Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D01155g6.21ON33533513710.0
SAKL0E01210g6.21ON3233309331e-125
Kwal_56.224336.21ON3223328681e-115
Ecym_30256.21ON3183298101e-107
KLTH0C11220g6.21ON3273328101e-107
KAFR0L004106.21ON3313438061e-106
TPHA0J003406.21ON3383378001e-105
TDEL0G044806.21ON3433427921e-104
Kpol_1037.266.21ON3423387841e-102
ACR005W6.21ON3273307801e-102
YOR007C (SGT2)6.21ON3463447751e-101
CAGL0E02739g6.21ON3433287741e-101
Smik_15.1766.21ON3453427721e-100
Skud_15.1686.21ON3483397691e-100
NCAS0H008306.21ON3383357598e-99
Suva_15.1826.21ON3463487572e-98
ZYRO0C07788g6.21ON3343277422e-96
KNAG0M011706.21ON3393397414e-96
NDAI0D008106.21ON3493417061e-90
TBLA0G010506.21ON3503376661e-84
Kpol_1032.86.21ON3433374642e-54
NCAS0D026706.21ON3512243596e-39
NDAI0I022406.21ON3502153307e-35
TPHA0M002706.21ON3772612951e-29
TBLA0A072706.21ON3732552642e-25
NDAI0F009105.617ON583942436e-22
TBLA0E033005.617ON582952392e-21
CAGL0H08195g5.617ON583952365e-21
SAKL0G07084g5.617ON585952322e-20
Smik_15.2055.617ON589952295e-20
TPHA0D028805.617ON585952295e-20
Kwal_55.199355.617ON593952251e-19
YOR027W (STI1)5.617ON589952252e-19
KAFR0C058905.617ON575942242e-19
ZYRO0A05676g5.617ON572952242e-19
Kpol_1018.695.617ON590952207e-19
AEL224W5.617ON580952171e-18
KNAG0B032005.617ON579952144e-18
Skud_15.1925.617ON589962144e-18
TDEL0A048405.617ON576942135e-18
KLTH0E02178g5.617ON593942126e-18
NCAS0G008105.617ON584952118e-18
Suva_8.805.617ON586952082e-17
KLLA0A07062g5.617ON581952038e-17
Ecym_55825.617ON584951967e-16
NCAS0A00490singletonON620921763e-13
Ecym_44133.481ON510981639e-12
SAKL0F03102g3.481ON5131081551e-10
NDAI0B057903.481ON523981522e-10
KAFR0B066103.481ON5111141523e-10
Smik_6.2153.481ON513761487e-10
Kwal_27.118908.506ON3341011477e-10
YGR123C (PPT1)3.481ON513761489e-10
KLTH0B05170g2.152ON593681471e-09
Suva_7.4083.481ON513761471e-09
Skud_7.4323.481ON513761462e-09
KLTH0F14542g3.481ON5131081452e-09
KLLA0F24046g2.152ON604681452e-09
CAGL0D05060g3.481ON510761433e-09
AAR083C3.481ON5381011434e-09
TDEL0D055003.481ON5121081424e-09
Kpol_505.413.481ON5131081415e-09
KNAG0A039508.506ON386991398e-09
NCAS0F034903.481ON512981408e-09
KNAG0A079003.481ON512761409e-09
Kwal_33.147672.152ON594831391e-08
TBLA0C039503.481ON5121081391e-08
NCAS0B024008.506ON380861371e-08
Kwal_55.211753.481ON511931381e-08
CAGL0H07425g8.506ON3801181362e-08
YHR117W (TOM71)2.152ON639831363e-08
SAKL0H10934g8.506ON380891353e-08
TBLA0C055302.152ON610681354e-08
Skud_8.1782.152ON638831336e-08
Ecym_82042.152ON597761328e-08
YBR155W (CNS1)8.506ON385891319e-08
NDAI0F028102.152ON609761311e-07
Smik_2.2958.506ON385891301e-07
SAKL0E10956g2.152ON600761302e-07
Suva_15.3142.152ON644831292e-07
KAFR0E029808.506ON380891272e-07
AGL268C8.506ON379991273e-07
ZYRO0B04224g3.481ON5131081283e-07
TPHA0D032203.481ON513721273e-07
Skud_2.2828.506ON385891264e-07
KLLA0B10912g3.481ON512681264e-07
Smik_8.1952.152ON635831264e-07
TDEL0B013108.506ON380861255e-07
Suva_4.4058.506ON385891255e-07
NCAS0B070102.152ON625831256e-07
NCAS0G024802.152ON596941231e-06
ABR131W2.152ON594761203e-06
NDAI0C052908.506ON379871193e-06
ZYRO0F08624g8.506ON379991183e-06
Kpol_513.28.506ON374891174e-06
YNL121C (TOM70)2.152ON617831168e-06
KLTH0E11748g8.506ON3781151141e-05
Ecym_25598.506ON370861141e-05
TDEL0B051402.152ON599961142e-05
Skud_14.2112.152ON617681142e-05
Smik_14.2072.152ON617681122e-05
CAGL0L12936g2.152ON600681122e-05
ZYRO0G06512g2.152ON604961122e-05
Suva_14.2192.152ON617681122e-05
TBLA0F032203.395ON536651123e-05
KNAG0I025206.328ON117851033e-05
NDAI0B043402.152ON664951104e-05
Kpol_1048.212.152ON597831104e-05
KNAG0H035302.152ON614681095e-05
NCAS0I008703.395ON585681088e-05
CAGL0L04048g2.152ON587641071e-04
TBLA0H033808.506ON3751211052e-04
KLLA0B09966g8.506ON3701191023e-04
YCR060W (TAH1)6.328ON11161929e-04
KAFR0F007202.152ON60883990.001
NCAS0E024907.412ON809126990.001
CAGL0K09240g6.328ON14263930.001
ADR230W5.689ON685100980.001
TPHA0L014208.506ON37486960.002
TBLA0I023106.328ON11658900.002
TPHA0I015102.152ON60368940.004
KAFR0B002507.546ON1420108940.004
SAKL0E14542g5.689ON69062940.004
TPHA0E007407.412ON74691930.005
Kpol_1043.605.689ON70698930.006
CAGL0K11209g8.470ON59092920.007
Skud_3.1356.328ON11857860.007
KLLA0E20857g7.412ON71087910.010
YNL313C (EMW1)3.32ON90497910.011
KAFR0J025706.328ON12186840.013
NDAI0F004005.689ON76469900.014
NCAS0C044903.32ON91897900.015
Smik_2.2543.367ON102079890.018
Kwal_23.54087.546ON141066890.018
CAGL0E01573g3.32ON904104890.019
Skud_2.2403.367ON98479880.022
ZYRO0B03828g7.412ON72791880.025
Suva_4.3613.367ON96379880.025
NDAI0C051308.470ON59093870.025
KNAG0H006103.367ON97379880.027
TPHA0D038606.328ON12077810.030
YBR112C (CYC8)3.367ON96679870.031
Smik_3.1596.328ON11572810.035
KNAG0B012903.395ON53771860.039
Suva_14.263.32ON90497860.040
KLTH0F18150g5.689ON68983860.041
CAGL0K07986g3.395ON53267840.057
KNAG0A041208.470ON602102840.059
YBL084C (CDC27)7.412ON758125840.062
KLTH0A00638g7.546ON141179840.068
AFR453W8.470ON56971830.074
KNAG0F040107.546ON141886830.097
Kpol_1031.648.470ON60768820.11
TBLA0D004607.412ON83599820.11
CAGL0C01903g7.412ON76991820.11
KLLA0C08910g6.328ON11556770.11
NDAI0G038703.32ON927104820.12
Smik_14.183.32ON90497820.13
Skud_2.247.412ON769125810.15
AEL281C7.546ON139079810.15
Ecym_13968.470ON57371810.15
Kpol_1018.1067.412ON75391810.17
NDAI0E040407.412ON783126810.17
Kpol_1028.516.328ON11751760.18
Smik_2.367.412ON751125800.18
Ecym_40315.689ON68862800.21
NCAS0B025608.470ON57892800.21
Suva_3.956.328ON11182740.23
Ecym_20906.328ON17256760.26
ZYRO0C02970g3.32ON896104790.31
KLLA0D09020g3.395ON53030780.31
TDEL0B016608.470ON54991780.32
Suva_2.347.412ON763125780.33
Skud_4.5068.470ON61183780.33
AGL294W7.412ON656103780.35
TBLA0B079705.72ON68791780.36
SAKL0A01672g6.328ON12858740.37
Smik_4.4918.470ON61267780.40
Suva_2.4108.470ON61183770.40
YDR244W (PEX5)8.470ON61267770.44
KNAG0B022407.412ON73987770.45
Skud_14.263.32ON93297770.46
Ecym_71427.412ON675103770.48
AAR054C6.328ON13358730.48
Kpol_1050.1127.546ON136057770.49
Kwal_55.218395.689ON69082770.50
Kwal_14.8742.665ON722105770.54
Suva_16.5217.546ON142479770.56
Suva_16.4173.395ON53965760.60
NCAS0A153007.546ON139863760.62
KLLA0C15455g8.470ON56692760.64
Kpol_172.23.367ON41879750.71
Kwal_27.117378.470ON57567750.72
Kwal_23.36703.367ON80279750.82
TBLA0B086803.32ON91497750.92
TBLA0H019705.352ON84063750.95
KLTH0C06204g7.412ON627103740.95
TBLA0H015203.367ON689101740.96
KLTH0E10934g8.470ON56867740.98
TDEL0C027207.412ON700126741.1
NDAI0A081703.395ON53976731.3
Ecym_20333.32ON909104741.3
Ecym_50925.72ON626100731.3
SAKL0D11110g1.456ON43294731.4
KLTH0F10428g3.367ON79579731.4
ADL344W3.367ON91079731.5
Ecym_34593.367ON111579731.6
ABR206W5.72ON61487721.7
ZYRO0A02926g8.470ON57768721.8
SAKL0H11946g8.470ON57371721.9
TPHA0B014107.458ON298133711.9
KAFR0L018707.412ON71269721.9
ZYRO0C16522g3.367ON97479722.0
TBLA0C010102.665ON86464722.1
CAGL0M08030g1.456ON38794712.2
CAGL0J09570g8.470ON54961712.3
TPHA0G004305.689ON72856712.4
TBLA0A041708.359ON954126712.6
TDEL0C050903.367ON75979703.0
SAKL0H02244g5.72ON628104703.1
TDEL0B076002.665ON75295703.1
Kwal_27.107407.412ON62891703.1
KLTH0C00572g2.665ON720104703.4
TPHA0L012108.470ON58868703.5
KNAG0E006805.72ON639100703.5
KLLA0E07239g3.32ON89696703.7
ZYRO0D00572g2.665ON785115703.8
TBLA0A016908.470ON66297693.9
SAKL0F12936g7.412ON63291694.0
CAGL0L09823g2.665ON74359694.2
SAKL0C13068g3.32ON90297694.6
CAGL0D01364g3.367ON114879694.8
CAGL0I02288g5.72ON63999685.5
YKL022C (CDC16)2.665ON84066685.8
KLLA0C02453g1.88ON102878686.5
NDAI0C033505.72ON64993678.0
NCAS0G003505.689ON69857678.3
TDEL0A074306.328ON12453638.6
NCAS0D045006.328ON12156639.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D01155g
         (335 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {...   532   0.0  
SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...   363   e-125
Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {O...   338   e-115
Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON} si...   316   e-107
KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar...   316   e-107
KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}...   315   e-106
TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...   312   e-105
TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.2...   309   e-104
Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {O...   306   e-102
ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic hom...   305   e-102
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...   303   e-101
CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {...   302   e-101
Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {...   301   e-100
Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {...   300   e-100
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...   296   8e-99
Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {...   296   2e-98
ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} simila...   290   2e-96
KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {...   290   4e-96
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...   276   1e-90
TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {O...   261   1e-84
Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON...   183   2e-54
NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {O...   142   6e-39
NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.2...   131   7e-35
TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON...   118   1e-29
TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa] ...   106   2e-25
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}     98   6e-22
TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {O...    97   2e-21
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...    96   5e-21
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...    94   2e-20
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...    93   5e-20
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...    93   5e-20
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...    91   1e-19
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...    91   2e-19
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...    91   2e-19
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...    91   2e-19
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    89   7e-19
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...    88   1e-18
KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {O...    87   4e-18
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    87   4e-18
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    87   5e-18
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    86   6e-18
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    86   8e-18
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    85   2e-17
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    83   8e-17
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    80   7e-16
NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON}       72   3e-13
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    67   9e-12
SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly...    64   1e-10
NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa] ...    63   2e-10
KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON} Anc_3...    63   3e-10
Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON...    62   7e-10
Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155...    61   7e-10
YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}  ...    62   9e-10
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...    61   1e-09
Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON...    61   1e-09
Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON...    61   2e-09
KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]...    60   2e-09
KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...    60   2e-09
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    60   3e-09
AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON} S...    60   4e-09
TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {O...    59   4e-09
Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}...    59   5e-09
KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {O...    58   8e-09
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    59   8e-09
KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa] ...    59   9e-09
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...    58   1e-08
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    58   1e-08
NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {O...    57   1e-08
Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {...    58   1e-08
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    57   2e-08
YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}  TOM71Mitoc...    57   3e-08
SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {...    57   3e-08
TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa] ...    57   4e-08
Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W ...    56   6e-08
Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}...    55   8e-08
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    55   9e-08
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...    55   1e-07
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    55   1e-07
SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} simila...    55   2e-07
Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117...    54   2e-07
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    54   2e-07
AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON} S...    54   3e-07
ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly...    54   3e-07
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    54   3e-07
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    53   4e-07
KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} simila...    53   4e-07
Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W ...    53   4e-07
TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {O...    53   5e-07
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    53   5e-07
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...    53   6e-07
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...    52   1e-06
ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic ho...    51   3e-06
NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON} Anc_8...    50   3e-06
ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} simila...    50   3e-06
Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)...    50   4e-06
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...    49   8e-06
KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} simi...    49   1e-05
Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar...    49   1e-05
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...    49   2e-05
Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...    49   2e-05
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...    48   2e-05
CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON} sim...    48   2e-05
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...    48   2e-05
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...    48   2e-05
TBLA0F03220 Chr6 complement(782214..783824) [1611 bp, 536 aa] {O...    48   3e-05
KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON...    44   3e-05
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...    47   4e-05
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...    47   4e-05
KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...    47   5e-05
NCAS0I00870 Chr9 (160192..161949) [1758 bp, 585 aa] {ON} Anc_3.3...    46   8e-05
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...    46   1e-04
TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.5...    45   2e-04
KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {...    44   3e-04
YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Compone...    40   9e-04
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...    43   0.001
NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {O...    43   0.001
CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {...    40   0.001
ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic ...    42   0.001
TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8....    42   0.002
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    39   0.002
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...    41   0.004
KAFR0B00250 Chr2 complement(58608..62870) [4263 bp, 1420 aa] {ON...    41   0.004
SAKL0E14542g Chr5 (1199439..1201511) [2073 bp, 690 aa] {ON} weak...    41   0.004
TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {O...    40   0.005
Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON} (1235...    40   0.006
CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON} sim...    40   0.007
Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W (...    38   0.007
KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} simi...    40   0.010
YNL313C Chr14 complement(45308..48022) [2715 bp, 904 aa] {ON}  E...    40   0.011
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    37   0.013
NDAI0F00400 Chr6 complement(96274..98568) [2295 bp, 764 aa] {ON}...    39   0.014
NCAS0C04490 Chr3 complement(919665..922421) [2757 bp, 918 aa] {O...    39   0.015
Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {O...    39   0.018
Kwal_23.5408 s23 (1146253..1150485) [4233 bp, 1410 aa] {ON} YPR1...    39   0.018
CAGL0E01573g Chr5 complement(149084..151798) [2715 bp, 904 aa] {...    39   0.019
Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON...    39   0.022
ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} simila...    39   0.025
Suva_4.361 Chr4 complement(631697..632812,632933..633154,633188....    39   0.025
NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON} Anc_8...    38   0.025
KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.36...    39   0.027
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    36   0.030
YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}  ...    38   0.031
Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W (...    36   0.035
KNAG0B01290 Chr2 (244938..246551) [1614 bp, 537 aa] {ON} Anc_3.3...    38   0.039
Suva_14.26 Chr14 complement(41582..44296) [2715 bp, 904 aa] {ON}...    38   0.040
KLTH0F18150g Chr6 (1462613..1464682) [2070 bp, 689 aa] {ON} weak...    38   0.041
CAGL0K07986g Chr11 complement(792641..794239) [1599 bp, 532 aa] ...    37   0.057
KNAG0A04120 Chr1 complement(556919..558727) [1809 bp, 602 aa] {O...    37   0.059
YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}  CD...    37   0.062
KLTH0A00638g Chr1 complement(63363..67598) [4236 bp, 1411 aa] {O...    37   0.068
AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic ...    37   0.074
KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7....    37   0.097
Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON} (1611...    36   0.11 
TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {O...    36   0.11 
CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {...    36   0.11 
KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {O...    34   0.11 
NDAI0G03870 Chr7 complement(926437..929220) [2784 bp, 927 aa] {O...    36   0.12 
Smik_14.18 Chr14 complement(29815..32529) [2715 bp, 904 aa] {ON}...    36   0.13 
Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON} Y...    36   0.15 
AEL281C Chr5 complement(111535..115707) [4173 bp, 1390 aa] {ON} ...    36   0.15 
Ecym_1396 Chr1 (820413..822134) [1722 bp, 573 aa] {ON} similar t...    36   0.15 
Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON} (280...    36   0.17 
NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.4...    36   0.17 
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    34   0.18 
Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON} Y...    35   0.18 
Ecym_4031 Chr4 complement(73900..75966) [2067 bp, 688 aa] {ON} s...    35   0.21 
NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {O...    35   0.21 
Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W (R...    33   0.23 
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    34   0.26 
ZYRO0C02970g Chr3 (230414..233104) [2691 bp, 896 aa] {ON} simila...    35   0.31 
KLLA0D09020g Chr4 (758818..760410) [1593 bp, 530 aa] {ON} simila...    35   0.31 
TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {O...    35   0.32 
Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 7...    35   0.33 
Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W ...    35   0.33 
AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic ho...    35   0.35 
TBLA0B07970 Chr2 (1887119..1889182) [2064 bp, 687 aa] {ON} Anc_5...    35   0.36 
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    33   0.37 
Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W ...    35   0.40 
Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W ...    34   0.40 
YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}  PEX5Peroxi...    34   0.44 
KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {O...    34   0.45 
Skud_14.26 Chr14 complement(38826..41624) [2799 bp, 932 aa] {ON}...    34   0.46 
Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}...    34   0.48 
AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON} Sy...    33   0.48 
Kpol_1050.112 s1050 (249717..252797,252855..252863,252906..25389...    34   0.49 
Kwal_55.21839 s55 (998426..1000498) [2073 bp, 690 aa] {ON} YOR08...    34   0.50 
Kwal_14.874 s14 complement(90148..92316) [2169 bp, 722 aa] {ON} ...    34   0.54 
Suva_16.521 Chr16 (895057..899331) [4275 bp, 1424 aa] {ON} YPR18...    34   0.56 
Suva_16.417 Chr16 complement(718714..720333) [1620 bp, 539 aa] {...    34   0.60 
NCAS0A15300 Chr1 (3006855..3011051) [4197 bp, 1398 aa] {ON}            34   0.62 
KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} simi...    34   0.64 
Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)...    33   0.71 
Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244...    33   0.72 
Kwal_23.3670 s23 (387536..389944) [2409 bp, 802 aa] {ON} YBR112C...    33   0.82 
TBLA0B08680 Chr2 (2070444..2073188) [2745 bp, 914 aa] {ON} Anc_3...    33   0.92 
TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.3...    33   0.95 
KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {...    33   0.95 
TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.3...    33   0.96 
KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} simila...    33   0.98 
TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.4...    33   1.1  
NDAI0A08170 Chr1 complement(1870449..1872068) [1620 bp, 539 aa] ...    33   1.3  
Ecym_2033 Chr2 complement(51082..53811) [2730 bp, 909 aa] {ON} s...    33   1.3  
Ecym_5092 Chr5 complement(208478..210358) [1881 bp, 626 aa] {ON}...    33   1.3  
SAKL0D11110g Chr4 (920630..921928) [1299 bp, 432 aa] {ON} simila...    33   1.4  
KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly...    33   1.4  
ADL344W Chr4 (103565..106297) [2733 bp, 910 aa] {ON} Syntenic ho...    33   1.5  
Ecym_3459 Chr3 (864878..868225) [3348 bp, 1115 aa] {ON} similar ...    33   1.6  
ABR206W Chr2 (787387..789231) [1845 bp, 614 aa] {ON} Syntenic ho...    32   1.7  
ZYRO0A02926g Chr1 complement(238036..239769) [1734 bp, 577 aa] {...    32   1.8  
SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]...    32   1.9  
TPHA0B01410 Chr2 (318162..319058) [897 bp, 298 aa] {ON} Anc_7.45...    32   1.9  
KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7....    32   1.9  
ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]...    32   2.0  
TBLA0C01010 Chr3 (198773..201367) [2595 bp, 864 aa] {ON} Anc_2.6...    32   2.1  
CAGL0M08030g Chr13 complement(800149..801312) [1164 bp, 387 aa] ...    32   2.2  
CAGL0J09570g Chr10 complement(941571..943220) [1650 bp, 549 aa] ...    32   2.3  
TPHA0G00430 Chr7 complement(77860..80046) [2187 bp, 728 aa] {ON}...    32   2.4  
TBLA0A04170 Chr1 (1030218..1033082) [2865 bp, 954 aa] {ON} Anc_8...    32   2.6  
TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {O...    32   3.0  
SAKL0H02244g Chr8 (216327..218213) [1887 bp, 628 aa] {ON} simila...    32   3.1  
TDEL0B07600 Chr2 (1331773..1334031) [2259 bp, 752 aa] {ON} Anc_2...    32   3.1  
Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {...    32   3.1  
KLTH0C00572g Chr3 complement(57378..59540) [2163 bp, 720 aa] {ON...    32   3.4  
TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8....    32   3.5  
KNAG0E00680 Chr5 complement(122876..124795) [1920 bp, 639 aa] {O...    32   3.5  
KLLA0E07239g Chr5 complement(655635..658325) [2691 bp, 896 aa] {...    32   3.7  
ZYRO0D00572g Chr4 complement(42511..44830,45510..45547) [2358 bp...    32   3.8  
TBLA0A01690 Chr1 complement(404419..406407) [1989 bp, 662 aa] {O...    31   3.9  
SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} simi...    31   4.0  
CAGL0L09823g Chr12 (1052444..1054675) [2232 bp, 743 aa] {ON} som...    31   4.2  
SAKL0C13068g Chr3 (1159968..1162676) [2709 bp, 902 aa] {ON} simi...    31   4.6  
CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} simil...    31   4.8  
CAGL0I02288g Chr9 complement(203605..205524) [1920 bp, 639 aa] {...    31   5.5  
YKL022C Chr11 complement(394726..397248) [2523 bp, 840 aa] {ON} ...    31   5.8  
KLLA0C02453g Chr3 complement(216740..219826) [3087 bp, 1028 aa] ...    31   6.5  
NDAI0C03350 Chr3 complement(769764..771713) [1950 bp, 649 aa] {O...    30   8.0  
NCAS0G00350 Chr7 complement(60735..62831) [2097 bp, 698 aa] {ON}...    30   8.3  
TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6....    29   8.6  
NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.32...    29   9.1  

>KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 335

 Score =  532 bits (1371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/335 (80%), Positives = 271/335 (80%)

Query: 1   MSLSNKEIAALIVDFLXXXXXXVNEDYVDSLNVAIDCITEAFQFERDETDSLISGPFNGK 60
           MSLSNKEIAALIVDFL      VNEDYVDSLNVAIDCITEAFQFERDETDSLISGPFNGK
Sbjct: 1   MSLSNKEIAALIVDFLSSSSSSVNEDYVDSLNVAIDCITEAFQFERDETDSLISGPFNGK 60

Query: 61  KLPELLASAPSSGGVSGEPVKVHIPVEDXXXXXXXXXXXXQGNKAMAAKKFDEAIEKYTA 120
           KLPELLASAPSSGGVSGEPVKVHIPVED            QGNKAMAAKKFDEAIEKYTA
Sbjct: 61  KLPELLASAPSSGGVSGEPVKVHIPVEDAAAKAKAEELKLQGNKAMAAKKFDEAIEKYTA 120

Query: 121 AIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNKPE 180
           AIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNKPE
Sbjct: 121 AIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNKPE 180

Query: 181 EALDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNLXXXXXXXXXXXXXXXXXTEXXX 240
           EALDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNL                 TE   
Sbjct: 181 EALDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNLEKSSTSASSEDVSDKSATEGPG 240

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXXXXNNPQVMQAAEKMMQNPGLMQDMMSNPAMKQMANQ 300
                                     NNPQVMQAAEKMMQNPGLMQDMMSNPAMKQMANQ
Sbjct: 241 AGAGGLPDLSSLLGGGGLGGGLGALLNNPQVMQAAEKMMQNPGLMQDMMSNPAMKQMANQ 300

Query: 301 FSSGGGMPDLSQMMNDPSIRDMAKNMFGGGNGSQQ 335
           FSSGGGMPDLSQMMNDPSIRDMAKNMFGGGNGSQQ
Sbjct: 301 FSSGGGMPDLSQMMNDPSIRDMAKNMFGGGNGSQQ 335

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score =  363 bits (933), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 188/330 (56%), Positives = 227/330 (68%), Gaps = 11/330 (3%)

Query: 1   MSLSNKEIAALIVDFLXXX--XXXVNEDYVDSLNVAIDCITEAFQFERDETDSLISGPFN 58
           M+ SNKEIAALIVDFL        V+EDY DSLNVAIDCI+EAF+FERD    ++   F+
Sbjct: 1   MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIVKNSFD 60

Query: 59  GKKLPELLASAPSSGGVSGEPVKVHIPVEDXXXXXXXXXXXXQGNKAMAAKKFDEAIEKY 118
            +KL ELL SA ++     EPVKV+IP ED            QGNKAMA+K F+ AI+KY
Sbjct: 61  NRKLDELLKSAATALPTQSEPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFETAIKKY 120

Query: 119 TAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNK 178
           T AIEV PSNAVYY+NRAAAYSSLK+YE++V+DAE AI+V+P+YSKG+SRLGFAKYAL K
Sbjct: 121 TEAIEVLPSNAVYYANRAAAYSSLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYALGK 180

Query: 179 PEEALDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNLXXXXXXXXXXXXXXXXXTEX 238
           PEEAL+AYK VLDIEG+KATDVMKRDYETAK+KVE S+NL                  E 
Sbjct: 181 PEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKSVPTQTD---------EQ 231

Query: 239 XXXXXXXXXXXXXXXXXXXXXXXXXXXXNNPQVMQAAEKMMQNPGLMQDMMSNPAMKQMA 298
                                       NNPQVM AA+K+MQNPG M +MM NPA++QMA
Sbjct: 232 ESSTDAGAGASGFPDMASLLGGGLGGLLNNPQVMSAAQKLMQNPGAMDEMMKNPAVRQMA 291

Query: 299 NQFSSGGGMPDLSQMMNDPSIRDMAKNMFG 328
             FSSGGG P+L  +M++P+I+DMAKN+FG
Sbjct: 292 ENFSSGGGTPNLGDLMSNPAIKDMAKNLFG 321

>Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {ON}
           YOR007C (SGT2) - small glutamine-rich tetratricopeptide
           repeat containing protein [contig 185] FULL
          Length = 322

 Score =  338 bits (868), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 176/332 (53%), Positives = 224/332 (67%), Gaps = 14/332 (4%)

Query: 1   MSLSNKEIAALIVDFLXXXX--XXVNEDYVDSLNVAIDCITEAFQFERDETDSLISGPFN 58
           MS SNK++A LIVDFL        V+EDYVDSLNVAIDCITEAF+F+R+   + +   F 
Sbjct: 1   MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKTFA 60

Query: 59  GKKLPELLASAPSSGGVSGEPVKVHIPVEDXXXXXXXXXXXXQGNKAMAAKKFDEAIEKY 118
           G+ L +++ +A        E VKV+IPVED            +GNKAMAAK F++A+ KY
Sbjct: 61  GRSLKQVVEAASVGSSSPQESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQAVLKY 120

Query: 119 TAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNK 178
           + AI+V P+NAVYY+NRAAA+SSLK+YE+AVKDAE AI+V+P+YSKG+SRLGFA+YAL K
Sbjct: 121 SEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALGK 180

Query: 179 PEEALDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNLXXXXXXXXXXXXXXXXXTEX 238
           PEEALDAYKKVLDIEGE ATD MKRDY+TA KKV  S+N+                 +  
Sbjct: 181 PEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQSLNVEKSAPAATRDGAGSATGSG- 239

Query: 239 XXXXXXXXXXXXXXXXXXXXXXXXXXXXNNPQVMQAAEKMMQNPGLMQDMMSNPAMKQMA 298
                                       NNPQ+MQAA++MMQNP  MQ++M+NPA+KQMA
Sbjct: 240 -----------GLPDISSMLGGGLGGLLNNPQLMQAAQQMMQNPNAMQEVMNNPAVKQMA 288

Query: 299 NQFSSGGGMPDLSQMMNDPSIRDMAKNMFGGG 330
            +F SGGG P ++ +MN+P++ DMAKNMFGGG
Sbjct: 289 EKFQSGGGTPSMADLMNNPALMDMAKNMFGGG 320

>Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON}
           similar to Ashbya gossypii ACR005W
          Length = 318

 Score =  316 bits (810), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 166/329 (50%), Positives = 211/329 (64%), Gaps = 14/329 (4%)

Query: 1   MSLSNKEIAALIVDFLXXXXXXVNEDYVDSLNVAIDCITEAFQFERDETDSLISGPFNGK 60
           M  SNKEIAALIV FL      V E+YVDSLNVAIDCI EAF+ ER++++ ++S  +NG+
Sbjct: 1   MPGSNKEIAALIVQFLSTSTKDVQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKAYNGR 60

Query: 61  KLPELLASAPSSGGVSG-EPVKVHIPVEDXXXXXXXXXXXXQGNKAMAAKKFDEAIEKYT 119
            L +L+ S  S   +S  EP   +                 +GNKA AAK F+ A++KYT
Sbjct: 61  GLVDLVKSGASEPTLSSSEPTGNNTDAHAPEVAERAENLKLEGNKAFAAKDFEGAVKKYT 120

Query: 120 AAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNKP 179
            AIE+ P+NAV+Y NRAAAYSS K++E+AV+DAE A+ ++P+YS+G+SRLG AKYAL KP
Sbjct: 121 EAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKP 180

Query: 180 EEALDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNLXXXXXXXXXXXXXXXXXTEXX 239
           EEA++AYKKVLDIEG+ AT+ MKRDYE+AKKKVE S+NL                     
Sbjct: 181 EEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNLEALPKG-------------EE 227

Query: 240 XXXXXXXXXXXXXXXXXXXXXXXXXXXNNPQVMQAAEKMMQNPGLMQDMMSNPAMKQMAN 299
                                      NNPQVMQAA+KMMQNP  MQ+MM+NPA+KQMA 
Sbjct: 228 QQTSEGSSAGGFPDLSSMLGGGLGGLLNNPQVMQAAQKMMQNPSAMQEMMNNPAIKQMAQ 287

Query: 300 QFSSGGGMPDLSQMMNDPSIRDMAKNMFG 328
            F+SGGG P+L  MM DP+I+DMA   FG
Sbjct: 288 NFASGGGTPNLGDMMKDPNIKDMAGKFFG 316

>KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar to
           uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 327

 Score =  316 bits (810), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 171/332 (51%), Positives = 219/332 (65%), Gaps = 11/332 (3%)

Query: 1   MSLSNKEIAALIVDFLXXXX--XXVNEDYVDSLNVAIDCITEAFQFERDETDSLISGPFN 58
           M+ + KE+A+LI+D+L        + EDY+DSLNVAIDC+TEAF+ E++   S+I   F 
Sbjct: 1   MNPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKSFG 60

Query: 59  GKKLPELL-ASAPSSGGVSGEPVKVHIPVEDXXXXXXXXXXXXQGNKAMAAKKFDEAIEK 117
           G+ L +++ AS+        EPVKV+IPVED            +GNKAMA K F+ AI K
Sbjct: 61  GQSLEQIVGASSKGPTATQQEPVKVNIPVEDAEIKAKAEALKLEGNKAMATKDFEHAISK 120

Query: 118 YTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALN 177
           Y+ AI   PSNAVY++NRAAAYSSLK+Y +AV+DAE AI+V+P+YSKG+SRLGFA+YAL 
Sbjct: 121 YSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALG 180

Query: 178 KPEEALDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNLXXXXXXXXXXXXXXXXXTE 237
           +PEEALDAYKKVLDIEG  ATD MKRDY+TA KKVE S+N+                  E
Sbjct: 181 RPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNV--------ERSAPAASNAE 232

Query: 238 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXNNPQVMQAAEKMMQNPGLMQDMMSNPAMKQM 297
                                         NPQVMQAA++MMQNP  MQ+MMSNPA+KQM
Sbjct: 233 SPDAAGGSGFPDIASMLGGGLGGGLGGLLKNPQVMQAAQQMMQNPNAMQEMMSNPAIKQM 292

Query: 298 ANQFSSGGGMPDLSQMMNDPSIRDMAKNMFGG 329
           A++F SGGG P ++ +MN+P++ DMAKNMFGG
Sbjct: 293 ADKFQSGGGTPSMADLMNNPALMDMAKNMFGG 324

>KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}
           Anc_6.21 YOR007C
          Length = 331

 Score =  315 bits (806), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 177/343 (51%), Positives = 214/343 (62%), Gaps = 21/343 (6%)

Query: 1   MSLSNKEIAALIVDFLXXXXXX--VNEDYVDSLNVAIDCITEAFQFERDETDSLISGPFN 58
           M LSNKEI+ LIVD+L        V+ED  DSLNVAIDCIT++F+FERD T  LI   F 
Sbjct: 1   MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLIKSKFY 60

Query: 59  GKKLPELLASAPSSGGVSGEPVKVHIPVE----DXXXXXXXXXXXXQGNKAMAAKKFDEA 114
              LPELL  A  +     E V V++P +    D            +GNKAMA K FD A
Sbjct: 61  NLSLPELLEVAMENSA--KENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAMKDFDLA 118

Query: 115 IEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKY 174
           I KY+ AI +SP+NA+YY+NRAAAYSSLK +E+A +DAE AI VDP YSKG+SRLGFAKY
Sbjct: 119 IAKYSEAISISPNNAIYYANRAAAYSSLKDFEKATEDAESAIRVDPNYSKGYSRLGFAKY 178

Query: 175 ALNKPEEALDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNLXXXXXXXXXXXXXXXX 234
           ALNKPEEAL+AYKKVLD+EG+KAT++MKRDYETAKK+VE S+NL                
Sbjct: 179 ALNKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEKKESTPKE------- 231

Query: 235 XTEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNNPQVMQAAEKMMQNPGLM---QDMMSN 291
             E                             NNPQ+MQAA++MM +P  M   Q MM N
Sbjct: 232 --ESVTESAANAAAGGFPDMSSMLGGGLNGLLNNPQLMQAAQQMMSDPNAMSKIQSMMQN 289

