Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D01221g6.22ON56656629290.0
SAKL0E01364g6.22ON54152620740.0
Ecym_30276.22ON54952720190.0
TDEL0G044706.22ON54254720180.0
KAFR0A050706.22ON56454820190.0
Kwal_56.224376.22ON53653220140.0
Kpol_1037.276.22ON54654720100.0
TBLA0G009706.22ON55954220000.0
KLTH0C11176g6.22ON53653319970.0
YOR002W (ALG6)6.22ON54453019840.0
Suva_15.1776.22ON54453019800.0
KNAG0F028906.22ON56356619810.0
Smik_15.1716.22ON54453019780.0
ACR004W6.22ON56353319760.0
NDAI0C026306.22ON58057719750.0
NCAS0D021606.22ON56356219720.0
Skud_15.1636.22ON54453019620.0
ZYRO0C07744g6.22ON54754119560.0
TPHA0J003506.22ON55956819340.0
CAGL0E02629g6.22ON54854719120.0
TBLA0A093105.669ON5463663244e-31
KLTH0F17666g5.669ON5554163121e-29
ZYRO0A11506g5.669ON5562873067e-29
ADR210C5.669ON5723792981e-27
TPHA0J013805.669ON5752602971e-27
YOR067C (ALG8)5.669ON5772572962e-27
KAFR0D024405.669ON5752952943e-27
Kwal_55.217425.669ON5554172915e-27
CAGL0L10450g5.669ON5504202909e-27
KNAG0L019205.669ON5684202891e-26
Smik_15.2475.669ON5773742845e-26
NCAS0G004505.669ON5702612811e-25
Suva_8.1185.669ON5763732792e-25
TDEL0B025405.669ON5693742774e-25
KLLA0F16621g5.669ON5612902748e-25
Skud_15.2345.669ON5772602731e-24
SAKL0G00836g5.669ON5612632731e-24
NDAI0F005105.669ON5704202712e-24
Kpol_1018.735.669ON6212612703e-24
Ecym_40515.669ON6042652571e-22
TBLA0H037608.564ON36337689.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D01221g
         (566 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D01221g Chr4 complement(106736..108436) [1701 bp, 566 aa] {...  1132   0.0  
SAKL0E01364g Chr5 (103009..104634) [1626 bp, 541 aa] {ON} simila...   803   0.0  
Ecym_3027 Chr3 complement(52360..54009) [1650 bp, 549 aa] {ON} s...   782   0.0  
TDEL0G04470 Chr7 (810734..812362) [1629 bp, 542 aa] {ON} Anc_6.2...   781   0.0  
KAFR0A05070 Chr1 complement(1007657..1009351) [1695 bp, 564 aa] ...   782   0.0  
Kwal_56.22437 s56 complement(127493..129103) [1611 bp, 536 aa] {...   780   0.0  
Kpol_1037.27 s1037 complement(65544..67184) [1641 bp, 546 aa] {O...   778   0.0  
TBLA0G00970 Chr7 (246516..248195) [1680 bp, 559 aa] {ON} Anc_6.2...   775   0.0  
KLTH0C11176g Chr3 (917419..919029) [1611 bp, 536 aa] {ON} simila...   773   0.0  
YOR002W Chr15 (329417..331051) [1635 bp, 544 aa] {ON}  ALG6Alpha...   768   0.0  
Suva_15.177 Chr15 (303845..305479) [1635 bp, 544 aa] {ON} YOR002...   767   0.0  
KNAG0F02890 Chr6 complement(547204..548895) [1692 bp, 563 aa] {O...   767   0.0  
Smik_15.171 Chr15 (296715..298349) [1635 bp, 544 aa] {ON} YOR002...   766   0.0  
ACR004W Chr3 (360904..362595) [1692 bp, 563 aa] {ON} Syntenic ho...   765   0.0  
NDAI0C02630 Chr3 (609993..611735) [1743 bp, 580 aa] {ON} Anc_6.2...   765   0.0  
NCAS0D02160 Chr4 complement(401973..403664) [1692 bp, 563 aa] {O...   764   0.0  
Skud_15.163 Chr15 (289416..291050) [1635 bp, 544 aa] {ON} YOR002...   760   0.0  
ZYRO0C07744g Chr3 (587374..589017) [1644 bp, 547 aa] {ON} highly...   758   0.0  
TPHA0J00350 Chr10 complement(77974..79653) [1680 bp, 559 aa] {ON...   749   0.0  
CAGL0E02629g Chr5 (250010..251656) [1647 bp, 548 aa] {ON} highly...   741   0.0  
TBLA0A09310 Chr1 (2297508..2299148) [1641 bp, 546 aa] {ON} Anc_5...   129   4e-31
KLTH0F17666g Chr6 complement(1425802..1427469) [1668 bp, 555 aa]...   124   1e-29
ZYRO0A11506g Chr1 complement(925282..926952) [1671 bp, 556 aa] {...   122   7e-29
ADR210C Chr4 complement(1070234..1071952) [1719 bp, 572 aa] {ON}...   119   1e-27
TPHA0J01380 Chr10 complement(321431..323158) [1728 bp, 575 aa] {...   119   1e-27
YOR067C Chr15 complement(451729..453462) [1734 bp, 577 aa] {ON} ...   118   2e-27
KAFR0D02440 Chr4 (489816..491543) [1728 bp, 575 aa] {ON} Anc_5.6...   117   3e-27
Kwal_55.21742 s55 complement(960476..962143) [1668 bp, 555 aa] {...   116   5e-27
CAGL0L10450g Chr12 complement(1117959..1119611) [1653 bp, 550 aa...   116   9e-27
KNAG0L01920 Chr12 complement(344454..346160) [1707 bp, 568 aa] {...   115   1e-26
Smik_15.247 Chr15 complement(417710..419443) [1734 bp, 577 aa] {...   114   5e-26
NCAS0G00450 Chr7 (77781..79493) [1713 bp, 570 aa] {ON} Anc_5.669...   112   1e-25
Suva_8.118 Chr8 complement(214797..216527) [1731 bp, 576 aa] {ON...   112   2e-25
TDEL0B02540 Chr2 (459825..461534) [1710 bp, 569 aa] {ON} Anc_5.6...   111   4e-25
KLLA0F16621g Chr6 complement(1531745..1533430) [1686 bp, 561 aa]...   110   8e-25
Skud_15.234 Chr15 complement(413571..415304) [1734 bp, 577 aa] {...   109   1e-24
SAKL0G00836g Chr7 (77387..79072) [1686 bp, 561 aa] {ON} highly s...   109   1e-24
NDAI0F00510 Chr6 (118893..120605) [1713 bp, 570 aa] {ON} Anc_5.6...   108   2e-24
Kpol_1018.73 s1018 complement(205615..207480) [1866 bp, 621 aa] ...   108   3e-24
Ecym_4051 Chr4 (109310..111124) [1815 bp, 604 aa] {ON} similar t...   103   1e-22
TBLA0H03760 Chr8 complement(913973..915064) [1092 bp, 363 aa] {O...    31   9.8  

>KLLA0D01221g Chr4 complement(106736..108436) [1701 bp, 566 aa] {ON}
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002W ALG6 Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease,
          Length = 566

 Score = 1132 bits (2929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 554/566 (97%), Positives = 554/566 (97%)

Query: 1   MGLKKKQTPKNAVKKTVSSLPANAETTTSTAIMKKVESVEAFFASPMYDFLTPFRPVGNQ 60
           MGLKKKQTPKNAVKKTVSSLPANAETTTSTAIMKKVESVEAFFASPMYDFLTPFRPVGNQ
Sbjct: 1   MGLKKKQTPKNAVKKTVSSLPANAETTTSTAIMKKVESVEAFFASPMYDFLTPFRPVGNQ 60

Query: 61  WCAKYVIVIFALIIRCAVGLGGYSGMNTPPMFGDFEAQRHWMEITQHLPVREWYWYDLQY 120
           WCAKYVIVIFALIIRCAVGLGGYSGMNTPPMFGDFEAQRHWMEITQHLPVREWYWYDLQY
Sbjct: 61  WCAKYVIVIFALIIRCAVGLGGYSGMNTPPMFGDFEAQRHWMEITQHLPVREWYWYDLQY 120

Query: 121 WGLDYPPLTAYHSYLLGKLGSFFREGWFDLESSRGYESLNLKSYMRFTVIISELLLYIPA 180
           WGLDYPPLTAYHSYLLGKLGSFFREGWFDLESSRGYESLNLKSYMRFTVIISELLLYIPA
Sbjct: 121 WGLDYPPLTAYHSYLLGKLGSFFREGWFDLESSRGYESLNLKSYMRFTVIISELLLYIPA 180

Query: 181 VIYFTKWVGKYRSQSPIGQYIAAAAILFQPALILVDHGHFQYNCVMLGMTVYTLNNLLDG 240
           VIYFTKWVGKYRSQSPIGQYIAAAAILFQPALILVDHGHFQYNCVMLGMTVYTLNNLLDG
Sbjct: 181 VIYFTKWVGKYRSQSPIGQYIAAAAILFQPALILVDHGHFQYNCVMLGMTVYTLNNLLDG 240

Query: 241 FYAMGAICFVLSLCFKQMALYYSPIFFAYLLSKSTYSPGINLPRLFAISVSTALAFIGSF 300
           FYAMGAICFVLSLCFKQMALYYSPIFFAYLLSKSTYSPGINLPRLFAISVSTALAFIGSF
Sbjct: 241 FYAMGAICFVLSLCFKQMALYYSPIFFAYLLSKSTYSPGINLPRLFAISVSTALAFIGSF 300

Query: 301 GPIYIFGGYKNLVQSMHRIFPFARGIFEDKVANFWCVSNIFIKYRNLFTQKDLQLYSLLA 360
           GPIYIFGGYKNLVQSMHRIFPFARGIFEDKVANFWCVSNIFIKYRNLFTQKDLQLYSLLA
Sbjct: 301 GPIYIFGGYKNLVQSMHRIFPFARGIFEDKVANFWCVSNIFIKYRNLFTQKDLQLYSLLA 360

Query: 361 TVIGLLPSFIITFLYPKRHLLPYALAACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSRDW 420
           TVIGLLPSFIITFLYPKRHLLPYALAACSMSFFLFSFQVHEK            YTSRDW
Sbjct: 361 TVIGLLPSFIITFLYPKRHLLPYALAACSMSFFLFSFQVHEKTILLPLLPITLLYTSRDW 420

Query: 421 NVLSLVCWINNVALFTLWPLLKKDNLVLQYGVMFMFSNWLIGNFSFVTPRFLPKFLTPGP 480
           NVLSLVCWINNVALFTLWPLLKKDNLVLQYGVMFMFSNWLIGNFSFVTPRFLPKFLTPGP
Sbjct: 421 NVLSLVCWINNVALFTLWPLLKKDNLVLQYGVMFMFSNWLIGNFSFVTPRFLPKFLTPGP 480

Query: 481 SISDIDVDYRRASLLPKSLIWRLIIVGSYIAMGIIHFLDYYVSPPSKYPDLWVLANCSLG 540
           SISDIDVDYRRASLLPKSLIWRLIIVGSYIAMGIIHFLDYYVSPPSKYPDLWVLANCSLG
Sbjct: 481 SISDIDVDYRRASLLPKSLIWRLIIVGSYIAMGIIHFLDYYVSPPSKYPDLWVLANCSLG 540

Query: 541 FSCFVTFWIWNNYKLFEMRNSTLQDL 566
           FSCFVTFWIWNNYKLFEMRNSTLQDL
Sbjct: 541 FSCFVTFWIWNNYKLFEMRNSTLQDL 566

>SAKL0E01364g Chr5 (103009..104634) [1626 bp, 541 aa] {ON} similar
           to uniprot|Q12001 Saccharomyces cerevisiae YOR002W ALG6
           Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 541

 Score =  803 bits (2074), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/526 (71%), Positives = 442/526 (84%)

Query: 40  EAFFASPMYDFLTPFRPVGNQWCAKYVIVIFALIIRCAVGLGGYSGMNTPPMFGDFEAQR 99
           E+FFASP++DFL+PFRPV NQWCAKY+IV+FALIIRC VGLG +SGMN PPM GDFEAQR
Sbjct: 15  ESFFASPLFDFLSPFRPVANQWCAKYIIVLFALIIRCGVGLGSFSGMNVPPMHGDFEAQR 74

Query: 100 HWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKLGSFFREGWFDLESSRGYESL 159
           HWME+T +LP+ +WYWYDL YWGLDYPPLTAYHSY+LGKLG  F   WF L  SRG ES+
Sbjct: 75  HWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKLGDIFDPTWFQLGVSRGQESM 134

Query: 160 NLKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAILFQPALILVDHGH 219
           +LKSYMRFTV++SELLLYIP VIYF KW+GK+R Q+PIGQYIAAAAILFQP+LIL+DHGH
Sbjct: 135 DLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAAILFQPSLILIDHGH 194

Query: 220 FQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMALYYSPIFFAYLLSKSTYSPG 279
           FQYN VMLG+TVY +NNLLD +YA  AICFVLS+CFKQMALYY+PIFF+YLLSKS +SP 
Sbjct: 195 FQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAPIFFSYLLSKSLFSPL 254

Query: 280 INLPRLFAISVSTALAFIGSFGPIYIFGGYKNLVQSMHRIFPFARGIFEDKVANFWCVSN 339
            NLPRL A++ +T ++F   F P+Y++GG +N++QS+HRIFPF+RGIFEDKVANFWC SN
Sbjct: 255 FNLPRLLAVAAATLISFAAMFFPLYMWGGIRNVLQSIHRIFPFSRGIFEDKVANFWCFSN 314

Query: 340 IFIKYRNLFTQKDLQLYSLLATVIGLLPSFIITFLYPKRHLLPYALAACSMSFFLFSFQV 399
           IFIKY+ L+TQ  LQ+YSL AT +G LP+FI+ F YPK+HL+PYAL ACSMSFFLFSFQV
Sbjct: 315 IFIKYKVLYTQSQLQMYSLCATALGFLPAFILIFFYPKKHLIPYALTACSMSFFLFSFQV 374

Query: 400 HEKXXXXXXXXXXXXYTSRDWNVLSLVCWINNVALFTLWPLLKKDNLVLQYGVMFMFSNW 459
           HEK            YTS DWNVLS+V WINN+A FTLWPLLKKD LVLQY  + + SNW
Sbjct: 375 HEKTILVPLLPITLLYTSTDWNVLSMVSWINNMAFFTLWPLLKKDGLVLQYATLLLLSNW 434

Query: 460 LIGNFSFVTPRFLPKFLTPGPSISDIDVDYRRASLLPKSLIWRLIIVGSYIAMGIIHFLD 519
           LIGNFSFVTPRFLPKFLTPGPS SD+  +YRR SLLP ++ W+LIIV SYI+MGI+H LD
Sbjct: 435 LIGNFSFVTPRFLPKFLTPGPSTSDVSENYRRRSLLPDNIFWKLIIVASYISMGILHLLD 494

Query: 520 YYVSPPSKYPDLWVLANCSLGFSCFVTFWIWNNYKLFEMRNSTLQD 565
           +YV PP+KYPDLWVL NCSLGF  F  FW+WN YK+F +RN TL D
Sbjct: 495 FYVQPPAKYPDLWVLLNCSLGFFSFFLFWVWNYYKMFTLRNKTLYD 540

>Ecym_3027 Chr3 complement(52360..54009) [1650 bp, 549 aa] {ON}
           similar to Ashbya gossypii ACR004W
          Length = 549

 Score =  782 bits (2019), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/527 (67%), Positives = 431/527 (81%)

Query: 40  EAFFASPMYDFLTPFRPVGNQWCAKYVIVIFALIIRCAVGLGGYSGMNTPPMFGDFEAQR 99
           E+FFASP+YDFL P RPV NQW AKY+I+IFALI+R AVGLGGYSG    P+FGDFEAQR
Sbjct: 23  ESFFASPLYDFLYPLRPVANQWSAKYIILIFALIVRLAVGLGGYSGKGKGPLFGDFEAQR 82

Query: 100 HWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKLGSFFREGWFDLESSRGYESL 159
           HWMEIT  LP+  WY+YDL+YWGLDYPPLTAYHSY+LG+LGSF    WF L +SRG+ES+
Sbjct: 83  HWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRLGSFVNATWFKLNTSRGFESI 142

