 306
              +Q +VQ+GPFVE+S E + +V +NYQ G+NGFE A  W   I NG+TE ++  +
Sbjct: 246 LILDQDIVQHGPFVETSPEKMKEVFRNYQWGINGFEKAINWESSIINGITEKDITNF 302

>NDAI0C02620 Chr3 (608649..609584) [936 bp, 311 aa] {ON} Anc_6.23
          Length = 311

 Score =  374 bits (961), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 176/305 (57%), Positives = 234/305 (76%), Gaps = 1/305 (0%)

Query: 3   LNVVSKVRSVLKHFVAIEQSEGAGALVKRSIGTIQMRNFPPFLMLDNFDVSPPAGFPEHP 62
           ++ V ++RSV K+F+AIEQ EG GA V+RSIG+++ RNF PFL++D+F VS PAGFP+HP
Sbjct: 1   MSKVPQIRSVAKNFIAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDHFTVSHPAGFPDHP 60

Query: 63  HHGQETITYVLRGMMAHEDFTGSKGVLRSGDLQFMTAGKAIVHSEIPVKMDNGESTQGLQ 122
           HHGQETITYVL GM+AHEDFTGSKGVLR GDLQFMTAGKAI+HSEIPVKM+NG    G+Q
Sbjct: 61  HHGQETITYVLNGMIAHEDFTGSKGVLRPGDLQFMTAGKAIMHSEIPVKMENGTPGIGIQ 120

Query: 123 LWVDLPNDIKNVEPRYRDLRREEIPLATPSDNLIVKVISGESYGVKSLTELAYTPVEFYH 182
           LWV LP D+KN EPRYR+LR ++IP+  P++NL V+VISG+SYG +S+ +LAYTP+++Y 
Sbjct: 121 LWVALPIDLKNSEPRYRNLRGDKIPIIKPNENLTVRVISGKSYGTESVKDLAYTPIDYYI 180

Query: 183 FIANKKNTEFAQPFSDDFSSFIYIMKGSISISDQEYPESSAIFFKNDGDGIRGFTTSD-N 241
           F  NKK  EF Q    +F+ F+YI KG++ I+   YP+ S +FF  DGD I+G + +D  
Sbjct: 181 FNMNKKGVEFFQETPRNFNFFLYITKGAVEINGVVYPKYSTVFFDTDGDSIKGKSAADEE 240

Query: 242 AEFAIIAGKYFNQKVVQYGPFVESSRENIVDVIQNYQNGVNGFENARTWSPVIKNGVTEA 301
            EFAII G   +Q ++Q+GPFVE+ RE+++ V +NYQ  +NGFE AR W   I +G+ E 
Sbjct: 241 TEFAIIGGLILDQPILQHGPFVETDRESLLQVFKNYQYCINGFERARGWRSSIADGILEK 300

Query: 302 EVQQY 306
           +V  +
Sbjct: 301 DVPAF 305

>KLTH0C11154g Chr3 (916374..917291) [918 bp, 305 aa] {ON} conserved
           hypothetical protein
          Length = 305

 Score =  374 bits (959), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 175/300 (58%), Positives = 233/300 (77%)

Query: 6   VSKVRSVLKHFVAIEQSEGAGALVKRSIGTIQMRNFPPFLMLDNFDVSPPAGFPEHPHHG 65
           ++K RS+LK+F A+EQSEG GA V+RSIG+ ++RNF PFLMLD+F+VSPPAGFP+HPHHG
Sbjct: 1   MNKPRSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHG 60

Query: 66  QETITYVLRGMMAHEDFTGSKGVLRSGDLQFMTAGKAIVHSEIPVKMDNGESTQGLQLWV 125
           QETITYVL GM+AHEDFTGS+GVLR GDLQFMTAGK I+HSEIPV++++G  + GLQLWV
Sbjct: 61  QETITYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWV 120