Query: 292 PAMKQMANQFSSGGGMPDLSQMMNDPSIRDMAKNMFGGGNGSQ 334
           P+++QMA  F   G  PD SQ+MNDP+I+DMAKN FGG N  Q
Sbjct: 290 PSIRQMAENF-QNGNTPDFSQLMNDPNIKDMAKNFFGGNNQQQ 331

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  312 bits (800), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 173/337 (51%), Positives = 210/337 (62%), Gaps = 13/337 (3%)

Query: 1   MSLSNKEIAALIVDFLXXX--XXXVNEDYVDSLNVAIDCITEAFQFERDETDSLISGPFN 58
           M+ SNKEIAALIVD+L        V+ D  DSLNVA+DCI EAF+FERD     +   FN
Sbjct: 1   MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVKSAFN 60

Query: 59  GKKLPELLASAPSSGGVSGEPVKVHIP--VEDXXXXXXXXXXXXQGNKAMAAKKFDEAIE 116
           G  L   L+      G +   ++V+I     D            +GNKAMA K ++ AI+
Sbjct: 61  GNGLTSFLS------GSATNDIQVNIADDAADEEQKATAEGLKLEGNKAMATKDYESAIK 114

Query: 117 KYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYAL 176
           KY+ AIEV P+NAVYY+NRAAAYSSLK+Y+ AV DAE AI+V+PTYSKG+SRLGFAK+A 
Sbjct: 115 KYSEAIEVLPTNAVYYANRAAAYSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQ 174

Query: 177 NKPEEALDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNLXXXXXXXXXXXXXXXXXT 236
            K E+ALDAYKKVLDIEG+KATD+MKRDYETAKKKVE S+NL                 T
Sbjct: 175 GKVEDALDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEKVTPKEAETESNADAGT 234

Query: 237 EXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNNPQVMQAAEKMMQNPGLMQ---DMMSNPA 293
                                          NPQ+MQAA++MMQNP  MQ    MM NPA
Sbjct: 235 GAAGMGGMGGFPDLSSMLGGGLGGGLGDLLKNPQIMQAAQQMMQNPNAMQQMESMMQNPA 294

Query: 294 MKQMANQFSSGGGMPDLSQMMNDPSIRDMAKNMFGGG 330
           ++QMA  F+SG G PDLS MMN+P ++DMAKNMFG G
Sbjct: 295 VRQMAENFASGEGTPDLSAMMNNPDLKDMAKNMFGNG 331

>TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.21
           YOR007C
          Length = 343

 Score =  309 bits (792), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 166/342 (48%), Positives = 220/342 (64%), Gaps = 22/342 (6%)

Query: 1   MSLSNKEIAALIVDFLXX--XXXXVNEDYVDSLNVAIDCITEAFQFERDETDSLISGPFN 58
           MS SNKE+A+LIVD+L        V+E+ +DSLNVAIDCI E+F+ ++ ++ ++    F 
Sbjct: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQKGDSKAV----FG 56

Query: 59  GKKLPELL----ASAPSSGGVSGEPVKVHIPVEDXXXXXXXXXXXXQGNKAMAAKKFDEA 114
           GK L ELL     S+  +     E +KV+IP ED            +GNKAMA K FD A
Sbjct: 57  GKGLVELLQNESGSSSETATTQAESIKVNIPAEDAETKAKAETLKLEGNKAMACKDFDLA 116

Query: 115 IEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKY 174
           I+KY+ AIEV P+NAVYY+NRAAA+SS+K YE+A+KDAE AI+ DPTYSKG+SRLG+AK+
Sbjct: 117 IKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKF 176

Query: 175 ALNKPEEALDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNLXXXXXXXXXXXXXXXX 234
           AL + E+AL+AYKKVLDIEG+KA+DVMKRDYETAKKKVE S++L                
Sbjct: 177 ALGQAEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSLDLEKKPETQARGADAGAG 236

Query: 235 XTEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNNPQVMQAAEKMMQNP---GLMQDMMSN 291
                                           NNPQ+MQAA++MMQNP     M+ MM N
Sbjct: 237 GAG---------GSGGFGDFASMLGGGLGGLLNNPQLMQAAQQMMQNPQAMSQMESMMQN 287

Query: 292 PAMKQMANQFSSGGGMPDLSQMMNDPSIRDMAKNMFGGGNGS 333
           P ++QMA  F+ G GMP++  +MN+P++RDMA ++FGG NG+
Sbjct: 288 PGVRQMAENFAQGNGMPNMGDLMNNPALRDMAGSLFGGANGN 329

>Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {ON}
           complement(59590..60618) [1029 nt, 343 aa]
          Length = 342

 Score =  306 bits (784), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 172/338 (50%), Positives = 217/338 (64%), Gaps = 12/338 (3%)

Query: 1   MSLSNKEIAALIVDFLXXX--XXXVNEDYVDSLNVAIDCITEAFQFERDETDSLISGPFN 58
           MS+SNK+IAALI+DFL        V+ED  DSLNVA+DCI EAF+FERD    ++   F 
Sbjct: 1   MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVVKSSFQ 60

Query: 59  GKKLPELL---ASAPSSGGVSGEPVKVHIPVEDXXXXXXXXXXXXQGNKAMAAKKFDEAI 115
           G  L   L    SA ++   + E VKV++  +D            +GNKAMA K ++ AI
Sbjct: 61  GNSLSSYLNGSTSASAATTTADETVKVNVTEDDTEASEAAEALKLEGNKAMAGKDYELAI 120

Query: 116 EKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYA 175
           +KYT AI   P+NAVY++NRAAAYSSLK+Y++AV+DA  AI+++PTYSKG+SRLGFAK+A
Sbjct: 121 KKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFA 180

Query: 176 LNKPEEALDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNLXXXXXXXXXXXXXXXXX 235
             K E+AL+AYKKVLDIEG+KAT++MKRDYETAKKKVE S+NL                 
Sbjct: 181 QGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNLEKSTVSGNATAESDSAS 240

Query: 236 TEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNNPQVMQAAEKMMQNPGLM---QDMMSNP 292
                                          NNPQ+MQAA++MMQ+P  M   + MM NP
Sbjct: 241 A----ADPFAGMGGMPDFSSMLGGGGLGNLLNNPQLMQAAQQMMQDPEAMKQVESMMQNP 296

Query: 293 AMKQMANQFSSGGGMPDLSQMMNDPSIRDMAKNMFGGG 330
           ++KQMA+QFSSG G PD S +MNDPSIRDMAKNMFG G
Sbjct: 297 SVKQMADQFSSGNGTPDFSALMNDPSIRDMAKNMFGNG 334

>ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR007C (SGT2)
          Length = 327

 Score =  305 bits (780), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 164/330 (49%), Positives = 208/330 (63%), Gaps = 7/330 (2%)

Query: 1   MSLSNKEIAALIVDFLXXXXXXVNEDYVDSLNVAIDCITEAFQFERDETDSLISGPFNGK 60
           MS SNK+IAALIVDFL      V EDY DSL VAIDCITEAF+    E D+L+S    G+
Sbjct: 1   MSPSNKDIAALIVDFLTTSAKTVGEDYEDSLKVAIDCITEAFELGPGEADTLVSEKCGGR 60

Query: 61  KLPELLASAPSSGGVSGEPVKVHIPVEDXXXXXXXXXXXXQGNKAMAAKKFDEAIEKYTA 120
            L +LL +  +    +GEP      V              +GN+AMAAK ++ AI+KYTA
Sbjct: 61  SLSQLLTTGMAHTSDAGEP-----KVAAEELKKEAEALKLEGNRAMAAKDYETAIQKYTA 115

Query: 121 AIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNKPE 180
           AIEV P++AVYY+NRAAAYSSL+QYE+AV+DAE+A +VD +YSKGFSRLG+AKYAL + E
Sbjct: 116 AIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHE 175

Query: 181 EALDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNLXXXXXXXXXXXXXXXXXTEXXX 240
           EAL+AYK+VLDIEG+ AT+ M+RDYE+AK+KVE S+N+                      
Sbjct: 176 EALEAYKRVLDIEGDNATEAMRRDYESAKRKVEESINMDRNAEVTESGDSAAGSAGGSGL 235

Query: 241 --XXXXXXXXXXXXXXXXXXXXXXXXXXNNPQVMQAAEKMMQNPGLMQDMMSNPAMKQMA 298
                                       NNPQVMQAA+KMMQNP  +Q+MMSNPA+K+MA
Sbjct: 236 PDLASMFGGGGLGGGLGGGLGGGLGGLLNNPQVMQAAQKMMQNPSAIQEMMSNPAIKKMA 295

Query: 299 NQFSSGGGMPDLSQMMNDPSIRDMAKNMFG 328
             F+SG G   L  +M DP++R+MA   FG
Sbjct: 296 ENFASGNGSSGLGDLMADPAVRNMASKFFG 325

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score =  303 bits (775), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 167/344 (48%), Positives = 220/344 (63%), Gaps = 20/344 (5%)

Query: 1   MSLSNKEIAALIVDFLXX--XXXXVNEDYVDSLNVAIDCITEAFQFERDETDSLIS-GPF 57
           MS S +EIAALIV++         ++ED  DSLNVA+DCI+EAF FER+    ++    F
Sbjct: 1   MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF 60

Query: 58  NGKKLPELLASAP----SSGGVSGEPVKVHIPVEDXXXXXXXXXXXXQGNKAMAAKKFDE 113
            G+ L ++L SA     S+     E V+++IP +D            QGNKAMA K ++ 
Sbjct: 61  KGQHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYEL 120

Query: 114 AIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAK 173
           AI KYT AI+V P+NA+YY+NRAAA+SSLK+Y+QAVKDAE AI +DP+Y +G+SRLGFAK
Sbjct: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAK 180

Query: 174 YALNKPEEALDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNLXXXXXXXXXXXXXXX 233
           YA  KPEEAL+AYKKVLDIEG+ AT+ MKRDYE+AKKKVE S+NL               
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNL---------EKTVPE 231

Query: 234 XXTEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNNPQVMQAAEKMMQNPGLMQD---MMS 290
              +                             NNPQ+MQAA+KMM NPG MQ+   MM 
Sbjct: 232 QSRDADVDASQGASAGGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQ 291

Query: 291 NPAMKQMANQFSSGGGMPDLSQMMNDPSIRDMAKNMFGGGNGSQ 334
           +P+++QMA  F+SGGG P+LS +MN+P++R+MA N+FGG  G+Q
Sbjct: 292 DPSIRQMAEGFASGGGTPNLSDLMNNPALRNMAGNLFGGA-GAQ 334

>CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007c SGT2
          Length = 343

 Score =  302 bits (774), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 162/328 (49%), Positives = 210/328 (64%), Gaps = 15/328 (4%)

Query: 5   NKEIAALIVDFLX--XXXXXVNEDYVDSLNVAIDCITEAFQFERDETDSLISGPFNGKKL 62
           +KE+AA+I+ +L        V EDY+DS+NVAIDCI E+F+ ER + DS++      K L
Sbjct: 2   SKEVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVLKQSGISKGL 61

Query: 63  PELLASAPSSGGVSGEPVKVHIPVEDXXXXXXXXXXXXQGNKAMAAKKFDEAIEKYTAAI 122
            E L      G V  E VKV+IP ED            +GNKAMA K F+ AI KY+ AI
Sbjct: 62  EECL-ECMKGGAVKSEDVKVNIPAEDAETKAKAEALKLEGNKAMAGKDFELAIAKYSEAI 120

Query: 123 EVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNKPEEA 182
           EV P+NA+YY+NRAAA+SSLKQY++AV DAE+AIE+DP YSKG+SRLGFAKYA NKPEEA
Sbjct: 121 EVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEA 180

Query: 183 LDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNLXXXXXXXXXXXXXXXXXTEXXXXX 242
           L+AYKKV+D+EG+KATD+MKRDYETAKKKVE S+NL                        
Sbjct: 181 LEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEKTPDARGADSGAGAGAG------ 234

Query: 243 XXXXXXXXXXXXXXXXXXXXXXXXNNPQVMQAAEKMMQNPGL---MQDMMSNPAMKQMAN 299
                                   NNPQ+MQAA++MM NP     MQ MM +P+++QMA 
Sbjct: 235 ---AGGAGGFDFSSMLSGGLSGLMNNPQIMQAAQQMMSNPQALQQMQSMMQDPSIRQMAE 291

Query: 300 QFSSGGGMPDLSQMMNDPSIRDMAKNMF 327
           QF+SG G P++  +M++P++R+MA +MF
Sbjct: 292 QFTSGNGTPNMDDLMSNPALRNMASSMF 319

>Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {ON}
           YOR007C (REAL)
          Length = 345

 Score =  301 bits (772), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 166/342 (48%), Positives = 217/342 (63%), Gaps = 21/342 (6%)

Query: 1   MSLSNKEIAALIVDFLXX--XXXXVNEDYVDSLNVAIDCITEAFQFERDETDSLIS-GPF 57
           M  S +EIAALIV++         ++ED  DSLNVA+DCI+EAF FERD    ++    F
Sbjct: 1   MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEF 60

Query: 58  NGKKLPELLASAPSSGGVSGEP-----VKVHIPVEDXXXXXXXXXXXXQGNKAMAAKKFD 112
            GK L ++L SA S    S E      V+V+IP ED            QGNKAMA K ++
Sbjct: 61  KGKSLADVLNSA-SKASESNEKDDAQNVEVNIPEEDAETKAKAEDLKMQGNKAMANKDYE 119

Query: 113 EAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFA 172
            AI KYT AI+V P+NA+YY+NRAAA+SSL++Y++AVKDAE +I +DP+Y +G+SRLGFA
Sbjct: 120 LAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFA 179

Query: 173 KYALNKPEEALDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNLXXXXXXXXXXXXXX 232
           KYA  KPEEAL+AYKKVLDIEG+ AT+ MKRDYE+AKKKVE S+NL              
Sbjct: 180 KYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNL---------EKAVP 230

Query: 233 XXXTEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNNPQVMQAAEKMMQNPGLMQD---MM 289
               +                             NNPQ+MQAA+KMM NPG MQ+   MM
Sbjct: 231 EQSRDADANASQGAGSSGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMM 290

Query: 290 SNPAMKQMANQFSSGGGMPDLSQMMNDPSIRDMAKNMFGGGN 331
            +P+++QMA  F+SGGG P+LS +MN+P++R+MA N+FGG +
Sbjct: 291 QDPSIRQMAEGFTSGGGAPNLSDLMNNPALRNMAGNLFGGAD 332

>Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {ON}
           YOR007C (REAL)
          Length = 348

 Score =  300 bits (769), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 166/339 (48%), Positives = 216/339 (63%), Gaps = 17/339 (5%)

Query: 1   MSLSNKEIAALIVDFLXX--XXXXVNEDYVDSLNVAIDCITEAFQFERDETDSLI-SGPF 57
           MS S  EIA+LIV++         ++ED  DSLNVA+DCI+EAF FER+   S++ +  F
Sbjct: 1   MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEF 60

Query: 58  NGKKLPELLAS----APSSGGVSGEPVKVHIPVEDXXXXXXXXXXXXQGNKAMAAKKFDE 113
            G+ L +LL S    + S+     + V+V+IP ED            QGNKAMA K ++ 
Sbjct: 61  KGQNLTDLLNSTSRVSESTKKDDAQNVEVNIPEEDAEIKAKAEDLKMQGNKAMANKDYEL 120

Query: 114 AIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAK 173
           AI KYT AI+V P+NA+YY+NRAAA+SSLK Y++AV+DAE AI +DPTY +G+SRLGFAK
Sbjct: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAK 180

Query: 174 YALNKPEEALDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNLXXXXXXXXXXXXXXX 233
           YA  KPEEAL+AYKKVLDIEG+ AT+ MKRDYE+AKKKVE S+NL               
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADANA 240

Query: 234 XXTEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNNPQVMQAAEKMMQNPGLMQD---MMS 290
             ++                             NNPQ+MQAA+KMM NPG MQ+   MM 
Sbjct: 241 DASQ-------GAGTSGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQ 293

Query: 291 NPAMKQMANQFSSGGGMPDLSQMMNDPSIRDMAKNMFGG 329
           +P +KQMA  F+SGGG P+LS +MN+P++R MA N+FGG
Sbjct: 294 DPNIKQMAEGFTSGGGAPNLSDLMNNPALRSMAGNLFGG 332

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  296 bits (759), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 166/335 (49%), Positives = 213/335 (63%), Gaps = 10/335 (2%)

Query: 1   MSLSNKEIAALIVDFLXX--XXXXVNEDYVDSLNVAIDCITEAFQFERDETDSLISGPFN 58
           MSLSNKE+ +LIVDFL        ++ED  DSLNVAIDCITE+F+FERD     +   F+
Sbjct: 1   MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTLQDKFS 60

Query: 59  GKKLPELLASAPSSGGVSG--EPVKVHIPVEDXXXXXXXXXXXXQGNKAMAAKKFDEAIE 116
           GK L E+L+SA ++   S   E VKV+IPVED            +GNKAMAAK +  AIE
Sbjct: 61  GKTLKEILSSASATSTGSEKEESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRLAIE 120

Query: 117 KYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYAL 176
           KY+ AI+  P+N +YY+NRAAAYSS+K+Y+ A+KDAE+AIE+DP YSKG+SRL FAKYAL
Sbjct: 121 KYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYAL 180

Query: 177 NKPEEALDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNLXXXXXXXXXXXXXXXXXT 236
           NKPEEAL+ YKKVLD+EG+KAT  MKRD+E AK +VE+SMNL                  
Sbjct: 181 NKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEKSSTTTPEPSRSAGQQP 240

Query: 237 EXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNNPQVMQAAEKMMQNPG---LMQDMMSNPA 293
                                         NNPQVMQAA++MM +P     MQ+MM NP 
Sbjct: 241 -ANPFAGSGMPDMSSLFGNGGGMGGLSSFLNNPQVMQAAQQMMSDPNSMQKMQEMMQNPN 299

Query: 294 MKQMANQFSSGGGMPDLSQMMNDPSIRDMAKNMFG 328
           +++MA   +SG    +L  +MN+PS++DMA N+FG
Sbjct: 300 LREMAQNLASGDA--NLDDLMNNPSVKDMANNLFG 332

>Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {ON}
           YOR007C (REAL)
          Length = 346

 Score =  296 bits (757), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 165/348 (47%), Positives = 217/348 (62%), Gaps = 31/348 (8%)

Query: 1   MSLSNKEIAALIVDFLXX--XXXXVNEDYVDSLNVAIDCITEAFQFERDETDSLI-SGPF 57
           MS S +EIA+LIV++         V+ED  DSLNVA+DCI+EAF FERD   S++    F
Sbjct: 1   MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF 60

Query: 58  NGK----------KLPELLASAPSSGGVSGEPVKVHIPVEDXXXXXXXXXXXXQGNKAMA 107
            G+          KLPE      S      + V+V+IP ED            QGNKAMA
Sbjct: 61  KGQSLNNLLSSSSKLPE------SGKKDDAQNVEVNIPEEDAETKAKAEELKIQGNKAMA 114

Query: 108 AKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFS 167
            K+++ AI+KYT AI+V P+NA+YY+NRAAA+SSLK+Y++A+KDAE AI VDP+Y +G+S
Sbjct: 115 NKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYS 174

Query: 168 RLGFAKYALNKPEEALDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNLXXXXXXXXX 227
           RLGFAKYA  KPEEAL+AYKKVLDIEG+ ATD MKRDYE+AKK+VE S+NL         
Sbjct: 175 RLGFAKYAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNL--------- 225

Query: 228 XXXXXXXXTEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNNPQVMQAAEKMMQNPGLM-- 285
                    +                             NNPQ+MQAA+KMM NPG M  
Sbjct: 226 EKTAPEQPRDAGANAGQGAGAGGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQN 285

Query: 286 -QDMMSNPAMKQMANQFSSGGGMPDLSQMMNDPSIRDMAKNMFGGGNG 332
            Q+MM +P+++QMA  F+SGGG P+LS +M +P++R+MA ++FGG + 
Sbjct: 286 IQNMMQDPSIRQMAEGFTSGGGTPNLSDLMKNPALRNMAGSLFGGADA 333

>ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} similar
           to uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 334

 Score =  290 bits (742), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 158/327 (48%), Positives = 209/327 (63%), Gaps = 18/327 (5%)

Query: 1   MSLSNKEIAALIVDFLXXX--XXXVNEDYVDSLNVAIDCITEAFQFERDETDSLISGPFN 58
           M+ SNK+I++LIVD+L        V+ED +DSLNVAI+CITEAF  E+  +    S  F 
Sbjct: 1   MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGSS----SAAFG 56

Query: 59  GKKLPELLASAPSSGGVSGEPVKVHIPVEDXXXXXXXXXXXXQGNKAMAAKKFDEAIEKY 118
           GK L ELL++   +    GE VKV+IP ED            +GNKAMA K ++ AI+KY
Sbjct: 57  GKNLAELLSAGAGAPSSQGENVKVNIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKY 116

Query: 119 TAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNK 178
           + AI V P+NAVYY+NRAAA+SSLK Y++A+KDAE A++VD +YSKG+SRLG+AK+A  K
Sbjct: 117 SEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGK 176

Query: 179 PEEALDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNLXXXXXXXXXXXXXXXXXTEX 238
            EEAL+AYKKVLDIEG+ ATDVMKRDYETAK+KVE ++ L                 ++ 
Sbjct: 177 SEEALEAYKKVLDIEGDSATDVMKRDYETAKRKVEQALEL---------NKTDETETSDR 227

Query: 239 XXXXXXXXXXXXXXXXXXXXXXXXXXXXNNPQVMQAAEKMMQNP---GLMQDMMSNPAMK 295
                                       NNPQVMQAA++MMQNP     M+ MM NP ++
Sbjct: 228 GTGEPAGANPGGGFDLSSMLGGGLGGLLNNPQVMQAAQQMMQNPQAMSQMETMMQNPNVR 287

Query: 296 QMANQFSSGGGMPDLSQMMNDPSIRDM 322
           QMA +F+ G G P+L+ +MN+P++RDM
Sbjct: 288 QMAEKFAGGNGTPNLNDIMNNPALRDM 314

>KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {ON}
           Anc_6.21 YOR007C
          Length = 339

 Score =  290 bits (741), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 158/339 (46%), Positives = 211/339 (62%), Gaps = 22/339 (6%)

Query: 1   MSLSNKEIAALIVDFLXX--XXXXVNEDYVDSLNVAIDCITEAFQFERDETDSLISGPFN 58
           M+ SNKE+++LI+D+L        V+ D +DSLNVAIDC+TE F  E+D   + I   FN
Sbjct: 1   MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATIESKFN 60

Query: 59  GKKLPELLASAPSSGG----VSGEPVKVHIPVEDXXXXXXXXXXXXQGNKAMAAKKFDEA 114
           GK L ELL +A  + G       E VK++IP ED            +GNKA+A+K +D A
Sbjct: 61  GKSLTELLDAASQNAGNTDECKTETVKINIPQEDAETKAKAEALKLEGNKAVASKDYDLA 120

Query: 115 IEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKY 174
           +EKYT AI++ P+NAVY++NRAAAY++ + Y++AVKDAE+AI++DP YSKG+SRL +AKY
Sbjct: 121 VEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKY 180

Query: 175 ALNKPEEALDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNLXXXXXXXXXXXXXXXX 234
                EE+L+AYKKVL+IEG+ AT+V KR YETAKK+VE S+NL                
Sbjct: 181 VQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNL------------EKSV 228

Query: 235 XTEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNNPQVMQAAEKMMQNPGLM---QDMMSN 291
            TE                             NNPQ+MQAA+ MM NPG M   Q MM N
Sbjct: 229 PTESAGGQTNPAAGGGFPDFSSLMSGGLEGLMNNPQMMQAAQSMMSNPGAMEKIQSMMQN 288