Query: 160 NLKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAILFQPALILVDHGH 219
           +LKS+MR TV++SEL+ YIPAV+YFT+W+G++R+QSPIGQY+A AAILFQP+LIL+DHGH
Sbjct: 143 DLKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVACAAILFQPSLILIDHGH 202

Query: 220 FQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMALYYSPIFFAYLLSKSTYSPG 279
           FQYNCVMLG+ VYT+NNLLD FY   AICFVLSL FKQMALYYSP+ FAYL S+S Y P 
Sbjct: 203 FQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYSPVIFAYLFSRSAYYPR 262

Query: 280 INLPRLFAISVSTALAFIGSFGPIYIFGGYKNLVQSMHRIFPFARGIFEDKVANFWCVSN 339
            N PR   I+++T L F   + P+ +FG ++N++QS++R+FPF+RGIFEDKVANFWCV+N
Sbjct: 263 FNFPRFAGIAIATLLTFGALYAPLCLFGDFRNIIQSVYRVFPFSRGIFEDKVANFWCVTN 322

Query: 340 IFIKYRNLFTQKDLQLYSLLATVIGLLPSFIITFLYPKRHLLPYALAACSMSFFLFSFQV 399
           + IKYR L+TQK LQ Y LL T I   P+FII FLYPK+ LLPYALAACSM+FFLFSFQV
Sbjct: 323 VIIKYRELYTQKQLQFYCLLTTAIAQFPAFIIIFLYPKKFLLPYALAACSMAFFLFSFQV 382

Query: 400 HEKXXXXXXXXXXXXYTSRDWNVLSLVCWINNVALFTLWPLLKKDNLVLQYGVMFMFSNW 459
           HEK            + S +W+VLS+V WINNVALFTLWPLLKKD L+LQY +MF+ SNW
Sbjct: 383 HEKTILVPLLPITLLHISTNWDVLSMVAWINNVALFTLWPLLKKDGLLLQYAIMFLLSNW 442

Query: 460 LIGNFSFVTPRFLPKFLTPGPSISDIDVDYRRASLLPKSLIWRLIIVGSYIAMGIIHFLD 519
           L+GNFSFVTP FLPKFLTPGPS+SD+  DYRR SLLPK++ WR+IIV SY+ M  IH LD
Sbjct: 443 LLGNFSFVTPTFLPKFLTPGPSVSDVADDYRRRSLLPKNIFWRIIIVSSYVCMAFIHLLD 502

Query: 520 YYVSPPSKYPDLWVLANCSLGFSCFVTFWIWNNYKLFEMRNSTLQDL 566
            YV PP  YPD+WVLA C+LGF+CF  FW+WN Y+L+ MRNS+L +L
Sbjct: 503 LYVQPPRNYPDIWVLATCALGFACFTAFWLWNYYQLYRMRNSSLNEL 549

>TDEL0G04470 Chr7 (810734..812362) [1629 bp, 542 aa] {ON} Anc_6.22
           YOR002W
          Length = 542

 Score =  781 bits (2018), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/547 (66%), Positives = 445/547 (81%), Gaps = 8/547 (1%)

Query: 21  PANAETTTSTAIMKKVESVEAFFASPMYDFLTPFRPVGNQWCAKYVIVIFALIIRCAVGL 80
           P N E   +T     VE  E+F+ASP+YDFL PFRP G+QW  +YVIV+FALII CAVG 
Sbjct: 3   PKNKEAKRNT-----VE--ESFYASPLYDFLYPFRPAGSQWLTEYVIVLFALIIGCAVGH 55

Query: 81  GGYSGMNTPPMFGDFEAQRHWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKLG 140
           G YSG  +PPMFGDFEAQRHWMEITQHL   +WYW+DL+YWGLDYPPLTAYHSY+LGK+G
Sbjct: 56  GSYSGQFSPPMFGDFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGKIG 115

Query: 141 SFFREGWFDLESSRGYESLNLKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQY 200
           SF +  WF+L  SRG E+ +LK++MRFTV++SE L YIPAV+YFTKW+GK+R +SPIGQ+
Sbjct: 116 SFIKPEWFELNESRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQF 175

Query: 201 IAAAAILFQPALILVDHGHFQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMAL 260
           I+AAAILFQP+L+L+DHGHFQYNCVMLG+TVY +N+L + FYA+ AICFVLS+CFKQMAL
Sbjct: 176 ISAAAILFQPSLMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMAL 235

Query: 261 YYSPIFFAYLLSKSTYSPGINLPRLFAISVSTALAFIGSFGPIYIF-GGYKNLVQSMHRI 319
           YY+PIFFAYLLSKS +SP  N PRLFAI+V+T L+F   + P+YIF GG  N++QS+HRI
Sbjct: 236 YYAPIFFAYLLSKSLFSPRFNFPRLFAIAVATVLSFAAMYAPLYIFGGGLANVIQSVHRI 295

Query: 320 FPFARGIFEDKVANFWCVSNIFIKYRNLFTQKDLQLYSLLATVIGLLPSFIITFLYPKRH 379
           FPFARGIFEDKVANFWCV+N+F KY+N+F Q+ LQLYSL+AT++G LP+ I+ FLYPK+H
Sbjct: 296 FPFARGIFEDKVANFWCVTNVFFKYKNIFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKH 355

Query: 380 LLPYALAACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSRDWNVLSLVCWINNVALFTLWP 439
           ++ YALA CSMSF+LFSFQVHEK            YTS +W+VLS+  WINNV LFTL+P
Sbjct: 356 IICYALATCSMSFYLFSFQVHEKTILVPLLPITLLYTSSNWDVLSMANWINNVGLFTLYP 415

Query: 440 LLKKDNLVLQYGVMFMFSNWLIGNFSFVTPRFLPKFLTPGPSISDIDVDYRRASLLPKSL 499
           LLKKD L LQY V F  SNWL+GNFSFVTP+FLPKFLTPGPS+S +D++YRR S LP ++
Sbjct: 416 LLKKDGLTLQYFVCFTLSNWLLGNFSFVTPKFLPKFLTPGPSVSSVDINYRRRSFLPSNV 475

Query: 500 IWRLIIVGSYIAMGIIHFLDYYVSPPSKYPDLWVLANCSLGFSCFVTFWIWNNYKLFEMR 559
           IW++IIV SY AMG++H +D+ + PP  YPDLWVL NC+LGF CF  FW+W+ Y LF M 
Sbjct: 476 IWKIIIVSSYTAMGVLHVVDFVMGPPVSYPDLWVLLNCALGFGCFTLFWLWSYYMLFTMP 535

Query: 560 NSTLQDL 566
             TLQ L
Sbjct: 536 RKTLQQL 542

>KAFR0A05070 Chr1 complement(1007657..1009351) [1695 bp, 564 aa]
           {ON} Anc_6.22 YOR002W
          Length = 564

 Score =  782 bits (2019), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/548 (66%), Positives = 438/548 (79%), Gaps = 3/548 (0%)

Query: 22  ANAETTTSTAIMKKVESVE-AFFASPMYDFLTPFRPVGNQWCAKYVIVIFALIIRCAVGL 80
           A +++    A     E++E  F+ASP+YDFL PFRP GNQW A+Y+IV FALIIRCA+GL
Sbjct: 17  AKSKSNPKKASKLNNEAIEEVFYASPLYDFLYPFRPAGNQWLAQYIIVTFALIIRCAIGL 76

Query: 81  GGYSGMNTPPMFGDFEAQRHWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKLG 140
           G YSGM   PMFGDFEAQRHWMEITQHLP+ +WYW+DLQYWGLDYPPLTAYHSY+LGK+G
Sbjct: 77  GSYSGMGHSPMFGDFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIG 136

Query: 141 SFFREGWFDLESSRGYESLNLKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQY 200
           SF    WF L  SRG E   +KSYMR TV+ISE + Y PA+IYF+KW GK+R+QSPIGQY
Sbjct: 137 SFIYPKWFTLNDSRGIEMEGIKSYMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQY 196

Query: 201 IAAAAILFQPALILVDHGHFQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMAL 260
           IAA AILFQP+L+L+DHGHFQYN VMLG+TVY +NNLLD FY++ ++CFVLS+CFKQM+L
Sbjct: 197 IAATAILFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSL 256

Query: 261 YYSPIFFAYLLSKSTYSPGI-NLPRLFAISVSTALAFIGSFGPIYIF-GGYKNLVQSMHR 318
           YY+PIFF YLLSKS + P + N+PRL  I+  T + F+  + P+YIF GG +NL+QS+HR
Sbjct: 257 YYAPIFFGYLLSKSLFFPRLFNIPRLVGIAAVTIVTFVAMYSPLYIFGGGLENLIQSVHR 316

Query: 319 IFPFARGIFEDKVANFWCVSNIFIKYRNLFTQKDLQLYSLLATVIGLLPSFIITFLYPKR 378
           IFPFARGIFEDKVANFWCV+NI IKY+  FTQ  LQLYSL ATV+G LP+ +I  LYPK+
Sbjct: 317 IFPFARGIFEDKVANFWCVTNILIKYKIKFTQDQLQLYSLAATVLGFLPALVIIVLYPKK 376

Query: 379 HLLPYALAACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSRDWNVLSLVCWINNVALFTLW 438
           HLLPYALAACSMSFFLFSFQVHEK            YTS DWNVLS+VCWINNVALFTLW
Sbjct: 377 HLLPYALAACSMSFFLFSFQVHEKTILVPLLPITLLYTSTDWNVLSMVCWINNVALFTLW 436

Query: 439 PLLKKDNLVLQYGVMFMFSNWLIGNFSFVTPRFLPKFLTPGPSISDIDVDYRRASLLPKS 498
           PLLKKD L+LQY V F  SNWL+GNFSFVTP+FLPK LTPGPSIS I  +Y R SLLP +
Sbjct: 437 PLLKKDGLILQYAVCFALSNWLLGNFSFVTPKFLPKMLTPGPSISAIHENYHRRSLLPHN 496

Query: 499 LIWRLIIVGSYIAMGIIHFLDYYVSPPSKYPDLWVLANCSLGFSCFVTFWIWNNYKLFEM 558
           ++W+++IV SY++M + H+LD++V PP+ YPD+W+  NC +GF  FV FW+W  Y LF +
Sbjct: 497 ILWKVVIVSSYLSMAVFHYLDFFVEPPTNYPDIWITLNCVIGFGSFVFFWMWTYYMLFTL 556

Query: 559 RNSTLQDL 566
           RN TL DL
Sbjct: 557 RNKTLMDL 564

>Kwal_56.22437 s56 complement(127493..129103) [1611 bp, 536 aa] {ON}
           YOR002W (ALG6) - glucosyltransferase [contig 185] FULL
          Length = 536

 Score =  780 bits (2014), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/532 (68%), Positives = 432/532 (81%)

Query: 34  KKVESVEAFFASPMYDFLTPFRPVGNQWCAKYVIVIFALIIRCAVGLGGYSGMNTPPMFG 93
           KKV   E FFASP+YDFL+PFRPV NQ+ A+YVIVIFAL+IRCAVGLG +SG N+ P+ G
Sbjct: 4   KKVSKNEPFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGENSGPIHG 63

Query: 94  DFEAQRHWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKLGSFFREGWFDLESS 153
           DFEAQRHWME+T HLP+ +WYWYDLQYWGLDYPPLTAYHSY+LGKLGS     WF L SS
Sbjct: 64  DFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKLGSLLNSEWFALLSS 123

Query: 154 RGYESLNLKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAILFQPALI 213
           RG E+ ++K+YMRFTVI+SE  LYIPAV+YFTKW G  R QSPIGQYIAAAAILFQP+LI
Sbjct: 124 RGIENPDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSLI 183

Query: 214 LVDHGHFQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMALYYSPIFFAYLLSK 273
           L+DHGHFQYN VMLG+TVY++NNLLDG+Y   AICFVLSLCFKQMALYYSP+FFAYLLS+
Sbjct: 184 LIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFFAYLLSE 243

Query: 274 STYSPGINLPRLFAISVSTALAFIGSFGPIYIFGGYKNLVQSMHRIFPFARGIFEDKVAN 333
              SP +N+PR  +++ ST ++F   F P+Y+FGG KN++QS+HRIFPF+RGIFEDKVAN
Sbjct: 244 CLISPSLNVPRFLSVAFSTVISFCIIFSPLYVFGGTKNVLQSIHRIFPFSRGIFEDKVAN 303

Query: 334 FWCVSNIFIKYRNLFTQKDLQLYSLLATVIGLLPSFIITFLYPKRHLLPYALAACSMSFF 393
           FWCVSN+  KY   +TQ++LQ +S++AT  G LPSF++   YPK+H++P+ALAACSM+FF
Sbjct: 304 FWCVSNVLFKYAQNYTQQELQRFSIIATAAGFLPSFLVVLCYPKKHMIPFALAACSMAFF 363

Query: 394 LFSFQVHEKXXXXXXXXXXXXYTSRDWNVLSLVCWINNVALFTLWPLLKKDNLVLQYGVM 453
           LFSFQVHEK            Y S DWNVLS+V WINNVALFTLWPLLKKD+L LQYG++
Sbjct: 364 LFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKDHLTLQYGIL 423

Query: 454 FMFSNWLIGNFSFVTPRFLPKFLTPGPSISDIDVDYRRASLLPKSLIWRLIIVGSYIAMG 513
            + SNWLIGNFSFVTPRFLPKF+TPGPSIS +   YRR S LP +  W+LIIV SY+ M 
Sbjct: 424 MLLSNWLIGNFSFVTPRFLPKFITPGPSISVVSETYRRRSFLPDNNFWKLIIVASYLIMA 483

Query: 514 IIHFLDYYVSPPSKYPDLWVLANCSLGFSCFVTFWIWNNYKLFEMRNSTLQD 565
            IH LD++V  P   PDLWVL NC+LGF CF  FW+W +YKLF MRN+ LQD
Sbjct: 484 AIHILDFFVPTPEGLPDLWVLLNCALGFFCFTIFWLWMHYKLFTMRNTNLQD 535

>Kpol_1037.27 s1037 complement(65544..67184) [1641 bp, 546 aa] {ON}
           complement(65544..67184) [1641 nt, 547 aa]
          Length = 546

 Score =  778 bits (2010), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/547 (67%), Positives = 439/547 (80%), Gaps = 6/547 (1%)

Query: 24  AETTTSTAIMKKVESVEAFFASPMYDFLTPFRPVGNQWCAKYVIVIFALIIRCAVGLGGY 83
           A     + I K VE  E+FFASP+YDFL+PFRPV NQW  +Y+IVIFALI+RCA+GLG Y
Sbjct: 2   ASKKKISRINKPVE--ESFFASPLYDFLSPFRPVSNQWLTEYIIVIFALIVRCAIGLGSY 59

Query: 84  SGMNTPPMFGDFEAQRHWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKLGSFF 143
           SGM  PPMFGDFEAQRHWMEITQHLP+ +WY++DL+YWGLDYPPLTAYHSY+LG +GSF 
Sbjct: 60  SGMGNPPMFGDFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFL 119

Query: 144 REGWFDLESSRGYESLN--LKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQYI 201
            + WF L  SRGYES N  LK+YMR TVIISE++ YIP VIYFTKWVG++R QS IGQYI
Sbjct: 120 NKSWFALNDSRGYESENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYI 179

Query: 202 AAAAILFQPALILVDHGHFQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMALY 261
           AAAAILFQP+L+L+DHGHFQYN VMLG+TVY +NNLLD FYA  A+CFVLS+CFKQMALY
Sbjct: 180 AAAAILFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALY 239

Query: 262 YSPIFFAYLLSKSTYSPGI-NLPRLFAISVSTALAFIGSFGPIYIFGG-YKNLVQSMHRI 319
           Y+PIFF YLL +S +S    N+ R  +I++ST  AF   + P+Y+FGG  +N++QS+HRI
Sbjct: 240 YAPIFFGYLLGRSLFSRKFFNISRFLSIAISTVFAFFSMYAPLYVFGGGLRNVIQSVHRI 299

Query: 320 FPFARGIFEDKVANFWCVSNIFIKYRNLFTQKDLQLYSLLATVIGLLPSFIITFLYPKRH 379
           FPFARG+FEDKVANFWCV+NIFIKY+ L+TQK+LQLYSL+ATV+G LP+ +    YPK+H
Sbjct: 300 FPFARGLFEDKVANFWCVTNIFIKYKILYTQKELQLYSLIATVVGFLPAVVTILFYPKKH 359