Query: 126 DLPNDIKNVEPRYRDLRREEIPLATPSDNLIVKVISGESYGVKSLTELAYTPVEFYHFIA 185
           DLP  +K+ EPRYRDL   EIP   P   L V+VISGESYGV S++ELAYTPV FYH+I 
Sbjct: 121 DLPMHLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYIT 180

Query: 186 NKKNTEFAQPFSDDFSSFIYIMKGSISISDQEYPESSAIFFKNDGDGIRGFTTSDNAEFA 245
            K  T F Q F  +F+ F+Y++KGS+ ++ + + + S++FF  DG  + G  +S+ +EF 
Sbjct: 181 RKPGTTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDGSRVEGSGSSEESEFI 240

Query: 246 IIAGKYFNQKVVQYGPFVESSRENIVDVIQNYQNGVNGFENARTWSPVIKNGVTEAEVQQ 305
           +I G+  +Q ++QYGPFVE+S++N+ +VI NYQ+G NGFE A+ WS  I  GV  ++V +
Sbjct: 241 LIGGEVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDVAK 300

>NDAI0D00830 Chr4 complement(188085..189209) [1125 bp, 374 aa] {ON}
           Anc_6.23
          Length = 374

 Score =  373 bits (958), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 173/301 (57%), Positives = 227/301 (75%), Gaps = 3/301 (0%)

Query: 10  RSVLKHFVAIEQSEGAGALVKRSIGTIQMRNFPPFLMLDNFDVSPP-AGFPEHPHHGQET 68
           R++LK+F+  EQSEG GA V+R+IGT +M  FPPFLMLD+F V+PP  GFP+HPHHGQET
Sbjct: 73  RTILKYFIPDEQSEGVGARVRRAIGTNEMPRFPPFLMLDHFKVTPPEQGFPDHPHHGQET 132

Query: 69  ITYVLRGMMAHEDFTGSKGVLRSGDLQFMTAGKAIVHSEIPVKMDNGESTQGLQLWVDLP 128
           ITY+L GM+AHEDFTGSKGVLR GDLQFMTAGK IVHSE+PV M +G    GLQLWVDLP
Sbjct: 133 ITYILDGMIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMPVLMKDGRPGIGLQLWVDLP 192

Query: 129 NDIKNVEPRYRDLRREEIPLATPSD--NLIVKVISGESYGVKSLTELAYTPVEFYHFIAN 186
            ++KN EPRYR+LR+ EIP+    D  ++ VKVISG +YGV S+ +LAYTP+ FYH+I++
Sbjct: 193 RELKNCEPRYRNLRKNEIPIVHTDDEKHMTVKVISGNAYGVDSVRDLAYTPIHFYHYISD 252

Query: 187 KKNTEFAQPFSDDFSSFIYIMKGSISISDQEYPESSAIFFKNDGDGIRGFTTSDNAEFAI 246
           K   EF Q   DDF+ F+Y+MKG++ I DQ + +++A+FF  DG  I+G + +++ EFAI
Sbjct: 253 KAGVEFKQSVPDDFNVFLYVMKGAVVIDDQIFKQNTAVFFNVDGHSIKGQSATNDTEFAI 312

Query: 247 IAGKYFNQKVVQYGPFVESSRENIVDVIQNYQNGVNGFENARTWSPVIKNGVTEAEVQQY 306
           I GK  +Q +VQ+GPFVE++RE++  V +NYQ G+NGFE A  W   I +G+ E      
Sbjct: 313 IGGKILDQPLVQHGPFVETTREDLYKVFENYQQGINGFERAVNWRSSIADGIDEDTANAL 372

Query: 307 L 307
           L
Sbjct: 373 L 373

>KAFR0G02680 Chr7 (553335..554486) [1152 bp, 383 aa] {ON} Anc_6.23
          Length = 383

 Score =  364 bits (934), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 167/296 (56%), Positives = 222/296 (75%)