Query: 292 PAMKQMANQFSSGGGMPDLSQMMNDPSIRDMAKNMFGGG 330
           PA++QMA QF  GG  PD S+MMN+P++R+MA ++F G 
Sbjct: 289 PAIQQMAEQF-KGGNTPDFSEMMNNPAVRNMASSLFSGA 326

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score =  276 bits (706), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 155/341 (45%), Positives = 209/341 (61%), Gaps = 14/341 (4%)

Query: 1   MSLSNKEIAALIVDFLXX--XXXXVNEDYVDSLNVAIDCITEAFQFERDETDSLISGPFN 58
           MSL+NK+I ALIVDFL        V+ED  DSLNVA+DCI+EA +F+R+     I   FN
Sbjct: 1   MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETIKNKFN 60

Query: 59  GKKLPELLASAPSSGGVSG----EPVKVHIPVEDXXXXXXXXXXXXQGNKAMAAKKFDEA 114
           GK L ++L +  ++   +     E V+V+IPVED            +GNKAMA K F  A
Sbjct: 61  GKTLVDILNTTSTATANTTIEKEESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLA 120

Query: 115 IEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKY 174
           +EKYT AI++ P+NA+YY+NRAAA+SSLK++E+A+KDAE AI++DP+YSKG+SRL FAKY
Sbjct: 121 VEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKY 180

Query: 175 ALNKPEEALDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNLXXXXXXXXXXXXXXXX 234
            L K EEAL++YKKVLDIEG+ AT  MKRDYETAKK+VE SMN+                
Sbjct: 181 GLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMNVEKSKTPEQGQGQQQTN 240

Query: 235 XTEXXXX---XXXXXXXXXXXXXXXXXXXXXXXXXNNPQVMQAAEKMMQNPGLM---QDM 288
            +                                 +NP  M  A+K+M +P  M   Q M
Sbjct: 241 ESAQGNAPNPFAGGMPDMSSLFGGAGMGGGLGSLLSNPDFMSTAQKLMSDPNAMQQVQSM 300

Query: 289 MSNPAMKQMANQFSSGGGMPDLSQMMNDPSIRDMAKNMFGG 329
           MS+P+M+ +AN F +G    D++ +MN+P+IR+MA N+F G
Sbjct: 301 MSDPSMRDLANNFKNGN--TDMNDIMNNPAIRNMASNLFKG 339

>TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {ON}
           Anc_6.21 YOR007C
          Length = 350

 Score =  261 bits (666), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 150/337 (44%), Positives = 200/337 (59%), Gaps = 24/337 (7%)

Query: 1   MSLSNKEIAALIVDFLXXX--XXXVNEDYVDSLNVAIDCITEAFQFERDETDSLISGPFN 58
           MS SNK+IA L+VDFL        V+ D  DSLNVAIDCITEAF+FE+D+  S ++  F 
Sbjct: 1   MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTLASKFG 60

Query: 59  GKKLPELLASAPSSGGVSGEPVKVHIPV------EDXXXXXXXXXXXXQGNKAMAAKKFD 112
           GK L ELL +A ++ G S  P  + + +      ED            +GNKAMAAK ++
Sbjct: 61  GKSLTELLDAATNAKGRSSSPEDIKVSISDKDEEEDKELAAKAEALKLEGNKAMAAKDYN 120

Query: 113 EAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFA 172
            A+EKY AAI++ P+ AVYY+NRAAAYSS ++Y++A+KDAE AI+V+P +SKG+SRLGFA
Sbjct: 121 LAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFA 180

Query: 173 KYALNKPEEALDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNLXXXXXXXXXXXXXX 232
           K+A  K +EAL+AYKK L+++G+KATD+MKRDYETAKKKVE S+N+              
Sbjct: 181 KFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEKSATPSASASASA 240

Query: 233 XXXTEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNNPQVMQAAEKMMQNPGLMQDMMSNP 292
                                             N P+ M+  E MMQ          NP
Sbjct: 241 SAGGMPDMASMLGGGLGSFLNNPQIMQAAQQMMSN-PRAMEQMESMMQ----------NP 289

Query: 293 AMKQMANQFSSGG--GMPDLSQMMNDPSIRDMAKNMF 327
           +++QMA   SSG   GM D    MN+P+IR+MA N+F
Sbjct: 290 SIRQMAENLSSGSSEGMGDF---MNNPAIREMASNLF 323

>Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON}
           complement(15762..16793) [1032 nt, 344 aa]
          Length = 343

 Score =  183 bits (464), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 119/337 (35%), Positives = 177/337 (52%), Gaps = 18/337 (5%)

Query: 1   MSLSNKEIAALIVDFLXXXX--XXVNEDYVDSLNVAIDCITEAFQFERDETDSLISGPFN 58
           MSL+NK+  ALIV++L        V+ED  +SLNVAIDCI++ F+ +    + +I+  FN
Sbjct: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFN 60

Query: 59  GKKLPELLASAPSSGGVSGEPVKVHIPVEDXX--XXXXXXXXXXQGNKAMAAKKFDEAIE 116
              L  +         VS + V++ +  E+              +GNK M+ K +  AI+
Sbjct: 61  KSDLKTITLKGLGLQNVS-DVVELEVKNEEISEDKKKEAEALKLEGNKQMSLKNYKSAID 119

Query: 117 KYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYAL 176
           KY+ AIE+ PSN  YYSNRAAAY  ++ +  AV DA  AI++DPTYSK +SRLG AK A 
Sbjct: 120 KYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAE 179

Query: 177 NKPEEALDAYKKVLDIEGEKATDVMKRDYETAKKKVET--SMNLXXXXXXXXXXXXXXXX 234
              E+A+ A+KKVL++EG+K+T+VMK DYE AKK V+T  ++N                 
Sbjct: 180 GNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNKNVPDPSGPPPLNTTDV 239

Query: 235 XTEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNNPQVMQAAEKMMQNPGLMQDMMSNPAM 294
            T+                             N P++MQ  E +MQ          NP +
Sbjct: 240 LTDIATVLGSSFGSLMNNTQMMQRAQQMMQTQN-PEMMQQVEGLMQ----------NPVV 288

Query: 295 KQMANQFSSGGGMPDLSQMMNDPSIRDMAKNMFGGGN 331
           +Q A   ++G G   LS ++N+PS++++A  +  G N
Sbjct: 289 RQFAENVANGNGPGGLSDVLNNPSVKEVANGLMNGYN 325

>NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {ON}
           Anc_6.21 YOR007C
          Length = 351

 Score =  142 bits (359), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 89/224 (39%), Positives = 131/224 (58%), Gaps = 26/224 (11%)

Query: 1   MSLSNKEIAALIVDFLXXXXXX--VNEDYVDSLNVAIDCITEAFQFERD-ETDSLISGPF 57
           MSLSNKEIA+ IV +L        V EDY +S++VAI+CI ++F  + +   DS ++   
Sbjct: 1   MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQEEVSADSDLATVL 60

Query: 58  --NGKKLPELLASAPSSGGVSGEPVKVHIPVEDXXXXXXXXXXXXQGNKAMAAKKFDEAI 115
             N    PE   S      V+ + +K+ +                +GNKA+  + + +AI
Sbjct: 61  LANLNLEPEPKLSEKERELVNEQAIKLKL----------------EGNKAVERENYKDAI 104

Query: 116 EKYTAAIEVSPSNAV-----YYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLG 170
           +KYT AI++   N +     Y SN++ A +   +YE+A  DA   I++DPT+SKG+SRL 
Sbjct: 105 DKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLA 164

Query: 171 FAKYALNKPEEALDAYKKVLDIEGEKATDVMKRDYETAKKKVET 214
            AK   NK E+A++AYK+VLD+EG KATD MKRD+E  K+K ET
Sbjct: 165 EAKIGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFEITKQKFET 208

>NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.21
           YOR007C
          Length = 350

 Score =  131 bits (330), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 79/215 (36%), Positives = 121/215 (56%), Gaps = 18/215 (8%)

Query: 1   MSLSNKEIAALIVDFLX--XXXXXVNEDYVDSLNVAIDCITEAFQFERDETDSLISGPFN 58
           MSL+ ++ A+LI+ +L        ++ED  +SL VAI CI E+F  + D    ++     
Sbjct: 1   MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLDGD----ILPTSLK 56

Query: 59  GKKLPELLASAPSSGGVSGEPVKVHIPVEDXXXXXXXXXXXXQGNKAMAAKKFDEAIEKY 118
            + L  +L    ++   +    K+H                 +GN+AM   +++EAI+KY
Sbjct: 57  ERTLKTILQENLNTLEATQ---KIH--------NEEAEALKKEGNEAMIEGQYEEAIKKY 105

Query: 119 TAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNK 178
           T AI+ S  N  YYSNR+ AYS L +YE AV DA  AI +DP++SK +SRLG+AK   +K
Sbjct: 106 TEAIQFSK-NVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCCQDK 164

Query: 179 PEEALDAYKKVLDIEGEKATDVMKRDYETAKKKVE 213
            E+ + AYK+ +D+EG  A+  +  DYE A+ K E
Sbjct: 165 LEDGMTAYKRAIDLEGTNASKTLYDDYEDARFKYE 199

>TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON}
           Anc_6.21 YOR007C
          Length = 377

 Score =  118 bits (295), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 82/261 (31%), Positives = 133/261 (50%), Gaps = 48/261 (18%)

Query: 1   MSLSNKEIAALIVDFLXXXXXX--VNEDYVDSLNVAIDCITEAFQFERDETDSLISGPF- 57
           M+ +++EIA++IVD+         +N+D VDSLNVAIDCI + F  ++D   +++   + 
Sbjct: 1   MNTTDQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNILKTAYR 60

Query: 58  ---------NGKKLPELLASAPSSGGVSGE--------------------PVKVHIPVED 88
                    NGK+    L    ++  VS +                    PVKV   +E+
Sbjct: 61  SNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIEE 120

Query: 89  XXXXXXXX-------XXXXQGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSS 141
                              +GN+ M AK++ +AI  Y+ AI++ P+N  YY+NRA AY  
Sbjct: 121 TKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIK 180

Query: 142 LKQYEQAVKDAEQAIEVD----PTYSKGFSRLGFAKYALNKPEEALDAYKKVLDI----- 192
              ++ A+ DA ++IE+D    PT  K + RLG AKY +   E +L A+K++++I     
Sbjct: 181 ANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENN 240

Query: 193 EGEKATDVMKRDYETAKKKVE 213
           +G++ T  M  DYE AK+KV+
Sbjct: 241 KGDEITKQMDADYEKAKEKVQ 261

>TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa]
           {ON} Anc_6.21 YOR007C
          Length = 373

 Score =  106 bits (264), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 71/255 (27%), Positives = 119/255 (46%), Gaps = 39/255 (15%)

Query: 3   LSNKEIAALIVDFL--XXXXXXVNEDYVDSLNVAIDCITEAFQFERDETDSLISGPFNGK 60
           +++K++A LIV+FL        +++D +DSLNVAIDCI + +        S +   F+  
Sbjct: 6   INDKDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYISSSLILKFSKS 65

Query: 61  KLPELL-----------ASAPSSGGVSGEPV-------------------KVHIPVEDXX 90
            L  +L            S   +  ++ EP                    K+ I + D  
Sbjct: 66  DLTSILNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISINLNDTS 125

Query: 91  X-------XXXXXXXXXQGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLK 143
                            +GN+ M ++ + +AIE YT AI   P + +YYSNR+ AY  + 
Sbjct: 126 KNNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVN 185

Query: 144 QYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKATDVMKR 203
            YE A+ DA   I +D  +SK + RL   K   ++  +ALD YKK +++  +   + + R
Sbjct: 186 DYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKITR 245