Query: 380 LLPYALAACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSRDWNVLSLVCWINNVALFTLWP 439
           LLPYALAACSMSF+LFSFQVHEK            YTS DWNVLS V W+NNV LFTLWP
Sbjct: 360 LLPYALAACSMSFYLFSFQVHEKTILVPLLPITLLYTSTDWNVLSFVSWVNNVGLFTLWP 419

Query: 440 LLKKDNLVLQYGVMFMFSNWLIGNFSFVTPRFLPKFLTPGPSISDIDVDYRRASLLPKSL 499
           LLKKD L LQYGV F  SNWLIGNFSF+TP+FLPK LTPGP + + +  Y R SLLP ++
Sbjct: 420 LLKKDGLTLQYGVCFFLSNWLIGNFSFITPKFLPKMLTPGPPVQNTEDTYHRRSLLPHNI 479

Query: 500 IWRLIIVGSYIAMGIIHFLDYYVSPPSKYPDLWVLANCSLGFSCFVTFWIWNNYKLFEMR 559
           +W++IIV SYI M +IH  + +VSPP +YPD+WVL NC LGF CFV FW+WN YK+F + 
Sbjct: 480 LWKIIIVSSYIVMLLIHLGEIFVSPPPEYPDIWVLMNCCLGFGCFVLFWLWNYYKIFTLA 539

Query: 560 NSTLQDL 566
           N TLQ L
Sbjct: 540 NKTLQYL 546

>TBLA0G00970 Chr7 (246516..248195) [1680 bp, 559 aa] {ON} Anc_6.22
           YOR002W
          Length = 559

 Score =  775 bits (2000), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/542 (69%), Positives = 439/542 (80%), Gaps = 15/542 (2%)

Query: 40  EAFFASPMYDFLTPFRPVGNQWCAKYVIVIFALIIRCAVGLGGYSGMNTPPMFGDFEAQR 99
           EAF+ASP++DFL PFRPVG+QW  +YVI+IFA+IIRCA+ LG YSG  TPPMFGDFEAQR
Sbjct: 18  EAFYASPLFDFLYPFRPVGSQWLTEYVIIIFAIIIRCAISLGSYSGKGTPPMFGDFEAQR 77

Query: 100 HWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKLGSFFREGWFDLESSRGYESL 159
           HWMEITQHLP+ +WYW+DLQYWGLDYPP TAYHSY  GKLGSFF   WF L SSRGYES 
Sbjct: 78  HWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSSRGYESD 137

Query: 160 N--LKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAILFQPALILVDH 217
           +  LK+YMRFTVI+SE + YIPAV+YFTKW+GK+R+QSPIGQ+IAAAAILFQP+L+L+DH
Sbjct: 138 DNGLKTYMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQPSLMLIDH 197

Query: 218 GHFQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMALYYSPIFFAYLLSKSTYS 277
           GHFQYN VMLG+TVY +NNLLD FY   AICFVLSLCFKQMALYYSPIFF YLLSKS   
Sbjct: 198 GHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGYLLSKSLVH 257

Query: 278 PGINLPRLFAISVSTALAFIGSFGPIYIFG-------------GYKNLVQSMHRIFPFAR 324
           P  N+ R   +++ST ++F+  FGPIY+FG             G  NL+Q + RIFPFAR
Sbjct: 258 PSCNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCIRRIFPFAR 317

Query: 325 GIFEDKVANFWCVSNIFIKYRNLFTQKDLQLYSLLATVIGLLPSFIITFLYPKRHLLPYA 384
           GIFEDKVANFWCV+N+ IKYR LFTQ+ LQ YSL+AT+IG LPS I  FLYP++ L+PYA
Sbjct: 318 GIFEDKVANFWCVTNVVIKYRELFTQEQLQFYSLVATLIGFLPSMITIFLYPRKFLIPYA 377

Query: 385 LAACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSRDWNVLSLVCWINNVALFTLWPLLKKD 444
           LAACSMSFFLFSFQVHEK            YTS DWNVLSLVCWINNVALFTLWPLL+KD
Sbjct: 378 LAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLLRKD 437

Query: 445 NLVLQYGVMFMFSNWLIGNFSFVTPRFLPKFLTPGPSISDIDVDYRRASLLPKSLIWRLI 504
            LVLQY V +  SNWLIGNFSF+TP+FLP FLTPGPSIS+ID DYRR SLLP +++W++I
Sbjct: 438 GLVLQYFVCYFLSNWLIGNFSFITPKFLPSFLTPGPSISNIDDDYRRGSLLPHNILWKII 497

Query: 505 IVGSYIAMGIIHFLDYYVSPPSKYPDLWVLANCSLGFSCFVTFWIWNNYKLFEMRNSTLQ 564
           I+ SYI MG +  LD +  PP+ YPDLW++ NC++GF CF+ FW+WNNYK+ +MRN TL 
Sbjct: 498 IISSYIVMGAVQILDLFFQPPTNYPDLWIILNCTVGFGCFMLFWLWNNYKIIQMRNKTLN 557

Query: 565 DL 566
           DL
Sbjct: 558 DL 559

>KLTH0C11176g Chr3 (917419..919029) [1611 bp, 536 aa] {ON} similar
           to uniprot|Q12001 Saccharomyces cerevisiae YOR002W ALG6
           Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 536

 Score =  773 bits (1997), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/533 (67%), Positives = 427/533 (80%)

Query: 34  KKVESVEAFFASPMYDFLTPFRPVGNQWCAKYVIVIFALIIRCAVGLGGYSGMNTPPMFG 93
           +K    E+FFASP+YDFL+PFRPV NQ+ A+YVIVIFAL+IRCAVGLG +SG  T PM G
Sbjct: 4   RKSLPKESFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGEATVPMHG 63

Query: 94  DFEAQRHWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKLGSFFREGWFDLESS 153
           DFEAQRHWME+T +LP+ +WYW+DLQYWGLDYPPLTAYHSY LGKLGS     WF L SS
Sbjct: 64  DFEAQRHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKLGSVLNPEWFALGSS 123

Query: 154 RGYESLNLKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAILFQPALI 213
           RG E+  LK+YMRFTVI+SE  LYIPAV+YFTKW G  R QSPIGQYIAAAAILFQP+LI
Sbjct: 124 RGNETPELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSLI 183

Query: 214 LVDHGHFQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMALYYSPIFFAYLLSK 273
           L+DHGHFQYN VMLG+TVY +NNLLDGF+   AICF+LSLCFKQMAL+YSPIFFAYLLS+
Sbjct: 184 LIDHGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLLSR 243

Query: 274 STYSPGINLPRLFAISVSTALAFIGSFGPIYIFGGYKNLVQSMHRIFPFARGIFEDKVAN 333
           S +SP     R  ++++ST + F   F P+Y+FGG KN++QS+HRIFPF+RGIFEDKVAN
Sbjct: 244 SLFSPSFKFSRFMSVALSTVITFCLMFSPLYVFGGMKNVLQSIHRIFPFSRGIFEDKVAN 303

Query: 334 FWCVSNIFIKYRNLFTQKDLQLYSLLATVIGLLPSFIITFLYPKRHLLPYALAACSMSFF 393
           FWCVSN+ +KY + FTQ  LQ  S  AT  G LPSF +  LYPK+H++PY LAACSM+FF
Sbjct: 304 FWCVSNVIVKYADNFTQDQLQKLSTFATAAGFLPSFALVVLYPKKHMIPYGLAACSMAFF 363

Query: 394 LFSFQVHEKXXXXXXXXXXXXYTSRDWNVLSLVCWINNVALFTLWPLLKKDNLVLQYGVM 453
           LF FQVHEK            + S DWNVL++V WINNVALFTLWPLLKKD L LQYG+M
Sbjct: 364 LFGFQVHEKSILVPLLPISLLFCSTDWNVLAIVSWINNVALFTLWPLLKKDKLALQYGIM 423

Query: 454 FMFSNWLIGNFSFVTPRFLPKFLTPGPSISDIDVDYRRASLLPKSLIWRLIIVGSYIAMG 513
            + SNWLIGNFSFVTPRFLP F+TPGPS+S++   YRR S LP +++W+++I+ SYI M 
Sbjct: 424 MLLSNWLIGNFSFVTPRFLPGFITPGPSMSNVAETYRRRSFLPNNIVWKILIITSYIVMA 483

Query: 514 IIHFLDYYVSPPSKYPDLWVLANCSLGFSCFVTFWIWNNYKLFEMRNSTLQDL 566
           +IH LD +V PP+K PDLWVL NC+LGF+CF  FW+WNNYKLF MRN ++ DL
Sbjct: 484 VIHILDLFVQPPAKLPDLWVLMNCALGFTCFSVFWLWNNYKLFTMRNKSILDL 536

>YOR002W Chr15 (329417..331051) [1635 bp, 544 aa] {ON}  ALG6Alpha
           1,3 glucosyltransferase, involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation; mutations in human ortholog are
           associated with disease
          Length = 544

 Score =  768 bits (1984), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/530 (68%), Positives = 433/530 (81%), Gaps = 3/530 (0%)

Query: 40  EAFFASPMYDFLTPFRPVGNQWCAKYVIVIFALIIRCAVGLGGYSGMNTPPMFGDFEAQR 99
           E+F+ASPMYDFL PFRPVGNQW  +Y+I + A+I+RC +GLG YSG  +PP++GDFEAQR
Sbjct: 15  ESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVILRCTIGLGPYSGKGSPPLYGDFEAQR 74

Query: 100 HWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKLGSFFREGWFDLESSRGYESL 159
           HWMEITQHLP+ +WYWYDLQYWGLDYPPLTA+HSYLLG +GSFF   WF LE SRG+ES 
Sbjct: 75  HWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALEKSRGFESP 134

Query: 160 N--LKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAILFQPALILVDH 217
           +  LK+YMR TVIIS++L Y PAVIYFTKW+G+YR+QSPIGQ IAA+AILFQP+L+L+DH
Sbjct: 135 DNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAILFQPSLMLIDH 194

Query: 218 GHFQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMALYYSPIFFAYLLSKSTYS 277
           GHFQYN VMLG+T Y +NNLLD +YAM A+CFVLS+CFKQMALYY+PIFFAYLLS+S   
Sbjct: 195 GHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYLLSRSLLF 254

Query: 278 PGINLPRLFAISVSTALAFIGSFGPIYIFGG-YKNLVQSMHRIFPFARGIFEDKVANFWC 336
           P  N+ RL  I+ +T   F   F P+Y  GG  KN+ Q +HRIFPFARGIFEDKVANFWC
Sbjct: 255 PKFNIARLTVIAFATLATFAIIFAPLYFLGGGLKNIHQCIHRIFPFARGIFEDKVANFWC 314

Query: 337 VSNIFIKYRNLFTQKDLQLYSLLATVIGLLPSFIITFLYPKRHLLPYALAACSMSFFLFS 396
           V+N+F+KY+  FT + LQLYSL+ATVIG LP+ I+T L+PK+HLLPY L ACSMSFFLFS
Sbjct: 315 VTNVFVKYKERFTIQQLQLYSLIATVIGFLPAMIMTLLHPKKHLLPYVLIACSMSFFLFS 374

Query: 397 FQVHEKXXXXXXXXXXXXYTSRDWNVLSLVCWINNVALFTLWPLLKKDNLVLQYGVMFMF 456
           FQVHEK            Y+S DWNVLSLV WINNVALFTLWPLLKKD L LQY V F+ 
Sbjct: 375 FQVHEKTILIPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQYAVSFLL 434

Query: 457 SNWLIGNFSFVTPRFLPKFLTPGPSISDIDVDYRRASLLPKSLIWRLIIVGSYIAMGIIH 516
           SNWLIGNFSF+TPRFLPK LTPGPSIS I+ DYRR SLLP +++W+  I+G+YIAMG  H
Sbjct: 435 SNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYIAMGFYH 494

Query: 517 FLDYYVSPPSKYPDLWVLANCSLGFSCFVTFWIWNNYKLFEMRNSTLQDL 566
           FLD +V+PPSKYPDLWVL NC++GF CF  FW+W+ YK+F   + +++DL
Sbjct: 495 FLDQFVAPPSKYPDLWVLLNCAVGFICFSIFWLWSYYKIFTSGSKSMKDL 544

>Suva_15.177 Chr15 (303845..305479) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  767 bits (1980), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/530 (67%), Positives = 434/530 (81%), Gaps = 3/530 (0%)

Query: 40  EAFFASPMYDFLTPFRPVGNQWCAKYVIVIFALIIRCAVGLGGYSGMNTPPMFGDFEAQR 99
           E+F+ASPMYDFL PFRPVGNQW  +Y+I + A+I+RCA+GLG YSG  TPP+ GDFEAQR
Sbjct: 15  ESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSGKATPPLHGDFEAQR 74

Query: 100 HWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKLGSFFREGWFDLESSRGYESL 159
           HWMEITQHLP+ +WYWYDLQYWGLDYPPLTA+HSYLLG +G+FF   WF L+ SRG+ES 
Sbjct: 75  HWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGTFFNPSWFALDKSRGFESP 134

Query: 160 N--LKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAILFQPALILVDH 217
           +  LK+YMR TVIIS++L Y PAVIYFTKW+G+YR+QSPIGQ IAAAAILFQP+L+L+DH
Sbjct: 135 DNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILFQPSLMLIDH 194

Query: 218 GHFQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMALYYSPIFFAYLLSKSTYS 277
           GHFQYN VMLG+T Y +NNLLD +YAM A+CFVLS+CFKQMALYY+PIFFAYLLS+S + 
Sbjct: 195 GHFQYNSVMLGLTAYAINNLLDEYYAMAAMCFVLSICFKQMALYYAPIFFAYLLSRSLFF 254

Query: 278 PGINLPRLFAISVSTALAFIGSFGPIYIFGG-YKNLVQSMHRIFPFARGIFEDKVANFWC 336
           P  N+ RL  I+ +T   F   F P+Y  GG  +N+ Q +HR+FPFARGIFEDKVANFWC
Sbjct: 255 PKFNIARLTVIAFATLATFSLMFAPLYFLGGGLRNIYQCIHRMFPFARGIFEDKVANFWC 314

Query: 337 VSNIFIKYRNLFTQKDLQLYSLLATVIGLLPSFIITFLYPKRHLLPYALAACSMSFFLFS 396
           VSNIF+KY+  F+ + LQLYSL+ATV+G LP+ ++T L+PK+HLLPY L ACSMSFFLFS
Sbjct: 315 VSNIFVKYKERFSIQQLQLYSLVATVLGFLPAMMMTLLHPKKHLLPYVLIACSMSFFLFS 374

Query: 397 FQVHEKXXXXXXXXXXXXYTSRDWNVLSLVCWINNVALFTLWPLLKKDNLVLQYGVMFMF 456
           FQVHEK            Y+S DWNVLSLV WINNVALFTLWPLLKKD L LQY V F+ 
Sbjct: 375 FQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQYVVSFLL 434

Query: 457 SNWLIGNFSFVTPRFLPKFLTPGPSISDIDVDYRRASLLPKSLIWRLIIVGSYIAMGIIH 516
           +NWLIGNFSF+TPRFLPK LTPGPSIS I+ DYRR SLLP +++W+  I+G+YIAMG+ H
Sbjct: 435 TNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYIAMGLYH 494

Query: 517 FLDYYVSPPSKYPDLWVLANCSLGFSCFVTFWIWNNYKLFEMRNSTLQDL 566
           FLD +V+PP KYPDLWVL NC++GF CF  FWIW+ YK+F   N +++DL
Sbjct: 495 FLDLFVAPPKKYPDLWVLLNCAVGFICFSIFWIWSYYKIFTSGNKSMKDL 544

>KNAG0F02890 Chr6 complement(547204..548895) [1692 bp, 563 aa] {ON}
           Anc_6.22 YOR002W
          Length = 563

 Score =  767 bits (1981), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/566 (63%), Positives = 445/566 (78%), Gaps = 10/566 (1%)

Query: 4   KKKQTPKNAVKKT--VSSLPANAETTTSTAIMKKVESVEAFFASPMYDFLTPFRPVGNQW 61
           KK+   ++A  KT  +S L  N +           E  E F+ASP+YDFL PFR  G+QW
Sbjct: 5   KKEPQGEDASSKTKSLSKLQRNKDEAAP-------EVEECFYASPIYDFLYPFRSPGSQW 57