Query: 10  RSVLKHFVAIEQSEGAGALVKRSIGTIQMRNFPPFLMLDNFDVSPPAGFPEHPHHGQETI 69
           RS++ HF+  E  EG GA VKRSIG+ + R F PFLMLD+FDV+PPAGFP+HPHHGQETI
Sbjct: 85  RSIINHFIPNETFEGDGARVKRSIGSHEQRRFAPFLMLDDFDVTPPAGFPDHPHHGQETI 144

Query: 70  TYVLRGMMAHEDFTGSKGVLRSGDLQFMTAGKAIVHSEIPVKMDNGESTQGLQLWVDLPN 129
           TYVL GM+AHEDFTG  G+L  GDLQFMTAG+ IVHSEIPV M+NG S +GLQLWVDLP 
Sbjct: 145 TYVLSGMIAHEDFTGLNGILSPGDLQFMTAGRGIVHSEIPVTMENGGSCRGLQLWVDLPQ 204

Query: 130 DIKNVEPRYRDLRREEIPLATPSDNLIVKVISGESYGVKSLTELAYTPVEFYHFIANKKN 189
           D+K +EPRYR+LR  +IP+A P +NL V VISG+SY V+SL +LAYTPV  YHF+  K  
Sbjct: 205 DLKTIEPRYRNLRAADIPIAMPYENLKVYVISGKSYDVESLNDLAYTPVHLYHFVTIKAG 264

Query: 190 TEFAQPFSDDFSSFIYIMKGSISISDQEYPESSAIFFKNDGDGIRGFTTSDNAEFAIIAG 249
           T F Q F  DF+ F+Y++KG++ I+++ + E++AIFF  DG+ I G   +D++EF ++ G
Sbjct: 265 TPFIQEFPKDFNVFLYVIKGAVLINEKIFKENTAIFFDVDGESIEGQFATDDSEFVLVGG 324

Query: 250 KYFNQKVVQYGPFVESSRENIVDVIQNYQNGVNGFENARTWSPVIKNGVTEAEVQQ 305
           +  NQ VVQ GPFVE+ ++ ++ V  ++++  NGFE A  W   I+ G+ EAE ++
Sbjct: 325 EILNQPVVQQGPFVETDKQKLMQVFDDFESYRNGFERAENWESNIRKGIKEAEARE 380

>YNL169C Chr14 complement(316169..317671) [1503 bp, 500 aa] {ON}
           PSD1Phosphatidylserine decarboxylase of the
           mitochondrial inner membrane, converts
           phosphatidylserine to phosphatidylethanolamine
          Length = 500

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 61/129 (47%), Gaps = 8/129 (6%)

Query: 132 KNVEPRYRDLRREEIPLATPSDNLIVKV--ISGESYGVKSLTELAYTPVEFY----HFIA 185
           +N++P  R + + E  +A+PSD  I++V  I+ E+  ++ +  + Y+  EF     H + 
Sbjct: 189 RNIKPGTRPVAQGEDVIASPSDGKILQVGIINSETGEIEQVKGMTYSIKEFLGTHSHPLM 248

Query: 186 NKKNTEFAQPFSDDFSSFIYIMKGSISISDQEYPESSAIFFKNDGD-GIRGFTTSDNAEF 244
           +K  +      SD+     +     I ++  E  E   + FKN+GD  +R F  S +   
Sbjct: 249 SKSASSLDLT-SDEEKHREFARVNRIQLAGSEDTEQPLLNFKNEGDQSVREFKPSVSKNI 307

Query: 245 AIIAGKYFN 253
            +++    N
Sbjct: 308 HLLSQLSLN 316

>KLTH0D00198g Chr4 complement(12199..13608) [1410 bp, 469 aa] {ON}
           similar to uniprot|P24031 Saccharomyces cerevisiae
           YBR092C PHO3 Constitutively expressed acid phosphatase
           similar to Pho5p; brought to the cell surface by
           transport vesicles; hydrolyzes thiamin phosphates in the
           periplasmic space, increasing cellular thiamin uptake;
           expression is repressed by thiamin
          Length = 469

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 12/73 (16%)