Query: 204 DYETAKKKVETSMNL 218
           ++E  K KV+T ++L
Sbjct: 246 EFEDLKLKVQTDISL 260

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score = 98.2 bits (243), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 71/94 (75%), Gaps = 1/94 (1%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPS-NAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVD 159
           QGN A  +K F++AIE +T AIEVSP+ N V YSNR+AAY+S KQ+++A+ DA + ++++
Sbjct: 11  QGNAAFTSKDFNKAIELFTKAIEVSPTPNHVLYSNRSAAYTSAKQFQEALNDATECVKIN 70

Query: 160 PTYSKGFSRLGFAKYALNKPEEALDAYKKVLDIE 193
           PT+SKG++RLG A++ L   EEA   YK+ L ++
Sbjct: 71  PTWSKGYNRLGAAEFGLGNLEEAEKNYKEALKLD 104

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%)

Query: 114 AIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAK 173
           A++ Y+  I+ +P +A  YSNRAAA S L  + +A+KD + AI+ DP + + + R   A+
Sbjct: 408 AVKAYSEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCDNAIKKDPNFVRAYIRKATAQ 467

Query: 174 YALNKPEEALD 184
            A+ +   ALD
Sbjct: 468 IAIKEYANALD 478

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 53/97 (54%), Gaps = 8/97 (8%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAI---- 156
           +GNK   A KFDEAIE+Y  A  ++  +  Y +NR+AA      +E A+    +A+    
Sbjct: 261 EGNKLYKAHKFDEAIEQYNKAWALN-KDITYLNNRSAAEFEKGDFETAIATLNEAVDQGR 319

Query: 157 EVDPTY---SKGFSRLGFAKYALNKPEEALDAYKKVL 190
           E+   Y   +K F+R+G A +     ++++D Y+K L
Sbjct: 320 ELRADYKIIAKSFARIGNAYHKKGDLKKSIDYYQKSL 356

>TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {ON}
           Anc_5.617 YOR027W
          Length = 582

 Score = 96.7 bits (239), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 70/95 (73%), Gaps = 1/95 (1%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPS-NAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVD 159
           QGN A  AK +DEAIEK+T AIEVS + N V YSNR+A Y+S KQ+ + ++DA + ++++
Sbjct: 11  QGNAAFVAKNYDEAIEKFTKAIEVSETPNHVLYSNRSACYTSKKQFVKGLEDANECVKIN 70

Query: 160 PTYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEG 194
           PT+SKG++R+G A + +   +EA  AYKK L+++ 
Sbjct: 71  PTWSKGYNRVGAAHFGMGDLDEAEKAYKKALELDS 105

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 38/66 (57%)

Query: 111 FDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLG 170
           +  A++ YT  I   PS+A  YSNRAAA S L  + +A+ D   AIE DP + + + R  
Sbjct: 405 WPNAVKAYTEMIARDPSDARGYSNRAAALSKLMSFPEAITDCNTAIEKDPNFIRAYIRKA 464

Query: 171 FAKYAL 176
            A+ A+
Sbjct: 465 TAQIAI 470

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 53/97 (54%), Gaps = 8/97 (8%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAI---- 156
           +GNK   A KFDEAIE Y  A E+  ++  Y +NR+AA      Y+ A++   +A+    
Sbjct: 261 EGNKLYKAHKFDEAIEHYNKAWELH-NDITYLNNRSAAEFEKGDYQTAIETLHEAVEKGR 319

Query: 157 EVDPTY---SKGFSRLGFAKYALNKPEEALDAYKKVL 190
           E+   Y   +K F+R+  +   LN  + A++ Y+K L
Sbjct: 320 EMRADYKLVAKSFTRIANSYMKLNDIKSAINYYQKSL 356

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score = 95.5 bits (236), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 72/95 (75%), Gaps = 1/95 (1%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPS-NAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVD 159
           QGN A  AK +++AI+ ++ AIEVS + N V+YSNR+A Y+SLK++ +A+ DAE+ ++++
Sbjct: 10  QGNAAFVAKDYEKAIDLFSKAIEVSETPNHVFYSNRSACYASLKKFPEALNDAEECVKIN 69

Query: 160 PTYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEG 194
           PT+SKG++RLG A   L   +EA  +YKK L+++G
Sbjct: 70  PTWSKGYNRLGAAHLGLGDLDEAEGSYKKALELDG 104

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 41/66 (62%)

Query: 111 FDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLG 170
           +  A++ YT  I+ +P +A  YSNRAAA S L  + +A++D  +AIE DP + + + R  
Sbjct: 406 WPNAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIEDCNKAIEKDPNFIRAYIRKA 465

Query: 171 FAKYAL 176
            A+ A+
Sbjct: 466 TAQIAV 471

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 66/145 (45%), Gaps = 11/145 (7%)

Query: 56  PFNGKKLPELLASAPSSGGVSGEPVKVHIPV---EDXXXXXXXXXXXXQGNKAMAAKKFD 112
           P   K+ P    S P +     EP  + +     E+             GNKA  A++FD
Sbjct: 214 PEQSKETPAEQKSEPQAEATKAEPEPMEVDSAGNEETSKKEEAEKEKALGNKAYKARQFD 273

Query: 113 EAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAI----EVDPTY---SKG 165
           EAI  Y AA  +   +  Y +NR+AA       E A+K  ++A+    E+   Y   +K 
Sbjct: 274 EAIAHYDAAWNLH-QDITYLNNRSAAEFEKGDAETALKTLDEAVEKGREMRTDYKLIAKS 332

Query: 166 FSRLGFAKYALNKPEEALDAYKKVL 190
           F+R+G   +  N  ++A++ Y+K L
Sbjct: 333 FARMGNVHHKTNNLKKAIEFYQKSL 357

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score = 94.0 bits (232), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 68/95 (71%), Gaps = 1/95 (1%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPS-NAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVD 159
           QGN A AAK F++AIE +T AIEVS   N V YSNR+A Y+S KQ+ +A++DA+Q + ++
Sbjct: 9   QGNAAFAAKDFEKAIELFTKAIEVSEKPNHVLYSNRSACYTSTKQFNKALEDAKQCVNIN 68

Query: 160 PTYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEG 194
           P +SKG++R+G A + L   +EA   YKK L+++ 
Sbjct: 69  PAWSKGYNRVGAAHFGLGDLDEAEQGYKKALELDS 103

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 65/121 (53%), Gaps = 8/121 (6%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKD----AEQAI 156
           +GNK   A+KFDEAIE Y+ A E+   +  Y +NRAAA     +YE A+K      EQ  
Sbjct: 265 EGNKFYKARKFDEAIEHYSKAWELH-KDITYLNNRAAAEYEKGEYETAIKTLTEAVEQGR 323

Query: 157 EVDPTY---SKGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKATDVMKRDYETAKKKVE 213
           E+   Y   SK F+R+G + + LN+ ++A++ Y+K L            R+ E   KK E
Sbjct: 324 ELRADYKVISKSFARIGNSYHKLNELKKAIEFYQKSLTEHRTPEILTKLRNCEKELKKQE 383

Query: 214 T 214
           T
Sbjct: 384 T 384

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 42/76 (55%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           QG +      +  A++ YT  I+ +P +A  YSNRAAA S L  + +A+KD   AI  DP
Sbjct: 399 QGKEYFTKGDWPNAVKSYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCNVAISKDP 458

Query: 161 TYSKGFSRLGFAKYAL 176
            + + + R   A+ A+
Sbjct: 459 NFIRAYIRKATAQIAV 474

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 92.8 bits (229), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 68/95 (71%), Gaps = 1/95 (1%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPS-NAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVD 159
           QGN A  AK +D+AIE +T AIEVS + N V YSNR+A Y+SLK++  A+ DA++ I ++
Sbjct: 11  QGNSAFTAKDYDKAIELFTKAIEVSKTPNHVLYSNRSACYASLKKFSDALNDAKECININ 70

Query: 160 PTYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEG 194
           P++SKG++RLG A   L   +EA + YKK L+++ 
Sbjct: 71  PSWSKGYNRLGAAHLGLGDLDEAENNYKKALELDA 105

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 48/87 (55%), Gaps = 4/87 (4%)

Query: 114 AIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAK 173
           A++ YT  I+ +P +A  YSNRAAA + L  + +A+ D  +AIE DP + + + R   A+
Sbjct: 415 AVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQ 474

Query: 174 YALNKPEEALDAYKKVLDIEGEKATDV 200
            A+ +   AL+     LD    K  DV
Sbjct: 475 IAVQEYAAALE----TLDAARTKDADV 497

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 55/97 (56%), Gaps = 8/97 (8%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAV---KDA-EQAI 156
           +GNK   A++FDEAIE Y  A E+   +  Y +NRAAA     +Y+ A+    DA EQ  
Sbjct: 268 EGNKFYKARQFDEAIEHYNKAWELH-RDITYLNNRAAAEYEKGEYKTAIATLNDAVEQGR 326

Query: 157 EVDPTY---SKGFSRLGFAKYALNKPEEALDAYKKVL 190
           E+   Y   S+ F+R+G A + L   ++ ++ Y+K L
Sbjct: 327 EMRADYKVISRSFARIGNAYHKLGDLKKTIEYYQKSL 363

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score = 92.8 bits (229), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 70/95 (73%), Gaps = 1/95 (1%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPS-NAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVD 159
           QGN A +AK++++A++ ++ AIEVSP  N V YSNR+A Y+SLK++  A+ DA +  +++
Sbjct: 11  QGNTAFSAKEYEKAVDLFSKAIEVSPEPNHVLYSNRSACYTSLKKFTDALNDANECTKIN 70

Query: 160 PTYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEG 194
           PT+SKG++R+G A Y L   +EA  +YKK L+++ 
Sbjct: 71  PTWSKGYNRVGAAHYGLGDLDEAEKSYKKALELDA 105

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 55/100 (55%), Gaps = 4/100 (4%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           QG       ++ +A++ YT  I  +P +A  YSNRAAA S L  + +A+ D E+A+E DP
Sbjct: 398 QGKDFFNKGQWPDAVKAYTEMIARAPDDARAYSNRAAALSKLMSFPEAISDCEKALEKDP 457

Query: 161 TYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKATDV 200
            + K + R   A+ A+ +   AL+     LDI   K T++
Sbjct: 458 NFVKAYIRKATAQIAIKEYSSALE----TLDIARSKDTEL 493

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 52/97 (53%), Gaps = 8/97 (8%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAI---- 156
           +GNK   A KFDEAIE Y  A E+  ++  Y +N+AAA      YE  +K  E AI    
Sbjct: 264 EGNKLYKAHKFDEAIEHYDKAWELH-NDITYLNNKAAAQYEKGDYETTIKTLEDAIEKGR 322

Query: 157 EVDPTY---SKGFSRLGFAKYALNKPEEALDAYKKVL 190
           E+   Y   +K F+R+G A   LN  ++A + + K L
Sbjct: 323 ELRADYKIIAKAFTRMGNAYEKLNDLKKAAEFFNKSL 359

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score = 91.3 bits (225), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 71/95 (74%), Gaps = 1/95 (1%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPS-NAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVD 159
           QGN A  AK F++A E ++ AIE S + N V YSNR+A Y+SLK++++A++DAE+ ++++
Sbjct: 9   QGNAAFVAKDFEKAAELFSKAIESSETPNHVLYSNRSACYTSLKKFKEALEDAEECVKIN 68

Query: 160 PTYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEG 194
           PT+SKG++R+G A+Y L   ++A   YKK L+I+ 
Sbjct: 69  PTWSKGYNRVGAAQYGLGNLDDAEKEYKKALEIDS 103

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 56/97 (57%), Gaps = 8/97 (8%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAI---- 156
           +GNK   A+KFDEAIE Y  A ++   +  Y +NR+AA      YEQA+K   +A+    
Sbjct: 273 EGNKYYKARKFDEAIEHYNKAWDLH-RDVTYLNNRSAAEYEKGDYEQAIKTLTEAVDQGR 331

Query: 157 EVDPTY---SKGFSRLGFAKYALNKPEEALDAYKKVL 190
           E+   Y   SK F+R+G A   ++  ++A++ Y++ L
Sbjct: 332 EMRADYKLISKSFARIGNAYLKMDDLKKAIEFYQRSL 368