Query: 62  CAKYVIVIFALIIRCAVGLGGYSGMNTPPMFGDFEAQRHWMEITQHLPVREWYWYDLQYW 121
             +Y+IV+F LII+ A+GLG YSG  TPPMFGDFEAQRHWMEITQHLPV +WYW+DLQYW
Sbjct: 58  VTEYIIVVFLLIIKSAIGLGSYSGFQTPPMFGDFEAQRHWMEITQHLPVSQWYWFDLQYW 117

Query: 122 GLDYPPLTAYHSYLLGKLGSFFREGWFDLESSRGYESLNLKSYMRFTVIISELLLYIPAV 181
           GLDYPP TAYHSYLLGK+G+F    WF+L++SRG E+  +KSYMRFTV++SE + YIPA+
Sbjct: 118 GLDYPPFTAYHSYLLGKIGTFIYPPWFELDASRGMETDGIKSYMRFTVLLSECIFYIPAI 177

Query: 182 IYFTKWVGKYRSQSPIGQYIAAAAILFQPALILVDHGHFQYNCVMLGMTVYTLNNLLDGF 241
           +YFTKWVG+ + QSPIGQ++AAAAILFQP L+L+DHGHFQYNCVMLG+TVY +NNLLDGF
Sbjct: 178 VYFTKWVGRRKKQSPIGQFVAAAAILFQPTLMLIDHGHFQYNCVMLGLTVYAINNLLDGF 237

Query: 242 YAMGAICFVLSLCFKQMALYYSPIFFAYLLSKSTYSPGI-NLPRLFAISVSTALAFIGSF 300
           YAM A+CFVLS+CFKQMALYY+PIFFA LLSKS + P + N+PR  +++ +T  +    F
Sbjct: 238 YAMAAVCFVLSICFKQMALYYAPIFFAVLLSKSLFFPRLFNIPRFLSVAFATLASLFVMF 297

Query: 301 GPIYIFGGYKNLVQSMHRIFPFARGIFEDKVANFWCVSNIFIKYRNLFTQKDLQLYSLLA 360
            P+YIFGG  N++QS+HRIFPFARGIFEDKVANFWCV+N+F KY+ +FTQ +LQ YSL+A
Sbjct: 298 APLYIFGGVGNVLQSIHRIFPFARGIFEDKVANFWCVTNVFFKYKTMFTQSELQFYSLVA 357

Query: 361 TVIGLLPSFIITFLYPKRHLLPYALAACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSRDW 420
           TV+G  P+F+I   YPK+ L+PY LAACSM+FFLFSFQVHEK            +TS +W
Sbjct: 358 TVVGFFPAFMIMIFYPKKFLIPYGLAACSMAFFLFSFQVHEKTILVPLLPATLLFTSTNW 417

Query: 421 NVLSLVCWINNVALFTLWPLLKKDNLVLQYGVMFMFSNWLIGNFSFVTPRFLPKFLTPGP 480
           N LS+V W+NNVALFTLWPLLKKD L LQY V  +  NWL+GNFSF+TPRFLPK LTPGP
Sbjct: 418 NNLSMVFWVNNVALFTLWPLLKKDGLWLQYCVCLVMYNWLLGNFSFITPRFLPKILTPGP 477

Query: 481 SISDIDVDYRRASLLPKSLIWRLIIVGSYIAMGIIHFLDYYVSPPSKYPDLWVLANCSLG 540
           SIS+I  +YRR SLLP ++IW++II+ SY+ M +IH L+Y ++ PS+YPDLWV  NC++G
Sbjct: 478 SISNIAENYRRRSLLPHNIIWKIIILVSYLCMLMIHVLEYTIAAPSQYPDLWVQLNCTVG 537

Query: 541 FSCFVTFWIWNNYKLFEMRNSTLQDL 566
           F CFV FW+W  YKL  +RN T+Q+L
Sbjct: 538 FGCFVLFWMWTYYKLITLRNKTIQEL 563

>Smik_15.171 Chr15 (296715..298349) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  766 bits (1978), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/530 (67%), Positives = 433/530 (81%), Gaps = 3/530 (0%)

Query: 40  EAFFASPMYDFLTPFRPVGNQWCAKYVIVIFALIIRCAVGLGGYSGMNTPPMFGDFEAQR 99
           E+F+ASPMYDFL PFRPVGNQW  +Y+I + A+I+RC +GLG YSG  +PP+ GDFEAQR
Sbjct: 15  ESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCTIGLGPYSGKGSPPLHGDFEAQR 74

Query: 100 HWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKLGSFFREGWFDLESSRGYESL 159
           HWMEITQHLP+ +WYWYDLQYWGLDYPPLTA+HSYLLG +GSFF   WF L+ SRG+ES 
Sbjct: 75  HWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALDKSRGFESP 134

Query: 160 N--LKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAILFQPALILVDH 217
           +  LK+YMR TVIIS++L Y PAVIYFTKW+G+YR+QSPIGQ IAA+AILFQP+L+L+DH
Sbjct: 135 DNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAILFQPSLMLIDH 194

Query: 218 GHFQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMALYYSPIFFAYLLSKSTYS 277
           GHFQYN VMLG+T Y +NNLLD +YAM A+CFVLS+CFKQMALYY+PIFFAYLLS+S   
Sbjct: 195 GHFQYNSVMLGLTAYAINNLLDEYYAMAAMCFVLSICFKQMALYYAPIFFAYLLSRSLLF 254

Query: 278 PGINLPRLFAISVSTALAFIGSFGPIYIFGG-YKNLVQSMHRIFPFARGIFEDKVANFWC 336
           P  N+ RL  IS +T   F     P+Y  GG  KN+ Q +HRIFPFARGIFEDKVANFWC
Sbjct: 255 PKFNIARLTVISFATLATFALMLAPLYFLGGGLKNIYQCIHRIFPFARGIFEDKVANFWC 314

Query: 337 VSNIFIKYRNLFTQKDLQLYSLLATVIGLLPSFIITFLYPKRHLLPYALAACSMSFFLFS 396
           V+N+F+KY+  F+ + LQLYSL+ATVIG LP+ ++T L+PK+HLLPY L ACSMSFFLFS
Sbjct: 315 VTNVFVKYKERFSVQQLQLYSLVATVIGFLPAMVMTLLHPKKHLLPYVLIACSMSFFLFS 374

Query: 397 FQVHEKXXXXXXXXXXXXYTSRDWNVLSLVCWINNVALFTLWPLLKKDNLVLQYGVMFMF 456
           FQVHEK            Y+S DWNVLSLV WINNVALFTLWPLLK+D L LQY V F+ 
Sbjct: 375 FQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKRDGLHLQYAVSFLL 434

Query: 457 SNWLIGNFSFVTPRFLPKFLTPGPSISDIDVDYRRASLLPKSLIWRLIIVGSYIAMGIIH 516
           SNWLIGNFSF+TPRFLPK LTPGPSIS I+ DYRR SLLP +++W+  I+G+YIAMG+ H
Sbjct: 435 SNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYIAMGLYH 494

Query: 517 FLDYYVSPPSKYPDLWVLANCSLGFSCFVTFWIWNNYKLFEMRNSTLQDL 566
           FLD +V+PPSKYPDLWVL NC++GF+CF  FW+W+ YK+F   + +++DL
Sbjct: 495 FLDLFVAPPSKYPDLWVLLNCTVGFTCFSIFWVWSYYKIFTSGSKSMKDL 544

>ACR004W Chr3 (360904..362595) [1692 bp, 563 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR002W (ALG6)
          Length = 563

 Score =  765 bits (1976), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/533 (66%), Positives = 424/533 (79%)

Query: 34  KKVESVEAFFASPMYDFLTPFRPVGNQWCAKYVIVIFALIIRCAVGLGGYSGMNTPPMFG 93
           KK    EAFFASP+YDFL P RPV NQW AKY+IVIFALIIR AVGLGGYSGM  PPMFG
Sbjct: 31  KKPGLKEAFFASPLYDFLYPLRPVTNQWAAKYIIVIFALIIRLAVGLGGYSGMGKPPMFG 90

Query: 94  DFEAQRHWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKLGSFFREGWFDLESS 153
           DFEAQRHWME+TQH+PV +WY++ LQYWGLDYPPLTAYHSYLLGKLGS+    WF L +S
Sbjct: 91  DFEAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLGSYISPEWFSLHAS 150

Query: 154 RGYESLNLKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAILFQPALI 213
           RGYES +LKSYMR TVI+SEL  YIPAV+YFT+W+G+ R QSPIGQYIA AAILFQPALI
Sbjct: 151 RGYESEDLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAGAAILFQPALI 210

Query: 214 LVDHGHFQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMALYYSPIFFAYLLSK 273
           L+DHGHFQYNCVMLG+TV  +NNLLD +YA+ A+ FV SL FKQMALYY+P+ F YLLS+
Sbjct: 211 LIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYYAPVMFVYLLSR 270

Query: 274 STYSPGINLPRLFAISVSTALAFIGSFGPIYIFGGYKNLVQSMHRIFPFARGIFEDKVAN 333
           S Y P +N+PR  A++V+T +AF   + P+Y+ G    + QS+HR+FPF RG+FEDKVAN
Sbjct: 271 SIYYPRLNIPRFVAVAVATLIAFGVLYAPLYLLGNISAIFQSIHRVFPFERGLFEDKVAN 330

Query: 334 FWCVSNIFIKYRNLFTQKDLQLYSLLATVIGLLPSFIITFLYPKRHLLPYALAACSMSFF 393
           FWCV+N+ +KY+  +T   L+ +SL+ T   +LPS IITFLYPK+ +LPYALAACSMSFF
Sbjct: 331 FWCVTNVLVKYKTKYTTSQLKFFSLVLTSAAMLPSLIITFLYPKKFMLPYALAACSMSFF 390

Query: 394 LFSFQVHEKXXXXXXXXXXXXYTSRDWNVLSLVCWINNVALFTLWPLLKKDNLVLQYGVM 453
           LF FQVHEK            YTS DWNVLS+V WINN+ALFTLWPLLKKD L LQY +M
Sbjct: 391 LFGFQVHEKTILVPLLPITLLYTSTDWNVLSMVAWINNIALFTLWPLLKKDGLSLQYAIM 450

Query: 454 FMFSNWLIGNFSFVTPRFLPKFLTPGPSISDIDVDYRRASLLPKSLIWRLIIVGSYIAMG 513
           F+ SNWLIGNFSF+TP FLPK LTPGPS+SD+   YRR SLLP ++IWR+IIV SYI +G
Sbjct: 451 FLLSNWLIGNFSFITPTFLPKVLTPGPSVSDVADGYRRRSLLPSNIIWRIIIVVSYICVG 510

Query: 514 IIHFLDYYVSPPSKYPDLWVLANCSLGFSCFVTFWIWNNYKLFEMRNSTLQDL 566
            IH  + +  P  + PD+WVLANC +G S F  FW+WNNYK+F MRNST+ DL
Sbjct: 511 AIHIAELWYPPSQRLPDIWVLANCLVGCSSFALFWMWNNYKMFAMRNSTISDL 563

>NDAI0C02630 Chr3 (609993..611735) [1743 bp, 580 aa] {ON} Anc_6.22
           YOR002W
          Length = 580

 Score =  765 bits (1975), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/577 (64%), Positives = 443/577 (76%), Gaps = 14/577 (2%)

Query: 4   KKKQTPKNAVKKTVSSLPANAETTTSTAIMKKVE---------SVEAFFASPMYDFLTPF 54
           KKK   KN    TV+S  +       T   KK+          S E+F+ASP+YDFL PF
Sbjct: 4   KKKTLMKNGSTSTVTSSSSQKSKVEDTKKSKKMNNNQPLETETSKESFYASPLYDFLYPF 63

Query: 55  RPVGNQWCAKYVIVIFALIIRCAVGLGGYSGMNTPPMFGDFEAQRHWMEITQHLPVREWY 114
           RP G+QW  +Y+IV+FA+IIRCAVGLG YSG NTPPMFGDFEAQRHWMEITQ+LP+ +WY
Sbjct: 64  RPAGSQWMTEYIIVLFAIIIRCAVGLGPYSGFNTPPMFGDFEAQRHWMEITQYLPISQWY 123

Query: 115 WYDLQYWGLDYPPLTAYHSYLLGKLGSFFREGWFDLESSRGYESLNLKSYMRFTVIISEL 174
           W+DLQYWGLDYPPLTA+HSYL GK+GSFF+  WF L  SRGYE  +LK++MR TV+ SE 
Sbjct: 124 WFDLQYWGLDYPPLTAFHSYLCGKIGSFFQPNWFTLGDSRGYEGQDLKTFMRLTVLASES 183

Query: 175 LLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAILFQPALILVDHGHFQYNCVMLGMTVYTL 234
           L YIPAV+YFTKW+GK R+QSPIGQ+IA AAILFQP+LIL+DHGHFQ+N VMLG+TVYTL
Sbjct: 184 LCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAILFQPSLILIDHGHFQFNSVMLGLTVYTL 243

Query: 235 NNLLDGFYAMGAICFVLSLCFKQMALYYSPIFFAYLLSKSTYSPGI-NLPRLFAISVSTA 293
           NNLLD FYA  A+CFVLS+CFKQMALYYSPIFFAYLLSKS + P + N+PR  AIS +T 
Sbjct: 244 NNLLDEFYAFAAVCFVLSICFKQMALYYSPIFFAYLLSKSLFHPRLFNIPRFAAISFATI 303

Query: 294 LAFIGSFGPIYIFGGYK----NLVQSMHRIFPFARGIFEDKVANFWCVSNIFIKYRNLFT 349
             F   FGPIY FGG      NL+QS+ RIFPFARGIFEDKVANFWCV+N+  KY+  FT
Sbjct: 304 CTFASMFGPIYFFGGENGGITNLLQSIKRIFPFARGIFEDKVANFWCVTNVIFKYKANFT 363

Query: 350 QKDLQLYSLLATVIGLLPSFIITFLYPKRHLLPYALAACSMSFFLFSFQVHEKXXXXXXX 409
           Q+ LQLYSL+ T+I  LP+ ++  LYP+++LL YAL+ACSMSF+LFSFQVHEK       
Sbjct: 364 QEQLQLYSLILTIIAFLPAMLVILLYPRKYLLLYALSACSMSFYLFSFQVHEKTILMPLL 423

Query: 410 XXXXXYTSRDWNVLSLVCWINNVALFTLWPLLKKDNLVLQYGVMFMFSNWLIGNFSFVTP 469
                YTS D NVLS V W+NN+ LFTLWPLLKKD L LQY V  + SNWLIGNFSF+TP
Sbjct: 424 PITLLYTSTDRNVLSRVSWMNNIGLFTLWPLLKKDGLSLQYWVCLILSNWLIGNFSFITP 483

Query: 470 RFLPKFLTPGPSISDIDVDYRRASLLPKSLIWRLIIVGSYIAMGIIHFLDYYVSPPSKYP 529
           RFLPK LTPGPSI  +  +YRR +LLP + IW++IIV SY+ MG+IHF+DY++ PPS YP
Sbjct: 484 RFLPKVLTPGPSIIQLGENYRRPTLLPSNWIWKVIIVLSYVMMGVIHFVDYFIEPPSAYP 543

Query: 530 DLWVLANCSLGFSCFVTFWIWNNYKLFEMRNSTLQDL 566
           DLWV+ NC+LGF CFV FW+WN YKLF M    +  L
Sbjct: 544 DLWVILNCTLGFGCFVLFWLWNYYKLFSMTKKNIHQL 580

>NCAS0D02160 Chr4 complement(401973..403664) [1692 bp, 563 aa] {ON}
           Anc_6.22 YOR002W
          Length = 563

 Score =  764 bits (1972), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/562 (64%), Positives = 444/562 (79%), Gaps = 7/562 (1%)

Query: 10  KNAV-KKTVSSLPANAETTTSTAIMKKVESVEAFFASPMYDFLTPFRPVGNQWCAKYVIV 68
           KN + KK +SS   + +T  ++      E  E+F+ASP+YD L PFRP G+QW  +Y IV
Sbjct: 4   KNKIPKKDLSSQKKSGKTKETSKKHDIPE--ESFYASPLYDLLYPFRPAGSQWMTEYTIV 61

Query: 69  IFALIIRCAVGLGGYSGMNTPPMFGDFEAQRHWMEITQHLPVREWYWYDLQYWGLDYPPL 128
           +F+LIIRCAVGLG +SG   PPMFGDFEAQRHWMEITQHLP+ +WYW+DL+YWGLDYPPL
Sbjct: 62  LFSLIIRCAVGLGPFSGYGVPPMFGDFEAQRHWMEITQHLPIHKWYWFDLKYWGLDYPPL 121