Query: 203 FIYIMKGSISISDQEYPESSAIFFKNDGDGIRGFTTSDNAEFAI-------IAGKYFNQK 255
           F Y   GS+S  D +Y      FF  D D +   TT++N+  AI        A K+  + 
Sbjct: 100 FPYQFNGSLSFIDDDYE-----FFIQDLDNLEMETTTENSVNAINPYTGEMDAKKHAQEF 154

Query: 256 VVQYGPFVESSRE 268
           + QY  F+E +RE
Sbjct: 155 LAQYADFLEDNRE 167

>Suva_10.97 Chr10 (183697..184710) [1014 bp, 337 aa] {ON} YLR017W
           (REAL)
          Length = 337

 Score = 30.4 bits (67), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 39/82 (47%), Gaps = 10/82 (12%)

Query: 192 FAQPFSDDFSSFIYIMKGSISISDQEYPESSAIFFKND-----GDGIRGFTTSDNAEFAI 246
           F QPFS+ F+ +IY  K SI+  + E P    + +  D      +G +  T +++  + +
Sbjct: 165 FGQPFSEKFAEYIYQFKDSITNPESEEP--CHLHYDKDMTVVCMEGPQFSTRAESKMYRM 222

Query: 247 IAGKYFNQKVVQYGPFVESSRE 268
             G   N  V+   P  + +RE
Sbjct: 223 FGGHVINMSVI---PEAKLARE 241

>CAGL0H05093g Chr8 complement(490310..494308) [3999 bp, 1332 aa] {ON}
            highly similar to uniprot|Q06706 Saccharomyces cerevisiae
            YLR384c IKI3
          Length = 1332

 Score = 30.8 bits (68), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 9/25 (36%), Positives = 18/25 (72%)

Query: 270  IVDVIQNYQNGVNGFENARTWSPVI 294
            I +++  YQN VN +++A++W P +
Sbjct: 1027 IFEMLGEYQNAVNAYKSAKSWKPAL 1051

>Skud_12.85 Chr12 (169420..170433) [1014 bp, 337 aa] {ON} YLR017W
           (REAL)
          Length = 337

 Score = 30.0 bits (66), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 38/82 (46%), Gaps = 10/82 (12%)

Query: 192 FAQPFSDDFSSFIYIMKGSISISDQEYPESSAIFFKND-----GDGIRGFTTSDNAEFAI 246
           F QPFS  F+ +IY  K SI+  + E P    + +  D      +G +  T +++  + +
Sbjct: 165 FGQPFSQKFAEYIYQFKDSITNPESEEP--CHLHYDKDMTVVCMEGPQFSTRAESKMYRM 222

Query: 247 IAGKYFNQKVVQYGPFVESSRE 268
             G   N  V+   P  + +RE
Sbjct: 223 FGGHVINMSVI---PEAKLARE 241

>Smik_12.80 Chr12 (164445..165458) [1014 bp, 337 aa] {ON} YLR017W
           (REAL)
          Length = 337

 Score = 29.6 bits (65), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 38/82 (46%), Gaps = 10/82 (12%)

Query: 192 FAQPFSDDFSSFIYIMKGSISISDQEYPESSAIFFKND-----GDGIRGFTTSDNAEFAI 246
           F QPFS  F+ +IY  K +I+  + E P    + F  D      +G +  T +++  + +
Sbjct: 165 FGQPFSQKFAEYIYQFKDAITNPESEEP--CHLHFDKDMTVVCMEGPQFSTRAESKMYRM 222

Query: 247 IAGKYFNQKVVQYGPFVESSRE 268
             G   N  V+   P  + +RE
Sbjct: 223 FGGHVINMSVI---PEAKLARE 241

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,278,566
Number of extensions: 1535148
Number of successful extensions: 3820
Number of sequences better than 10.0: 36
Number of HSP's gapped: 3921
Number of HSP's successfully gapped: 36
Length of query: 311
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 202
Effective length of database: 40,982,805
Effective search space: 8278526610
Effective search space used: 8278526610
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)