Query: 129 TAYHSYLLGKLGSFFREGWFDLESSRGYESLNLKSYMRFTVIISELLLYIPAVIYFTKWV 188
           TAYHSY+ GK+GSFF   WF L+SSRGYE+ +LK++MR TV++SE L YIP V+YF KW+
Sbjct: 122 TAYHSYICGKIGSFFNPNWFALDSSRGYEAQDLKTFMRLTVLVSEALFYIPGVVYFVKWL 181

Query: 189 GKYRSQSPIGQYIAAAAILFQPALILVDHGHFQYNCVMLGMTVYTLNNLLDGFYAMGAIC 248
           GK+R QSPIGQ+IAAAAIL QP+LIL+DHGHFQYN V LG+TVY +NNLLD FYAM A+C
Sbjct: 182 GKHRRQSPIGQFIAAAAILLQPSLILIDHGHFQYNSVALGLTVYAINNLLDEFYAMAAVC 241

Query: 249 FVLSLCFKQMALYYSPIFFAYLLSKSTYSPGI-NLPRLFAISVSTALAFIGSFGPIYIFG 307
           FVLS+CFKQM LYYSPIFFAYLLSKS ++P + N+PR  AI+++T  +F+  +GP+Y+FG
Sbjct: 242 FVLSICFKQMTLYYSPIFFAYLLSKSLFTPKLFNIPRFLAIAIATVCSFLLMYGPLYVFG 301

Query: 308 GYK---NLVQSMHRIFPFARGIFEDKVANFWCVSNIFIKYRNLFTQKDLQLYSLLATVIG 364
           G +   N++QS+HRIFPFARGIFEDKVANFWCV+N+  KY+ LFTQ++LQLYSL+ TV+G
Sbjct: 302 GDQGLNNVLQSIHRIFPFARGIFEDKVANFWCVTNVIFKYKMLFTQQELQLYSLVLTVVG 361

Query: 365 LLPSFIITFLYPKRHLLPYALAACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSRDWNVLS 424
            LP+ +I   YPK++LLPYAL+ACSM+F+LFSFQVHEK            YTS D NVLS
Sbjct: 362 FLPAMMIILFYPKKYLLPYALSACSMAFYLFSFQVHEKTILMPLLPITLLYTSTDRNVLS 421

Query: 425 LVCWINNVALFTLWPLLKKDNLVLQYGVMFMFSNWLIGNFSFVTPRFLPKFLTPGPSISD 484
            V W+NN+ LFTLWPLLKKD L LQY V  + SNWLIGNFSF+TP FLPK LTPGPS+S 
Sbjct: 422 RVSWMNNIGLFTLWPLLKKDGLTLQYWVCLLLSNWLIGNFSFITPNFLPKVLTPGPSVSM 481

Query: 485 IDVDYRRASLLPKSLIWRLIIVGSYIAMGIIHFLDYYVSPPSKYPDLWVLANCSLGFSCF 544
           I  +Y   SLLP+++ W++IIV SYIAMG IH LD +V+PP  YPDLWV+ NC+LGF CF
Sbjct: 482 IGENYHYRSLLPRNIFWKVIIVLSYIAMGAIHVLDAFVNPPVAYPDLWVILNCTLGFGCF 541

Query: 545 VTFWIWNNYKLFEMRNSTLQDL 566
             FWIWN YKLF M   +L  L
Sbjct: 542 FLFWIWNYYKLFSMIKKSLHHL 563

>Skud_15.163 Chr15 (289416..291050) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  760 bits (1962), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/530 (67%), Positives = 432/530 (81%), Gaps = 3/530 (0%)

Query: 40  EAFFASPMYDFLTPFRPVGNQWCAKYVIVIFALIIRCAVGLGGYSGMNTPPMFGDFEAQR 99
           E+F+ASPMYDFL PFRPVGNQW  +Y+I + A+I+RCA+GLG YSG ++PP+ GDFEAQR
Sbjct: 15  ESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSGKDSPPLHGDFEAQR 74

Query: 100 HWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKLGSFFREGWFDLESSRGYESL 159
           HWMEITQHLP+ +WYWYDLQYWGLDYPPLTA+HS L G +G+FF   WF L+ SRG+ES 
Sbjct: 75  HWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNPSWFALDKSRGFESP 134

Query: 160 N--LKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAILFQPALILVDH 217
           +  LK+YMR TVIIS++L Y PAVIYFTKW+G+YR+QSPIGQ IAAAAILFQP+L+L+DH
Sbjct: 135 DNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILFQPSLMLIDH 194

Query: 218 GHFQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMALYYSPIFFAYLLSKSTYS 277
           GHFQYN VMLG+T Y +NNLLD +YAM A+CFVLS+CFKQMALYY+PIFFAYLLS+S   
Sbjct: 195 GHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYLLSRSLLF 254

Query: 278 PGINLPRLFAISVSTALAFIGSFGPIYIFGG-YKNLVQSMHRIFPFARGIFEDKVANFWC 336
           P  N+ RL  I+ +T   F     P+Y  GG  +N+ Q ++RIFPF+RGIFEDKVANFWC
Sbjct: 255 PKFNIARLTVIAFATLATFSVILAPLYFLGGGLRNIHQCIYRIFPFSRGIFEDKVANFWC 314

Query: 337 VSNIFIKYRNLFTQKDLQLYSLLATVIGLLPSFIITFLYPKRHLLPYALAACSMSFFLFS 396
           V+NIF+KY++ FT + LQLYSL+ATVIG LP+ I+T L+PK+HLLPY L ACSMSFFLFS
Sbjct: 315 VTNIFVKYKDRFTIQQLQLYSLVATVIGFLPAMIMTLLHPKKHLLPYVLIACSMSFFLFS 374

Query: 397 FQVHEKXXXXXXXXXXXXYTSRDWNVLSLVCWINNVALFTLWPLLKKDNLVLQYGVMFMF 456
           FQVHEK            Y+S DWNVLSLV WINNVALFTLWPLLKKD L LQY V F+ 
Sbjct: 375 FQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQYTVSFLL 434

Query: 457 SNWLIGNFSFVTPRFLPKFLTPGPSISDIDVDYRRASLLPKSLIWRLIIVGSYIAMGIIH 516
           SNWLIGNFSF+TPRFLPK LTPGPSIS I+ DYRR SLLP +++W+  I+G+YIAMG+ H
Sbjct: 435 SNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYIAMGVYH 494

Query: 517 FLDYYVSPPSKYPDLWVLANCSLGFSCFVTFWIWNNYKLFEMRNSTLQDL 566
            LD +V PPSKYPDLWVL NC++GF+CF  FWIW+ YK+F   N +++DL
Sbjct: 495 LLDLFVVPPSKYPDLWVLLNCAVGFTCFSIFWIWSYYKIFTSGNKSVKDL 544

>ZYRO0C07744g Chr3 (587374..589017) [1644 bp, 547 aa] {ON} highly
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002W ALG6 Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 547

 Score =  758 bits (1956), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/541 (67%), Positives = 440/541 (81%), Gaps = 8/541 (1%)

Query: 34  KKVESV-------EAFFASPMYDFLTPFRPVGNQWCAKYVIVIFALIIRCAVGLGGYSGM 86
           KKVE         E+F+ASP+YDFL PF+PVG+QW  +Y+I++FA+IIRCA+GLG YSG 
Sbjct: 7   KKVEKAQADNTAEESFYASPLYDFLYPFKPVGSQWLPEYIIILFAVIIRCAIGLGPYSGQ 66

Query: 87  NTPPMFGDFEAQRHWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKLGSFFREG 146
           +  PM GDFEAQRHW+EITQHLP+ +WY++DL+YWGLDYPPLTAYHSY+LGKLGS     
Sbjct: 67  SVKPMHGDFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLGSLINPD 126

Query: 147 WFDLESSRGYESLNLKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAI 206
           WF L  SRG ES +LK+YMRFTVI+SE++ YIPAV+YFTKWVG++R  SP+GQ+IAAAAI
Sbjct: 127 WFALNVSRGLESNDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIAAAAI 186

Query: 207 LFQPALILVDHGHFQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMALYYSPIF 266
           LFQPAL+L+DHGHFQYNCVMLG TVY +N+L+D FYA  A CFVLS+CFKQMALYYSPIF
Sbjct: 187 LFQPALMLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYYSPIF 246

Query: 267 FAYLLSKSTYSPGINLPRLFAISVSTALAFIGSFGPIYIFG-GYKNLVQSMHRIFPFARG 325
           FAYLL +  +  GI  PR  +I+++T   F+  + P+YI G G +N++QS+HRIFPFARG
Sbjct: 247 FAYLLGRCVFKTGIRFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVHRIFPFARG 306

Query: 326 IFEDKVANFWCVSNIFIKYRNLFTQKDLQLYSLLATVIGLLPSFIITFLYPKRHLLPYAL 385
           IFEDKVANFWCV+NIF+KY+ LFTQ+ LQLYSLLAT +G LP+ ++  LYPK+HL+P+AL
Sbjct: 307 IFEDKVANFWCVTNIFVKYKQLFTQQQLQLYSLLATALGFLPAVVLVLLYPKKHLVPFAL 366

Query: 386 AACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSRDWNVLSLVCWINNVALFTLWPLLKKDN 445
           AACSMSFFLFSFQVHEK            YTS +W+VLSLV WINNV LFTLWPLLKKD 
Sbjct: 367 AACSMSFFLFSFQVHEKTILVPLLPITLLYTSTNWDVLSLVSWINNVGLFTLWPLLKKDG 426

Query: 446 LVLQYGVMFMFSNWLIGNFSFVTPRFLPKFLTPGPSISDIDVDYRRASLLPKSLIWRLII 505
           L LQY V F F NWLIGNFSFVTP FLPKFLTPGPS+S +D +YRR SLLPKS+IW+LII
Sbjct: 427 LALQYCVCFAFCNWLIGNFSFVTPTFLPKFLTPGPSVSSVDSNYRRRSLLPKSIIWKLII 486

Query: 506 VGSYIAMGIIHFLDYYVSPPSKYPDLWVLANCSLGFSCFVTFWIWNNYKLFEMRNSTLQD 565
           VGSYI+MG IH LD +V+PP  YPDLWV+ NC+LGF CF+ FW+WN YKLF +   +LQ 
Sbjct: 487 VGSYISMGAIHVLDMFVAPPLNYPDLWVILNCTLGFGCFMLFWLWNYYKLFSLAGQSLQQ 546

Query: 566 L 566
           L
Sbjct: 547 L 547

>TPHA0J00350 Chr10 complement(77974..79653) [1680 bp, 559 aa] {ON}
           Anc_6.22 YOR002W
          Length = 559

 Score =  749 bits (1934), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/568 (62%), Positives = 436/568 (76%), Gaps = 11/568 (1%)

Query: 1   MGLKKKQTPKNAVKKTVSSLPANAETTTSTAIMKKVESVEAFFASPMYDFLTPFRPVGNQ 60
           MG   K   K  VK+T  +  ++ + T  T         E F+ASP+Y FL+PF+   NQ
Sbjct: 1   MGKSGKHNSKKFVKQTHKNDISSLDETLDT---------EPFYASPLYTFLSPFKSTTNQ 51

Query: 61  WCAKYVIVIFALIIRCAVGLGGYSGMNTPPMFGDFEAQRHWMEITQHLPVREWYWYDLQY 120
           W + Y+IV+FALIIRCA+GLG YSGMN  PMFGDFEAQRHWMEITQHLP+ +WY+YDLQY
Sbjct: 52  WLSVYIIVLFALIIRCAIGLGPYSGMNEAPMFGDFEAQRHWMEITQHLPISQWYFYDLQY 111

Query: 121 WGLDYPPLTAYHSYLLGKLGSFFREGWFDLESSRGYESLNLKSYMRFTVIISELLLYIPA 180
           WGLDYPPLTAYHSY+ G +G FF   WF+LE+SRG E   LK++MR T I+SE++ YIPA
Sbjct: 112 WGLDYPPLTAYHSYICGLIGKFFNPAWFELETSRGMEMKELKTFMRLTAIVSEVIFYIPA 171

Query: 181 VIYFTKWVGKYRSQSPIGQYIAAAAILFQPALILVDHGHFQYNCVMLGMTVYTLNNLLDG 240
           +IYFT WVGK R QSP+GQYIAAAAILFQP L+L+DHGHFQYN VMLG+TVY +NNLLD 
Sbjct: 172 IIYFTTWVGKQRKQSPMGQYIAAAAILFQPCLMLIDHGHFQYNSVMLGLTVYAINNLLDD 231

Query: 241 FYAMGAICFVLSLCFKQMALYYSPIFFAYLLSKSTYSPG-INLPRLFAISVSTALAFIGS 299
            YA  AI FV+S+CFKQM+LYY+PIFFAYLL +S +     N+ R   I+++T ++F   
Sbjct: 232 MYAPAAISFVMSICFKQMSLYYAPIFFAYLLGRSLFKKQFFNVSRFLNIAIATMVSFFTV 291

Query: 300 FGPIYIFGGYK-NLVQSMHRIFPFARGIFEDKVANFWCVSNIFIKYRNLFTQKDLQLYSL 358
           F P+Y+FGG K N++QS+HRIFPFARGIFEDKVANFWCV+N+ +KY+  +TQ +LQLYSL
Sbjct: 292 FAPLYVFGGGKRNIIQSVHRIFPFARGIFEDKVANFWCVTNVIMKYKVNYTQDELQLYSL 351

Query: 359 LATVIGLLPSFIITFLYPKRHLLPYALAACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSR 418
           + TV+G LP+ +    +PK+HLLPY+LAAC+MSFFLFSFQVHEK            YTS 
Sbjct: 352 ILTVVGFLPAMVTILWFPKKHLLPYSLAACAMSFFLFSFQVHEKTILVPLLPITLLYTST 411

Query: 419 DWNVLSLVCWINNVALFTLWPLLKKDNLVLQYGVMFMFSNWLIGNFSFVTPRFLPKFLTP 478
           DWNVLSLV WINNVALFTLWPLLKKD +VLQYGV F+ SNWLIGNFSF TPRFLPK LTP
Sbjct: 412 DWNVLSLVSWINNVALFTLWPLLKKDGVVLQYGVCFILSNWLIGNFSFFTPRFLPKILTP 471

Query: 479 GPSISDIDVDYRRASLLPKSLIWRLIIVGSYIAMGIIHFLDYYVSPPSKYPDLWVLANCS 538
           GP I +++  YRR SLLP ++IW++IIV SYI M  I  L+ +V PP +YPD++VL NC+
Sbjct: 472 GPPIQNVNTHYRRRSLLPNNIIWKIIIVLSYIVMVAIQGLELFVEPPPQYPDIFVLLNCT 531

Query: 539 LGFSCFVTFWIWNNYKLFEMRNSTLQDL 566
           LGF CF +FW+WN YKLF + +  LQ L
Sbjct: 532 LGFCCFTSFWLWNYYKLFTLTSKNLQYL 559

>CAGL0E02629g Chr5 (250010..251656) [1647 bp, 548 aa] {ON} highly
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002w ALG6 glucosyltransferase
          Length = 548

 Score =  741 bits (1912), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/547 (62%), Positives = 427/547 (78%), Gaps = 3/547 (0%)

Query: 23  NAETTTSTAIMK--KVESVEAFFASPMYDFLTPFRPVGNQWCAKYVIVIFALIIRCAVGL 80
           ++E     A+ K    +  E+F+ASP+YDFL PFRP G+QW  +++I++FA+IIRCA+GL
Sbjct: 2   SSEKKDKKAVSKFESEQGEESFYASPLYDFLFPFRPAGSQWLTEWIIIMFAMIIRCAIGL 61

Query: 81  GGYSGMNTPPMFGDFEAQRHWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKLG 140
           G YSG    PM GDFEAQRHWMEITQHLP+ +WY+YDL+YWGLDYPPLTA+HSYLLGKLG
Sbjct: 62  GPYSGYKDGPMHGDFEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLG 121

Query: 141 SFFREGWFDLESSRGYESLNLKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQY 200
           +F    WF L+SSRG E+  LK+YMRFTV++SE + Y+PAV+YFTKW+G+ R+QSPIGQ+
Sbjct: 122 TFCNPDWFALDSSRGIETQGLKNYMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQF 181

Query: 201 IAAAAILFQPALILVDHGHFQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMAL 260
           IAAAAILFQP+L+L+DHGHFQYN +MLG TVY +NNLLD FYA  AICFVLS+CFKQM+L
Sbjct: 182 IAAAAILFQPSLMLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSL 241

Query: 261 YYSPIFFAYLLSKSTYSPGI-NLPRLFAISVSTALAFIGSFGPIYIFGGYKNLVQSMHRI 319
           YY+PIFFAYLL +S + P + N+PR  +IS++T + F   F P YIFGG   L Q++ RI
Sbjct: 242 YYAPIFFAYLLGRSMFFPKLFNIPRFISISIATLVTFTAMFSPFYIFGGLDGLAQTVRRI 301

Query: 320 FPFARGIFEDKVANFWCVSNIFIKYRNLFTQKDLQLYSLLATVIGLLPSFIITFLYPKRH 379
           FPFARGIFEDKVANFWCV N  +K++ LFT   L++YSL+ TV+G  P+ I+  LYP++H
Sbjct: 302 FPFARGIFEDKVANFWCVVNTIVKFKVLFTNDQLRMYSLILTVVGFAPAMILIILYPRKH 361

Query: 380 LLPYALAACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSRDWNVLSLVCWINNVALFTLWP 439
           LLPYALAACSMSF+LFSFQVHEK            +TSRDWNVLS+V WINNVALFTLWP
Sbjct: 362 LLPYALAACSMSFYLFSFQVHEKTILVPLLPITLLFTSRDWNVLSMVSWINNVALFTLWP 421

Query: 440 LLKKDNLVLQYGVMFMFSNWLIGNFSFVTPRFLPKFLTPGPSISDIDVDYRRASLLPKSL 499
           LLK++ L LQY V F  SNWLIGNFSF+TPRFLPKF+TPGPSIS +  +YRR SLLP S+
Sbjct: 422 LLKREGLYLQYFVCFFLSNWLIGNFSFITPRFLPKFITPGPSISSVSDNYRRRSLLPHSI 481

Query: 500 IWRLIIVGSYIAMGIIHFLDYYVSPPSKYPDLWVLANCSLGFSCFVTFWIWNNYKLFEMR 559
            W+LIIV SYI M   HFLD ++  P ++PDLWV+ NC++GF  F  FW+W  YK   + 
Sbjct: 482 FWKLIIVSSYIGMTAYHFLDLFIEAPPRFPDLWVILNCTIGFVSFSLFWLWTYYKFCTLL 541

Query: 560 NSTLQDL 566
              +QDL
Sbjct: 542 KKNIQDL 548

>TBLA0A09310 Chr1 (2297508..2299148) [1641 bp, 546 aa] {ON}
           Anc_5.669 YOR067C
          Length = 546

 Score =  129 bits (324), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 101/366 (27%), Positives = 173/366 (47%), Gaps = 72/366 (19%)

Query: 94  DFEAQRHWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKLGSFF--REGWFDL- 150
           DF+  R+W+ IT  LP+REWY+ +   W LDYPP  AY  + L +    F   +G  D+ 
Sbjct: 43  DFDVHRNWLAITNKLPLREWYYENTSQWTLDYPPFFAYFEWFLSQFVPKFVKEDGCLDIL 102

Query: 151 -ESSRGYESLNLKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAILFQ 209
            E   G+ ++    + R TVIISE+LL++   ++        ++QS    ++ A++I+  
Sbjct: 103 PEGEFGWSTI---VFQRLTVIISEILLFVVLQVFINNSGSNEKTQS----FVVASSIILS 155

Query: 210 PALILVDHGHFQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMALYYSPIFFAY 269
           P  +++DH HFQYN  + G+ + ++    +  Y +  + + ++LCFK + LY +P +F +
Sbjct: 156 PGFLMIDHIHFQYNGFLFGILIASIVAAKNKRYLLCGLFYSIALCFKHIFLYLAPCYFVF 215

Query: 270 LLSK----------STYSPGI------NLPRLFAISVSTALAFIGSFGPIYIFGGYKNLV 313
           LL             +Y   I      NL +L  I V         FGP +     +++ 
Sbjct: 216 LLRAYVLNFQDFKFKSYKDLILVVQWGNLMKLGGIVVCVMGV---CFGPFW-----RDMN 267

Query: 314 QSMHRIFPFARGI--------------FEDKVANFWCVSNIFIKYRNLFTQKDLQLYS-- 357
           Q + R+FPF+RG+              F DK+ +   V   F K+ NL   ++ + ++  
Sbjct: 268 QLLSRLFPFSRGLTHAYWAPNFWAIYSFVDKMLSILFVRVPFNKFINLDKIEERKRWNNG 327

Query: 358 ---LLATVI-GLLP------SFIITFLYPKRHLLPY-----------ALAACSMSFFLFS 396
              L+  V   +LP      +F++T  Y    ++P            +L  C  + FLF 
Sbjct: 328 SRGLVEDVFFVILPQIQPNLTFVLTLFYQVLAVVPVLFDPSFKRFIGSLTLCGFASFLFG 387

Query: 397 FQVHEK 402
           + VHEK
Sbjct: 388 WHVHEK 393

>KLTH0F17666g Chr6 complement(1425802..1427469) [1668 bp, 555 aa]
           {ON} highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 555

 Score =  124 bits (312), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 113/416 (27%), Positives = 176/416 (42%), Gaps = 78/416 (18%)

Query: 94  DFEAQRHWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKL--GSFFREGWFDLE 151
           DF+  R+W+ IT  LP+ +WY+     W LDYPP  AY  +LL +        +G  D+ 
Sbjct: 44  DFDVHRNWLAITNKLPLHKWYYESTSQWTLDYPPFFAYFEWLLSQFVPQRVQDDGCLDIV 103

Query: 152 SSRGYESLNLKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAILFQPA 211
           +  G   L    + R TVI+SE+LL++   +Y  K     RS      ++ A++I+  P 
Sbjct: 104 AV-GQFGLPTIVFQRVTVIVSEILLFVVLQVYINKSHISDRS----ANFVVASSIVLSPG 158

Query: 212 LILVDHGHFQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMALYYSPIFFAYLL 271
            +++DH HFQYN  +  + + ++       Y +    F  +LCFK + LY +P FFA+LL
Sbjct: 159 FLIIDHIHFQYNGFLFAILIASIVAAKHQRYLLCGFFFSTALCFKHIFLYLAPSFFAFLL 218

Query: 272 SK----------STYSPGINLPR---LFAISVSTALAFIGSFGP-IYIFGGYKNLVQSMH 317
                        TY+  I++ R   LF +       F   F P IY       L Q M 
Sbjct: 219 RVYILDFSNFRFRTYNDLISMVRWKNLFKLGTVVLSVFAVCFAPFIY------QLPQLMS 272

Query: 318 RIFPFARGIFEDKVA-NFWCVSNIFIKYRNLFTQKDLQLYSLLATVIG--LLP------- 367
           R+FPF+RG+     A NFW + +   K   LF  K   ++  L  V+   L+P       
Sbjct: 273 RLFPFSRGLTHAYWAPNFWALYSALDKVLTLFFLKVPYVHKFLTQVVSPPLIPVTIDEIK 332

Query: 368 -----------------------------SFIITFLYPKRHLLPY-----------ALAA 387
                                        +FI+T  Y    ++P            +L  
Sbjct: 333 TKLQQYNVGTKGLVQDVYFVILPQIQPKLTFILTLFYQILAVIPVLFSPSFERFVGSLTL 392

Query: 388 CSMSFFLFSFQVHEKXXXXXXXXXXXXYTSRDWNVLSLVCWINNVALFTLWPLLKK 443
           C  + FLF + VHEK             T+ D  +L+    + +    +L+PLL +
Sbjct: 393 CGFASFLFGWHVHEKAVLLIIIPFSFLVTT-DRRLLTPFHLVASAGYVSLFPLLHE 447

>ZYRO0A11506g Chr1 complement(925282..926952) [1671 bp, 556 aa] {ON}
           highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 556

 Score =  122 bits (306), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 86/287 (29%), Positives = 142/287 (49%), Gaps = 36/287 (12%)

Query: 94  DFEAQRHWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKL--GSFFREGWFDLE 151
           DF+  R+W+ IT +LP+R+WY+     W LDYPP  AY  + L +   G+  ++G  ++ 
Sbjct: 45  DFDVHRNWLAITHNLPLRQWYYEATSQWTLDYPPFFAYFEWFLSQFVPGTVKQDGCLEI- 103

Query: 152 SSRGYESLNLKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAILFQPA 211
             +G    +   + R TVI+SE+LL++   ++        R+QS    ++ A++I+  PA
Sbjct: 104 VDKGQFGWSTLVFQRSTVILSEILLFVVLQVFINTSSVTERTQS----FVIASSIVLSPA 159

Query: 212 LILVDHGHFQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMALYYSPIFFAYLL 271
            ++VDH HFQYN  +  + + ++     G Y   A  + ++LCFK + LY +P +F +LL
Sbjct: 160 FLIVDHIHFQYNGFLFAILIASIVAAKRGKYLWCATFYSVALCFKHIFLYLAPCYFVFLL 219

Query: 272 SK----------STYSPGINLPR---LFAISVSTALAFIGSFGPIYIFGGYKNLVQSMHR 318
                        +Y   I + +   LF +       F   FGP       K+L Q + R
Sbjct: 220 RAYCLNFQDFKFKSYKDLIFIVKWRHLFQLGSIVIGVFALCFGPF-----VKDLPQVLTR 274

Query: 319 IFPFARGIFEDKVA-NFWCVSNIFIK----------YRNLFTQKDLQ 354
           +FPF+RG+     A NFW + +   K          Y + FT K +Q
Sbjct: 275 LFPFSRGLTHAYWAPNFWALYSFLDKILTVVMLKLPYVHQFTSKFIQ 321

>ADR210C Chr4 complement(1070234..1071952) [1719 bp, 572 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR067C
           (ALG8)
          Length = 572

 Score =  119 bits (298), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 100/379 (26%), Positives = 163/379 (43%), Gaps = 85/379 (22%)

Query: 94  DFEAQRHWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKL--GSFFREGWFDL- 150
           DFE  R+W+ +T  LP+R+WY      W +DYPPL A+  + L ++  G+  R+G   L 
Sbjct: 59  DFEVHRNWLAVTHRLPLRKWYVDATSQWTMDYPPLFAWLEWALSQVVPGAVRRDGCLKLV 118

Query: 151 -ESSRGYESLNLKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAILFQ 209
            E   G+ ++    + R TVI SE+LLY+   +Y +    + R+ +    ++   ++   
Sbjct: 119 AEGRYGWPTV---VFQRLTVIASEVLLYVVLQVYVSSSAAQERTVN----FVVTTSVALS 171

Query: 210 PALILVDHGHFQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMALYYSPIFFAY 269
           PA +LVDH HFQYN  +  + V ++    +  Y +    F ++LC K + LY +P +F +
Sbjct: 172 PAFLLVDHIHFQYNGFLFAVLVASIVAARERRYVLCGALFTVALCLKHIFLYLAPAYFVF 231

Query: 270 LLSKSTYSPGI----------------NLPRLFAISVSTALAFIGSFGPIYIFGGYKNLV 313
           LL       G                 NL RL  + ++       +F P   F G   + 
Sbjct: 232 LLRAYVLDLGEFRFRSYRDLVFAVRWGNLCRLGGVVLAIMAV---TFAP---FAGV--MP 283

Query: 314 QSMHRIFPFARGIFEDKVA-NFWCVSNIFIKYRNLFTQKDLQLYSLLATVIG--LLP--- 367
           Q M R+FPF+RG+     A NFW + +   K       +   +Y L  +++   L+P   
Sbjct: 284 QLMARLFPFSRGLTHAYWAPNFWAIYSFVDKVLTFLMLRVPYVYKLATSLVQPPLIPASI 343

Query: 368 ---------------------------------SFIITFLYPKRHLLPY----------- 383
                                            +F++T  Y    +LP            
Sbjct: 344 DEIRARMAAGNHGTRGLVQDVSFVILPQIQPKLTFLLTLFYQVLAVLPVLFDPSFKRFIG 403

Query: 384 ALAACSMSFFLFSFQVHEK 402
           +L+ C  S FLF + VHEK
Sbjct: 404 SLSLCGFSAFLFGWHVHEK 422

>TPHA0J01380 Chr10 complement(321431..323158) [1728 bp, 575 aa] {ON}
           Anc_5.669 YOR067C
          Length = 575

 Score =  119 bits (297), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 81/260 (31%), Positives = 126/260 (48%), Gaps = 26/260 (10%)

Query: 94  DFEAQRHWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKLGSFF--REGWFDLE 151
           DF+  R+W+ IT +LP+ +WY+ +   W LDYPP  AY  ++L +        +G  D+ 
Sbjct: 64  DFDVHRNWLAITSNLPISKWYYENTSEWTLDYPPFFAYFEWVLSRFAPEIVKNDGCLDIV 123

Query: 152 SSRGYESLNLKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAILFQPA 211
              G   L    + R TVIISE+LL+     Y      K R Q     ++ A++I+  P 
Sbjct: 124 EV-GQFGLPTIVFQRLTVIISEILLFAVLQYYINTSNSKERGQC----FVVASSIVLSPG 178

Query: 212 LILVDHGHFQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMALYYSPIFFAYLL 271
            +++DH HFQYN  +  + + ++       Y   A+ + +SLCFK + LY +P +F +LL
Sbjct: 179 FLIIDHIHFQYNGFLFAIFIASIVAAKQKKYLACAVFYSISLCFKHIFLYLAPCYFVFLL 238

Query: 272 -------------SKSTYSPGINLPRLFAISVSTALAFIGSFGPIYIFGGYKNLVQSMHR 318
                        S       I   RLF ++   +  F   F P +IF     L Q + R
Sbjct: 239 RAYVLNFENFKFKSYMDLQSVIQWKRLFKLAGIVSGIFTICFAP-FIF----QLPQVLSR 293

Query: 319 IFPFARGIFEDKVA-NFWCV 337
           +FPF+RG+     A NFW +
Sbjct: 294 LFPFSRGLTHAYWAPNFWAM 313

>YOR067C Chr15 complement(451729..453462) [1734 bp, 577 aa] {ON}
           ALG8Glucosyl transferase, involved in N-linked
           glycosylation; adds glucose to the dolichol-linked
           oligosaccharide precursor prior to transfer to protein
           during lipid-linked oligosaccharide biosynthesis;
           similar to Alg6p
          Length = 577

 Score =  118 bits (296), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 78/257 (30%), Positives = 129/257 (50%), Gaps = 20/257 (7%)

Query: 94  DFEAQRHWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKL--GSFFREGWFDLE 151
           DF+  R+W+ IT  LP+ EWY+     W LDYPP  AY  + L +    S   +G  D+ 
Sbjct: 66  DFDVHRNWLAITNKLPISEWYYEHTSQWTLDYPPFFAYFEWFLSQFVPKSVRDDGCLDIV 125

Query: 152 SSRGYESLNLKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAILFQPA 211
              G   L    + R TVI SE+LL++   IY        RSQS    ++ A++I+  P 
Sbjct: 126 EI-GKFGLPTIVFQRLTVIFSEILLFVILQIYINTTKLSERSQS----FVVASSIVLSPG 180

Query: 212 LILVDHGHFQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMALYYSPIFFAYLL 271
            +++DH HFQYN  +  + + ++    +  Y + A+ +  ++CFK + LY +P +F +LL
Sbjct: 181 FLIIDHIHFQYNGFLFAILIGSIVAAKNKRYILCAVLYTTAICFKHIFLYLAPCYFVFLL 240

Query: 272 SK----------STYSPGINLPRLFAISVSTALAFIGSFGPIYIFGGYKNLVQSMHRIFP 321
                        +Y   + L R +A  +  A   +G F   ++   ++ + Q + R+FP
Sbjct: 241 RAYVLNVNNFKFKSYKDFLFLIR-WANLLKLATVVVGIFTICFLPFAHQ-MPQVLSRLFP 298

Query: 322 FARGIFEDKVA-NFWCV 337
           F+RG+     A NFW +
Sbjct: 299 FSRGLTHAYWAPNFWAL 315

>KAFR0D02440 Chr4 (489816..491543) [1728 bp, 575 aa] {ON} Anc_5.669
           YOR067C
          Length = 575

 Score =  117 bits (294), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 91/295 (30%), Positives = 145/295 (49%), Gaps = 28/295 (9%)

Query: 94  DFEAQRHWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKLGSFF--REGWFDLE 151
           DF+  R+W+ IT  + +++WY+     W LDYPP  AY  + +  L   F  R+G  D+ 
Sbjct: 64  DFDVHRNWLAITNGMHLKDWYYEHTSQWTLDYPPFFAYFEWFISHLVPSFVRRDGCLDIV 123

Query: 152 SSRGYESLNLKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAILFQPA 211
              G        + R TVI SE LL++   IY      + R+QS    +I A++I+  P 
Sbjct: 124 EV-GQFGWPTVLFQRLTVIFSESLLFLVLQIYINTSEVEERTQS----FIVASSIVLSPG 178

Query: 212 LILVDHGHFQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMALYYSPIFFAYLL 271
            ++VDH HFQYN  +  + V ++    +  Y + A+ + ++LCFK + LY +P +F +LL
Sbjct: 179 FLIVDHIHFQYNGFLFAILVASIVAARNKRYLLCALFYSIALCFKHIFLYLAPCYFVFLL 238

Query: 272 SK----------STYSPGINLPR---LFAISVSTALAFIGSFGPIYIFGGYKNLVQSMHR 318
                        +Y   I L R   L  + +     F   FGP +IF    ++ Q + R
Sbjct: 239 RVYVLNFENFKFRSYKDLIFLIRWKNLCQLGMIVVGVFSLCFGP-FIF----DMPQLLSR 293

Query: 319 IFPFARGIFEDKVA-NFWCVSNIFIKYRNLFTQKDLQLYSLLATVIG--LLPSFI 370
           +FPF+RG+     A NFW + +   K   +F  +   +++  A  I   LLPS I
Sbjct: 294 LFPFSRGLTHAYWAPNFWALYSFLDKVLTVFALRLHYVHNFAAKFIAPSLLPSSI 348

>Kwal_55.21742 s55 complement(960476..962143) [1668 bp, 555 aa] {ON}
           YOR067C (ALG8) - glycosyl transferase [contig 126] FULL
          Length = 555

 Score =  116 bits (291), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 104/417 (24%), Positives = 175/417 (41%), Gaps = 76/417 (18%)

Query: 94  DFEAQRHWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKL--GSFFREGWFDLE 151
           DF+  R+W+ IT  LP+++WY+ +   W LDYPP  AY  + L +L      ++G  D+ 
Sbjct: 44  DFDVHRNWLAITNKLPLKQWYFENTSQWTLDYPPFFAYFEWALSQLVPNIVRQDGCLDIV 103

Query: 152 SSRGYESLNLKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAILFQPA 211
              G   +    + R TVI SE+LL++   +Y  K     RS      ++ A++I+  P 
Sbjct: 104 KV-GQFGMPTIVFQRLTVIASEILLFVVLQVYINKSHISERS----ANFVVASSIVLSPG 158

Query: 212 LILVDHGHFQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMALYYSPIFFAYLL 271
            +++DH HFQYN  +  + + ++    +  Y +  + F +++CFK + LY +P FF +LL
Sbjct: 159 FLIIDHIHFQYNGFLFAILIASIVAAKEQRYLLCGLFFSIAICFKHIFLYLAPSFFVFLL 218

Query: 272 SK----------STYSPGINLPR---LFAISVSTALAFIGSFGPIYIFGGYKNLVQSMHR 318
                        +Y+  I++ +   LF +       F   F P           Q + R
Sbjct: 219 RVYVLDFSNFHFKSYNDLISIVQWRNLFKLGSVVLCVFGVCFAPF-----ISQWPQLLSR 273

Query: 319 IFPFARGIFEDKVA-NFWCVSNIFIKYRNLFTQKDLQLYSLLATVIG--LLP-------- 367
           +FPF+RG+     A NFW + ++  K   L   K   ++  L   I   L+P        
Sbjct: 274 LFPFSRGLTHAYWAPNFWAMYSLLDKVLTLIILKVPYVHKFLTQFIAPPLIPATIGEIKQ 333

Query: 368 ----------------------------SFIITFLYPKRHLLPY-----------ALAAC 388
                                       +FI+T  Y    ++P            +L  C
Sbjct: 334 KLLQYNVGTKGLVQDVYFVILPQIQPRLTFILTLFYQILAIIPVLFSPSFKRFVGSLTLC 393

Query: 389 SMSFFLFSFQVHEKXXXXXXXXXXXXYTSRDWNVLSLVCWINNVALFTLWPLLKKDN 445
             + FLF + VHEK             TS D  +L+    + +    +L+PLL +  
Sbjct: 394 GFASFLFGWHVHEKAIMLIIIPFSFLVTS-DRRLLTPFNLLASAGYVSLFPLLHETQ 449

>CAGL0L10450g Chr12 complement(1117959..1119611) [1653 bp, 550 aa]
           {ON} similar to uniprot|P40351 Saccharomyces cerevisiae
           YOR067c ALG8 Glucosyltransferase
          Length = 550

 Score =  116 bits (290), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 108/420 (25%), Positives = 183/420 (43%), Gaps = 82/420 (19%)

Query: 94  DFEAQRHWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGK-LGSFFR-EGWFDLE 151
           DF+  R+W+ IT  LP+R+WY+     W LDYPP  AY  + L + + S+ + +G  D+ 
Sbjct: 36  DFDVHRNWLAITNKLPLRQWYYEHTSQWTLDYPPFFAYFEWFLSQFVPSYVKSDGCLDIV 95

Query: 152 SSRGYESLNLKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAILFQPA 211
              G   +    + R TVI SE+LL++   +Y        R+QS    ++ A++I   P 
Sbjct: 96  EV-GQFGMPTVVFQRLTVIASEILLFVVLQVYINTSKVSERTQS----FVVASSIAISPG 150

Query: 212 LILVDHGHFQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMALYYSPIFFAYLL 271
            +++DH HFQYN  +  + + ++    +  Y      + ++LCFK + LY +P +F +LL
Sbjct: 151 FLIIDHIHFQYNGFLFAILIASIVAAKNKKYLWCGFFYSVALCFKHIYLYLAPCYFVFLL 210

Query: 272 SK----------STYSPGI------NLPRLFAISVSTALAFIGSFGPIYIFGGYKNLVQS 315
                        +Y   I      +L +L ++ ++T   F  +FGP +IF    +L Q 
Sbjct: 211 RAYVLNLKDFKFKSYRDLIFIVKWRHLVKLGSVVIAT---FAVAFGP-FIF----DLPQL 262

Query: 316 MHRIFPFARGIFEDKVA-NFWCVSNIFIKYRNLFTQKDLQLYSLLATVIG--LLP----- 367
           + R+FPF+RG+     A NFW + +   K   +   K    Y L +  I   L+P     
Sbjct: 263 LTRLFPFSRGLTHAYWAPNFWAIYSTIDKILTMVFLKMPYTYKLASQFISPPLIPASLNE 322

Query: 368 -------------------------------SFIITFLYPKRHLLPY-----------AL 385
                                          +F++T LY    ++P            ++
Sbjct: 323 IKAKMAANNNGSKGLVEDVYFVILPQIVPKLTFLLTLLYQVLAVVPVLFDPSFKRFMGSM 382

Query: 386 AACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSRDWNVLSLVCWINNVALFTLWPLLKKDN 445
             C ++ FLF + VHEK              S D  +LS    + +    +L+PLL +  
Sbjct: 383 TLCGLASFLFGWHVHEKAIMLVIIPFSFLVIS-DRRLLSSFMLLTSAGYVSLFPLLYESQ 441

>KNAG0L01920 Chr12 complement(344454..346160) [1707 bp, 568 aa] {ON}
           Anc_5.669 YOR067C
          Length = 568

 Score =  115 bits (289), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 108/420 (25%), Positives = 177/420 (42%), Gaps = 81/420 (19%)

Query: 94  DFEAQRHWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKL--GSFFREGWFDLE 151
           DF+  R+W+ IT  LP+REWY+     W LDYPP  AY  ++L +    +   +G  D+ 
Sbjct: 53  DFDVHRNWLAITNALPLREWYYEKTSQWTLDYPPFFAYFEWVLSQFVPAAVRADGCLDIV 112

Query: 152 SSRGYESLNLKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAILFQPA 211
               + +L +  + R TVI SE+LL++   +Y        ++QS    ++ A++I+  P 
Sbjct: 113 PQGVFGALTVL-FQRCTVIASEVLLFVVLQVYINTSPPAEKTQS----FVVASSIVLSPM 167

Query: 212 LILVDHGHFQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMALYYSPIFFAYLL 271
           L++VDH HFQYN  +  + + ++       + + A  +  +LCFK + LY +P +F +LL
Sbjct: 168 LLIVDHIHFQYNGFLFAILIASIVAARKRKFLLCAFFYSTALCFKHIFLYLAPCYFMFLL 227

Query: 272 -------------SKSTYSPGINLPRLFAISVSTALAFIGSFGPIYIFGGYKNLVQSMHR 318
                        S       I+  RLF +        +  F P       +++ Q + R
Sbjct: 228 RTYVLQFEGFRFKSYKDLFRIIHWGRLFKLGGVVLGVAVVCFAPF-----ARDMPQLLSR 282

Query: 319 IFPFARGIFEDKVA-NFWCVSNIFIKYRNLFTQKDLQLYSLLATVIG------------- 364
           +FPF+RG+     A NFW + ++  K   +   K    + L+  V+              
Sbjct: 283 LFPFSRGLTHAYWAPNFWALYSLCDKVLTVALLKVPLFHRLILKVLSPKIFPASLDIIRQ 342

Query: 365 --------------------LLP------SFIITFLYPKRHLLPY-----------ALAA 387
                               +LP      +F++T LY    +LP            +L  
Sbjct: 343 RLKKNANHGTKGLVEDVYFVVLPQITPATTFLLTLLYQVLAVLPLLFDASFKRFLGSLTL 402

Query: 388 CSMSFFLFSFQVHEKXXXXXXX--XXXXXYTSRDWNVLSLVCWINNVALFTLWPLLKKDN 445
           C  + FLF + VHEK              Y  R      LV     V+LF   PLL K++
Sbjct: 403 CGFASFLFGWHVHEKAIMLVIIPFSFLVVYDRRLLTSFKLVTTAGYVSLF---PLLYKND 459

>Smik_15.247 Chr15 complement(417710..419443) [1734 bp, 577 aa] {ON}
           YOR067C (REAL)
          Length = 577

 Score =  114 bits (284), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 99/374 (26%), Positives = 157/374 (41%), Gaps = 75/374 (20%)

Query: 94  DFEAQRHWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKL--GSFFREGWFDLE 151
           DF+  R+W+ IT  LP+ EWY+     W LDYPP  AY  + L +        +G  D+ 
Sbjct: 66  DFDVHRNWLAITNKLPISEWYYEHTSQWTLDYPPFFAYFEWFLSQFVPKVVRDDGCLDIV 125

Query: 152 SSRGYESLNLKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAILFQPA 211
              G   L    + R TVI SE+LLY    IY        RSQS    ++ A++I+  P 
Sbjct: 126 EV-GKFGLPTIVFQRLTVIFSEILLYAVLQIYINTTKLSERSQS----FVVASSIVLSPG 180

Query: 212 LILVDHGHFQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMALYYSPIFFAYLL 271
            +++DH HFQYN  +  + + ++    +  Y + A  +  ++CFK + LY +P +F +LL
Sbjct: 181 FLMIDHIHFQYNGFLFAILIGSIVAAKNKKYLLCAFLYTTAICFKHIFLYLAPCYFVFLL 240

Query: 272 SK----------STYSPGINLPR---LFAISVSTALAFIGSFGPIYIFGGYKNLVQSMHR 318
                        +Y   + L R   LF +       F   F P         + Q + R
Sbjct: 241 RAYVLNVNNFKFKSYKDFLFLIRWANLFKLGSIVIGIFTICFVPF-----AHQMPQVLSR 295

Query: 319 IFPFARGIFEDKVA-NFWCVSNIFIK----------YRNLFTQKDLQ------------- 354
           +FPF+RG+     A NFW + +   K          Y + F  K ++             
Sbjct: 296 LFPFSRGLTHAYWAPNFWALYSFMDKILTTVMLKLPYVHTFATKFIKPPLIPQNIKEINE 355

Query: 355 ------------LYSLLATVIGLLP---SFIITFLYPKRHLLPY-----------ALAAC 388
                       +  +   ++  +P   +FI+T  Y    +LP            +L  C
Sbjct: 356 RLAANNNGSKGLVQDVFFVILPQIPPKLTFILTLFYQNLAVLPLLFDPSFKRFVGSLTLC 415

Query: 389 SMSFFLFSFQVHEK 402
            ++ FLF + VHEK
Sbjct: 416 GLASFLFGWHVHEK 429

>NCAS0G00450 Chr7 (77781..79493) [1713 bp, 570 aa] {ON} Anc_5.669
           YOR067C
          Length = 570

 Score =  112 bits (281), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 76/261 (29%), Positives = 132/261 (50%), Gaps = 28/261 (10%)

Query: 94  DFEAQRHWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKL--GSFFREGWFDLE 151
           DF+  R+W+ +T  LP+++WY+     W LDYPP  AY  +++ +        +G  D+ 
Sbjct: 56  DFDVHRNWLAVTNKLPLKQWYYEHTSQWTLDYPPFFAYFEWIISQFVPQVVRDDGCLDIV 115

Query: 152 SSRGYESLNLKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAILFQPA 211
               +    +  + R +VI SE+LL++    +      K R+QS    +I A +I+  P 
Sbjct: 116 EIGKFGEPTV-IFQRLSVITSEILLFVVLQWFINTSNVKERTQS----FIVATSIILSPG 170

Query: 212 LILVDHGHFQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMALYYSPIFFAYLL 271
            ++VDH HFQYN  +  + + ++       Y + A+ +  +LCFK + LY +P +F +LL
Sbjct: 171 FLIVDHIHFQYNGFLFSILIASIVAAKQKRYILCAVFYTTALCFKHIFLYLAPCYFVFLL 230

Query: 272 SK----------STYSPGINLPR---LFAISVSTALAFIG-SFGPIYIFGGYKNLVQSMH 317
                        +Y   + L +   LF ++    L+ +G  FGP +IF    ++ Q + 
Sbjct: 231 RAYVLNVKGFQFKSYKDLVRLVQWTNLFRLA-GVVLSIVGVCFGP-FIF----DMPQLLT 284

Query: 318 RIFPFARGIFEDKVA-NFWCV 337
           R+FPF+RG+     A NFW +
Sbjct: 285 RLFPFSRGLTHAYWAPNFWAI 305

>Suva_8.118 Chr8 complement(214797..216527) [1731 bp, 576 aa] {ON}
           YOR067C (REAL)
          Length = 576

 Score =  112 bits (279), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 99/373 (26%), Positives = 160/373 (42%), Gaps = 74/373 (19%)

Query: 94  DFEAQRHWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKL--GSFFREGWFDLE 151
           DF+  R+W+ IT  LP+ EWY+     W LDYPP  AY  + L +        +G  D+ 
Sbjct: 66  DFDVHRNWLAITNKLPMSEWYYEHTSQWTLDYPPFFAYFEWFLSQFVPKVVRDDGCLDIV 125

Query: 152 SSRGYESLNLKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAILFQPA 211
              G   L    + R TVI SE+LL+    IY        RSQS    ++ A++I+  P 
Sbjct: 126 EV-GKFGLPTIVFQRLTVIFSEILLFAVLQIYINTTKLSERSQS----FVVASSIVLSPG 180

Query: 212 LILVDHGHFQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMALYYSPIFFAYLL 271
            +++DH HFQYN  +  + + ++    +  Y   A+ +  S+CFK + LY +P +F +LL
Sbjct: 181 FLMIDHIHFQYNGFLFAILIGSIVAAKNKKYLWCAVLYTTSICFKHIFLYLAPCYFVFLL 240

Query: 272 SK----------STYSPGINLPR---LFAISVSTALAFIGSFGPIYIFGGYKNLVQSMHR 318
                        +Y   + L R   LF +       F   F P         + Q + R
Sbjct: 241 RAYVLNVNNFKFKSYKDFLFLIRWTNLFKLGSIVIGIFTICFLPF-----AHQMPQVLSR 295

Query: 319 IFPFARGIFEDKVA-NFWC--------VSNIFIK--YRNLFTQKDLQ------------- 354
           +FPF+RG+     A NFW         ++ I +K  Y ++F  K ++             
Sbjct: 296 LFPFSRGLTHAYWAPNFWALYSFMDKILTTIMLKLPYVHMFATKLIKPPLIPKDIKEINE 355

Query: 355 -----------LYSLLATVIGLLP---SFIITFLYPKRHLLPY-----------ALAACS 389
                      +  +   ++  +P   +FI+T  Y    +LP            +L  C 
Sbjct: 356 RLLANNGSKGLVQDVFFVILPQIPPRLTFILTIFYQILAVLPILFDPSFKRFIGSLTLCG 415

Query: 390 MSFFLFSFQVHEK 402
           ++ +LF + VHEK
Sbjct: 416 LASYLFGWHVHEK 428

>TDEL0B02540 Chr2 (459825..461534) [1710 bp, 569 aa] {ON} Anc_5.669
           YOR067C
          Length = 569

 Score =  111 bits (277), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 100/374 (26%), Positives = 160/374 (42%), Gaps = 75/374 (20%)

Query: 94  DFEAQRHWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKL--GSFFREGWFDLE 151
           DF+  R+W+ IT  LP++EWY+     W LDYPP  AY  +LL +        +G  D+ 
Sbjct: 55  DFDVHRNWLAITNELPLKEWYYEKTSQWTLDYPPFFAYFEWLLSQFVPKIVKEDGALDI- 113

Query: 152 SSRGYESLNLKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAILFQPA 211
              G        + R TVI SE+LL++   ++        +++S    ++ A++I+  P 
Sbjct: 114 VEIGQFGWPTVVFQRLTVIFSEVLLFVVLQVFVNTSSATEKTRS----FVVASSIVLSPG 169

Query: 212 LILVDHGHFQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMALYYSPIFFAYLL 271
            +++DH HFQYN  +    + ++       Y   A  + ++LCFK + LY +P +F +LL
Sbjct: 170 FLMIDHIHFQYNGFLFAPLIASIVAAKHKKYMWCATFYAIALCFKHIFLYLAPCYFVFLL 229

Query: 272 SK----------STYSPGINL---PRLFAISVSTALAFIGSFGPIYIFGGYKNLVQSMHR 318
                        +Y   I +     LF ++      F   FGP        +L Q M R
Sbjct: 230 RAYVLNFKNFEFKSYKDLIFIVQWKHLFKMASVVLGIFFICFGPFLY-----DLPQVMTR 284

Query: 319 IFPFARGIFEDKVA-NFWCVSNIFIK----------YRNLFTQK------------DLQ- 354
           +FPF+RG+     A NFW + +   K          Y + F  K            DL+ 
Sbjct: 285 LFPFSRGLTHAYWAPNFWAIYSFLDKILTFVMLKLPYVHAFATKFISPPLIPESLDDLKE 344

Query: 355 --------LYSLLATV-IGLLP------SFIITFLYPKRHLLPY-----------ALAAC 388
                      L+  V   +LP      +FI+T  Y    ++P            +L  C
Sbjct: 345 RLVQNNSGTKGLVQDVFFAILPQISPKLTFILTMFYQALAVIPLLFDPSFKRFIGSLTLC 404

Query: 389 SMSFFLFSFQVHEK 402
            +S +LF + VHEK
Sbjct: 405 GLSSYLFGWHVHEK 418

>KLLA0F16621g Chr6 complement(1531745..1533430) [1686 bp, 561 aa]
           {ON} highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 561

 Score =  110 bits (274), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 82/290 (28%), Positives = 134/290 (46%), Gaps = 26/290 (8%)

Query: 94  DFEAQRHWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKL--GSFFREGWFDLE 151
           DF+  R+W+ IT  LP+ +WY      W LDYPP  AY  + L +    S   +G  D+ 
Sbjct: 52  DFDVHRNWLAITNKLPLNKWYVESTSQWTLDYPPFFAYFEWFLSQFVPKSVAEDGCLDIV 111

Query: 152 SSRGYESLNLKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAILFQPA 211
              G   L    + R TVI+SEL+LY    ++    +           ++ A++I+  P 
Sbjct: 112 KV-GSFGLPTIIFQRITVILSELVLYAALQVF----INTSDISEKSANFVVASSIVLSPG 166

Query: 212 LILVDHGHFQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMALYYSPIFFAYLL 271
           L++VDH HFQYN  + G+ + ++    +  Y + A  F ++LCFK + LY +P +F +LL
Sbjct: 167 LLIVDHIHFQYNGFLFGILISSIVAAKNKRYILCAAFFSIALCFKHIFLYLAPAYFVFLL 226

Query: 272 SK----------STYSPGINLPR---LFAISVSTALAFIGSFGPIYIFGGYKNLVQSMHR 318
                        +Y   I++ +   L  ++      F  +F P           Q + R
Sbjct: 227 RAYVLDFSSFKFRSYKDLISIVQWSNLLKLASVVMGIFSLAFLPFI-----TTWQQLLAR 281

Query: 319 IFPFARGIFEDKVA-NFWCVSNIFIKYRNLFTQKDLQLYSLLATVIGLLP 367
           +FPF+RG+     A N W V +   K   +   K   L  +L+ V+  +P
Sbjct: 282 LFPFSRGLTHAYWAPNVWAVYSFTDKVLTVLVLKLPYLQKILSIVLTSMP 331

>Skud_15.234 Chr15 complement(413571..415304) [1734 bp, 577 aa] {ON}
           YOR067C (REAL)
          Length = 577

 Score =  109 bits (273), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 76/260 (29%), Positives = 121/260 (46%), Gaps = 26/260 (10%)

Query: 94  DFEAQRHWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKL--GSFFREGWFDLE 151
           DF+  R+W+ IT  LP+ +WY+     W LDYPP  AY  + L +        +G  D+ 
Sbjct: 66  DFDVHRNWLAITNKLPISKWYYEHTSQWTLDYPPFFAYFEWFLSQFVPKVVRDDGCLDIV 125

Query: 152 SSRGYESLNLKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAILFQPA 211
              G   L    + R TVI S++LL++   +Y        RSQS    ++ A++I+  P 
Sbjct: 126 EV-GKFGLPTIVFQRLTVIFSDILLFVVLQVYINTTDLSERSQS----FVVASSIVLSPG 180

Query: 212 LILVDHGHFQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMALYYSPIFFAYLL 271
             ++DH HFQYN  +  + + ++       Y + AI +  ++CFK + LY +P +F +LL
Sbjct: 181 FFMIDHIHFQYNGFLFAILIGSIVAAKKKRYILCAILYTTAICFKHIFLYLAPCYFVFLL 240

Query: 272 SK----------STYSPGINLPR---LFAISVSTALAFIGSFGPIYIFGGYKNLVQSMHR 318
                        +Y   + L R   LF +       F   F P         + Q + R
Sbjct: 241 RAYVLNVNNFKFKSYKDFLFLIRWANLFKLGSIVIGIFTICFLPF-----AHQMPQVLSR 295

Query: 319 IFPFARGIFEDKVA-NFWCV 337
           +FPF+RG+     A NFW +
Sbjct: 296 LFPFSRGLTHAYWAPNFWAL 315

>SAKL0G00836g Chr7 (77387..79072) [1686 bp, 561 aa] {ON} highly
           similar to uniprot|P40351 Saccharomyces cerevisiae
           YOR067C ALG8 adds glucose to the dolichol- linked
           oligosaccharide precursor prior to transfer to protein
           glycosyl transferase
          Length = 561

 Score =  109 bits (273), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 77/263 (29%), Positives = 127/263 (48%), Gaps = 20/263 (7%)

Query: 94  DFEAQRHWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGK-LGSFFRE-GWFDLE 151
           DF+  R+W+ IT  LP+REWY      W LDYPP  AY  + L + +    R+ G  D+ 
Sbjct: 48  DFDVHRNWLAITNKLPLREWYIEATSQWTLDYPPFFAYFEWFLSQFVPKIVRDDGCLDIV 107

Query: 152 SSRGYESLNLKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAILFQPA 211
              G   +    + R TVI+SE+LL++   I+  K     +S      +I A++I+  P 
Sbjct: 108 EV-GNFGMPTIIFQRITVIVSEVLLFVVLQIFINKSATNEKS----ANFIVASSIVLSPG 162

Query: 212 LILVDHGHFQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMALYYSPIFFAYLL 271
            ++VDH HFQYN  +  + +  +       Y +    F  +LCFK + LY +P FF +LL
Sbjct: 163 FLIVDHIHFQYNGFLFAILIAAIVAAKHHRYLLCGAFFATALCFKHIFLYLAPSFFVFLL 222

Query: 272 SK----------STYSPGINLPRLFAISVSTALAFIGSFGPIYIFGGYKNLVQSMHRIFP 321
                        +Y   +++ + +  ++   L  +G F   +       + Q + R+FP
Sbjct: 223 RAYILDFTNFKFKSYKDLVSIVK-WQRALKLGLVVLGIFAVCFA-PFISEMPQLLERLFP 280

Query: 322 FARGIFEDKVA-NFWCVSNIFIK 343
           F+RG+     A NFW + ++  K
Sbjct: 281 FSRGLTHAYWAPNFWALYSLLDK 303

>NDAI0F00510 Chr6 (118893..120605) [1713 bp, 570 aa] {ON} Anc_5.669
           YOR067C
          Length = 570

 Score =  108 bits (271), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 103/420 (24%), Positives = 173/420 (41%), Gaps = 81/420 (19%)

Query: 94  DFEAQRHWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKL--GSFFREGWFDLE 151
           DF+  R+W+ IT  LP++EWY+     W LDYPP  AY  + + +        +G  D+ 
Sbjct: 54  DFDVHRNWLAITNKLPLKEWYYEHTSQWTLDYPPFFAYFEWFMSQFVPKVVRDDGCLDIV 113

Query: 152 --SSRGYESLNLKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAILFQ 209
                G+ ++    + R +VIISE+LL++    +  K     R+QS    +I A +I+  
Sbjct: 114 PVGQFGWATV---VFQRTSVIISEILLFVVLQWFINKSKDNERTQS----FIVATSIILS 166

Query: 210 PALILVDHGHFQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMALYYSPIFFAY 269
           P  +++DH HFQYN  +  + + ++       Y +  + + ++LCFK + LY +P +F +
Sbjct: 167 PGFLIIDHIHFQYNGFLFAILIASIVAAKQERYLLCGLFYSIALCFKHIFLYLAPCYFVF 226

Query: 270 LLSKSTYSPGINLPRLFAISVSTALAFIGSFGPIYIFGGYK-------------NLVQSM 316
           LL        +N+   F       L  +  +  ++  GG               +L Q  
Sbjct: 227 LLRAYV----LNVKN-FKFKSYKDLILLIQWNNLFKLGGIVLSIFGICFLPFIYHLPQVF 281

Query: 317 HRIFPFARGIFEDKVA-NFWCVSNIFIKYRNLFTQKDLQLYSLLATVIG----------- 364
            R+FPF RG+     A NFW + +   K       K   ++ LL   I            
Sbjct: 282 TRLFPFGRGLTHAYWAPNFWAIYSFTDKIATTLLLKLPYVHKLLCKCIKHPLFPTTREEI 341

Query: 365 ----------------------LLP------SFIITFLYPKRHLLPY-----------AL 385
                                 +LP      SFI+T  Y    ++P            +L
Sbjct: 342 QSRIMEYGNNGSKGLVEDVYFIILPQIIPKLSFILTGFYQLLAVVPLLFDPSFKRFIGSL 401

Query: 386 AACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSRDWNVLSLVCWINNVALFTLWPLLKKDN 445
             C M+ FLF + VHEK                D  +L+    +++    +L+PLL K++
Sbjct: 402 TLCGMASFLFGWHVHEKAILLVIIPFSFLVVC-DRRLLTSFMLVSSAGYVSLFPLLYKND 460

>Kpol_1018.73 s1018 complement(205615..207480) [1866 bp, 621 aa]
           {ON} complement(205615..207480) [1866 nt, 622 aa]
          Length = 621

 Score =  108 bits (270), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 81/261 (31%), Positives = 126/261 (48%), Gaps = 28/261 (10%)

Query: 94  DFEAQRHWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGK-LGSFFRE-GWFDLE 151
           DF+  R+WM IT  LP+ +WY+ +   W LDYPP  AY  + L + +    R+ G  D+ 
Sbjct: 109 DFDVHRNWMAITNALPISKWYFENTSQWTLDYPPFFAYFEWFLSQFVPKIVRDDGCLDIV 168

Query: 152 SSRGYESLNLKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAILFQPA 211
              G        + R TVIISE+ L+     Y        R+QS    ++ A++I+  P 
Sbjct: 169 EV-GQFGWPTVVFQRLTVIISEICLFAVLQYYINTSNLNERTQS----FVVASSIVLSPG 223

Query: 212 LILVDHGHFQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMALYYSPIFFAYLL 271
            ++VDH HFQYN  +  + + ++       Y   A+ + ++LCFK + LY +P +F +LL
Sbjct: 224 FLIVDHIHFQYNAFLFSILIASIVAAKQKKYIACAVFYTIALCFKHIFLYLAPCYFVFLL 283

Query: 272 SK----------STYSPGINL---PRLFAISVSTALAFIG-SFGPIYIFGGYKNLVQSMH 317
                        +Y   I +    RL  +  S  L   G  F P +IF     + Q + 
Sbjct: 284 RAYVLNFKDFKFKSYKDLIFIVQWRRLLKLG-SIVLGIFGICFAP-FIF----QMPQVLS 337

Query: 318 RIFPFARGIFEDKVA-NFWCV 337
           R+FPF+RG+     A NFW +
Sbjct: 338 RLFPFSRGLTHAYWAPNFWAI 358

>Ecym_4051 Chr4 (109310..111124) [1815 bp, 604 aa] {ON} similar to
           Ashbya gossypii ADR210C
          Length = 604

 Score =  103 bits (257), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 79/265 (29%), Positives = 123/265 (46%), Gaps = 36/265 (13%)

Query: 94  DFEAQRHWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKL--GSFFREGWFDL- 150
           D E  R+W+ +T  LP+ +WY      W LDYPP  AY  ++L +        +G  D+ 
Sbjct: 93  DLEVHRNWLALTNKLPLLDWYREATSQWTLDYPPFFAYFEWVLSQFVPAVVRDDGCLDIV 152

Query: 151 -ESSRGYESLNLKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAILFQ 209
            E   G+ ++    ++R TVI +E+LL++   ++        R+ +    +I A++I   
Sbjct: 153 KEGKFGWPTV---VFLRLTVIGTEILLFVVLQVFINTSDESERTVN----FIIASSIALS 205

Query: 210 PALILVDHGHFQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMALYYSPIFFAY 269
           P  ++VDH HFQYN  +  + + ++       Y +    F   LCFK + LY +P +F +
Sbjct: 206 PGFLIVDHMHFQYNGFLFAILIASIVAAKKERYLLCGAFFTTVLCFKHIFLYLAPAYFTF 265

Query: 270 LL----------SKSTYSPGI------NLPRLFAISVSTALAFIGSFGPIYIFGGYKNLV 313
           LL          S  TY   I      NL +L  I VS        F P+        L 
Sbjct: 266 LLRAYVLNFSNFSFRTYRDLIFVVRWFNLLKLGVIIVSILAVCFVPFIPV--------LP 317

Query: 314 QSMHRIFPFARGIFEDKVA-NFWCV 337
           Q + R+FPF+RG+     A NFW V
Sbjct: 318 QLISRLFPFSRGLTHAYWAPNFWAV 342

>TBLA0H03760 Chr8 complement(913973..915064) [1092 bp, 363 aa] {ON}
           Anc_8.564 YBR183W
          Length = 363

 Score = 30.8 bits (68), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 22/37 (59%)

Query: 423 LSLVCWINNVALFTLWPLLKKDNLVLQYGVMFMFSNW 459
           +  VCWI + A+   W  L+++ ++L +GV+F    W
Sbjct: 223 VGFVCWIFDKAMCGFWRNLRRNYILLPFGVLFELHGW 259

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.329    0.142    0.464 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,041,429
Number of extensions: 2475894
Number of successful extensions: 7547
Number of sequences better than 10.0: 56
Number of HSP's gapped: 7587
Number of HSP's successfully gapped: 56
Length of query: 566
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 451
Effective length of database: 40,294,809
Effective search space: 18172958859
Effective search space used: 18172958859
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 68 (30.8 bits)