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 40/77 (51%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           QG +      +  A+  YT  I+ +P +A  YSNRAA  + L  +  A+KD + AI  DP
Sbjct: 407 QGKEFFTKGDWPSAVSAYTEMIKRAPEDARGYSNRAAVLAKLMSFPDAIKDCDVAISKDP 466

Query: 161 TYSKGFSRLGFAKYALN 177
            + + + R   A+ A+ 
Sbjct: 467 NFVRAYIRKASAQIAVR 483

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score = 91.3 bits (225), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 67/95 (70%), Gaps = 1/95 (1%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPS-NAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVD 159
           QGN A  AK +D+AIE +T AIEVS + N V YSNR+A Y+SLK++  A+ DA + ++++
Sbjct: 11  QGNAAFTAKDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLKKFSDALNDANECVKIN 70

Query: 160 PTYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEG 194
           P++SKG++RLG A   L   +EA   YKK L+++ 
Sbjct: 71  PSWSKGYNRLGAAHLGLGDLDEAESNYKKALELDA 105

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 55/97 (56%), Gaps = 8/97 (8%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAV---KDA-EQAI 156
           +GNK   A++FDEAIE Y  A E+   +  Y +NRAAA     +YE A+    DA EQ  
Sbjct: 268 EGNKFYKARQFDEAIEHYNKAWELH-KDITYLNNRAAAEYEKGEYETAISTLNDAVEQGR 326

Query: 157 EVDPTY---SKGFSRLGFAKYALNKPEEALDAYKKVL 190
           E+   Y   SK F+R+G A + L   ++ ++ Y+K L
Sbjct: 327 EMRADYKVISKSFARIGNAYHKLGDLKKTIEYYQKSL 363

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 47/84 (55%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +G +      +  A++ YT  I+ +P +A  YSNRAAA + L  + +A+ D  +AIE DP
Sbjct: 402 EGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDP 461

Query: 161 TYSKGFSRLGFAKYALNKPEEALD 184
            + + + R   A+ A+ +   AL+
Sbjct: 462 NFVRAYIRKATAQIAVKEYASALE 485

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score = 90.9 bits (224), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 46/94 (48%), Positives = 68/94 (72%), Gaps = 1/94 (1%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPS-NAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVD 159
           +GN A  AK + +AI+ +T AIEVS + N V YSNR+AAY+S KQYEQA+ DA++ I+++
Sbjct: 11  EGNTAFVAKDYQKAIDAFTKAIEVSETPNHVLYSNRSAAYTSSKQYEQALSDADECIKIN 70

Query: 160 PTYSKGFSRLGFAKYALNKPEEALDAYKKVLDIE 193
           P+++KG++R G A   L+K EEA   Y + L I+
Sbjct: 71  PSWAKGYTRKGAALQGLHKYEEAEQCYNETLKID 104

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 53/97 (54%), Gaps = 8/97 (8%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAI---- 156
           +GNKA  A++FDEAI  Y  A E    +  Y +NR+AA      YE  +K   +A+    
Sbjct: 257 EGNKAYKARQFDEAISHYNQAWETF-KDITYLNNRSAAEYEKGDYETCIKTLTEAVENAR 315

Query: 157 EVDPTY---SKGFSRLGFAKYALNKPEEALDAYKKVL 190
           E+   Y   +K F+R+G A   L+  ++A++ Y+K L
Sbjct: 316 ELRTDYKIVAKSFARMGNAYAKLDDLKKAIEYYQKSL 352

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 51/96 (53%), Gaps = 4/96 (4%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +G +      +  A++ YT  I+ +P +A  YSNRAAA + L  +  A+ D  +AIE DP
Sbjct: 391 EGKEYFTKADWPNAVKSYTEMIKRAPDDARGYSNRAAALAKLMSFPDAISDCNKAIEKDP 450

Query: 161 TYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEGEK 196
           ++ + + R    + A+ +   A++     LD+  E+
Sbjct: 451 SFIRAYLRKATCQIAVKEFAGAIE----TLDLARER 482

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score = 90.9 bits (224), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 73/95 (76%), Gaps = 1/95 (1%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPS-NAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVD 159
           QGN A  AK + +AI+ +T AIEVS + N V YSNR+A Y+S K++E+A+KDAE+ +++ 
Sbjct: 9   QGNAAFLAKDYVKAIDLFTKAIEVSETPNHVLYSNRSACYASNKKFEEALKDAEECVKIS 68

Query: 160 PTYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEG 194
           P++SKG++R+G A++ L++ +EA  +YK+ L+++ 
Sbjct: 69  PSWSKGYNRVGAAQFGLSQLDEAEKSYKRALELDS 103

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 51/97 (52%), Gaps = 8/97 (8%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVD- 159
           +GNK   A++F+EAIE Y  A E+   +  Y +NR+AA      Y+ A+K    A+E   
Sbjct: 252 EGNKLYKARQFEEAIEHYNKAWELH-KDITYLNNRSAAEFEKGDYDTAIKTLNDAVEQGR 310

Query: 160 ------PTYSKGFSRLGFAKYALNKPEEALDAYKKVL 190
                  T +K F+R+G A Y L    +A++ Y + L
Sbjct: 311 ELRADYKTIAKSFARIGNAYYKLKDLRKAIEHYNRSL 347

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 55/102 (53%), Gaps = 4/102 (3%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           QG +      +  A++ YT  ++ +P +A  +SNRAAA + L  + +A++D  +A+ +DP
Sbjct: 386 QGKEFFTKGDWPNAVKAYTEMVKRAPQDARGFSNRAAALAKLMSFPEAIEDCNKAVSIDP 445

Query: 161 TYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKATDVMK 202
            + + + R   A+ A+ +   A++     L+I  EK   V K
Sbjct: 446 NFVRAYIRKATAQIAVKEFAAAIE----TLNIAREKDAQVNK 483

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 89.4 bits (220), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 69/95 (72%), Gaps = 1/95 (1%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPS-NAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVD 159
           QGN A  AK +D+AI+ ++ AI+VS   N V YSNR+A Y+SLK++  A+KDAE+ ++++
Sbjct: 11  QGNAAFVAKDYDKAIDLFSKAIDVSEQPNHVLYSNRSACYTSLKKFVNALKDAEECVKIN 70

Query: 160 PTYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEG 194
           P++SKG++R+G A + +   +EA   YKK L+++ 
Sbjct: 71  PSWSKGYNRVGAAHFGMGDLDEAEAGYKKALELDA 105

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 52/96 (54%), Gaps = 8/96 (8%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVD-- 159
           GNK   A++FDEA+ KY  A E   ++  Y +NR+AA      YE ++K  E+A+E    
Sbjct: 270 GNKLYKARQFDEAVAKYNEAWEAH-NDITYLNNRSAAEFEKGDYETSIKTLEEAVEKGRE 328

Query: 160 -----PTYSKGFSRLGFAKYALNKPEEALDAYKKVL 190
                   +K F+R+G     LN  ++A+D YKK L
Sbjct: 329 MRADYKVIAKSFARMGNCYTKLNDLKKAIDFYKKSL 364

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 42/71 (59%)

Query: 114 AIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAK 173
           A++ YT  I+ +P +A  YSNRAA  S L  + +A+ D  +AIE DP + + + R   A+
Sbjct: 416 AVKAYTEMIKRAPEDARGYSNRAAVLSKLMSFPEAIDDCNKAIEKDPNFVRAYIRKATAQ 475

Query: 174 YALNKPEEALD 184
            A+ +   AL+
Sbjct: 476 IAVREFSSALE 486

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score = 88.2 bits (217), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 67/95 (70%), Gaps = 1/95 (1%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPS-NAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVD 159
           +GN A AAK F++AIE +  AIEVS   N V YSNR+A Y+S++++ +A+ DA++ + + 
Sbjct: 10  EGNSAFAAKDFEKAIELFGKAIEVSEQPNHVLYSNRSACYASMRKFREALADAQECVRIK 69

Query: 160 PTYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEG 194
           P +SKG +RLG A Y L   +EA ++YKK L+++ 
Sbjct: 70  PDWSKGHNRLGAAHYGLGDLDEAEESYKKALELDS 104

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 53/100 (53%), Gaps = 4/100 (4%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           QG +      +  A++ YT  I+ +P +A  YSNRAAA + L  +  A+KD + AI+ DP
Sbjct: 394 QGKEYFTNADWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPDAIKDCDMAIQKDP 453

Query: 161 TYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKATDV 200
            + + + R   A+ A+ +   A++     LD   EK  +V
Sbjct: 454 NFVRAYIRKATAQIAVQEYAAAIE----TLDTAREKDAEV 489

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 54/97 (55%), Gaps = 8/97 (8%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIE--- 157
           +GN+    ++FDEAI  Y  A ++   +  Y +NRAAA      YE A+K  E+A+E   
Sbjct: 260 KGNELYKKRQFDEAIANYEKAWDLH-KDITYLNNRAAAEYEKGDYESAIKTLEKAVEEGR 318

Query: 158 -VDPTY---SKGFSRLGFAKYALNKPEEALDAYKKVL 190
            +   Y   +K F+RLG A Y L   ++A++ Y+K L
Sbjct: 319 ELRADYKVIAKSFARLGNAHYKLADLKKAIEYYEKSL 355

>KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {ON}
           Anc_5.617 YOR027W
          Length = 579

 Score = 87.0 bits (214), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 71/95 (74%), Gaps = 1/95 (1%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPS-NAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVD 159
           QGN A AAKK+DEA++ +T AIEVS + N V YSNR+A+Y+S +++ +A+KDA +  +++
Sbjct: 11  QGNSAFAAKKYDEAVDLFTKAIEVSETPNHVLYSNRSASYASEQKFNEALKDALECTKIN 70

Query: 160 PTYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEG 194
           P+++KG++R G A + +   ++A  +YKK L+++ 
Sbjct: 71  PSWAKGYTREGAAHFGMGNLDDAEASYKKALELDA 105

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 39/66 (59%)

Query: 111 FDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLG 170
           +  A++ YT  I+ +P +A  YSNRAAA S L  +  A+ D  +AIE DP + + + R  
Sbjct: 401 WPSAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPDAISDCNKAIEKDPNFVRAYIRKA 460

Query: 171 FAKYAL 176
            A+ A+
Sbjct: 461 TAQIAV 466

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 54/97 (55%), Gaps = 8/97 (8%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAI---- 156
           +GNKA  A+ FDEAI  Y  A E+  +N  Y +NR+AA     +Y+ A+    +AI    
Sbjct: 257 EGNKAYKARNFDEAIACYNKAWELD-NNITYLNNRSAAEFEKGEYDTAINTLNEAIEKGR 315

Query: 157 EVDPTY---SKGFSRLGFAKYALNKPEEALDAYKKVL 190
           E+   Y   +K F+R+G A   +   +EA++ Y+K L
Sbjct: 316 EMRADYKIIAKSFARIGNAYVKMGNLKEAINHYQKSL 352

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 87.0 bits (214), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 67/96 (69%), Gaps = 3/96 (3%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVS--PSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEV 158
           QGN A  AK +D AIE +T AIEVS  PS+ V +SNR+A Y+SLK++  A+ DA + +++
Sbjct: 11  QGNAAFTAKNYDGAIELFTKAIEVSETPSH-VLFSNRSACYTSLKKFSDALNDANECVKI 69

Query: 159 DPTYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEG 194
           +P++SKG++RLG A   L   +EA   YKK L+++ 
Sbjct: 70  NPSWSKGYNRLGAAHLGLGDLDEAESDYKKALELDA 105

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 55/102 (53%), Gaps = 4/102 (3%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +G +      +  A++ YT  I+ +P +A  YSNRAAA + L  + +A+ D  +AIE DP
Sbjct: 402 EGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDP 461

Query: 161 TYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKATDVMK 202
            + + + R+  A+ A+ +   AL+     LD+   K  +V K
Sbjct: 462 NFVRAYIRMAAAQIAVKEFAAALE----TLDVARTKDAEVNK 499

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 59/122 (48%), Gaps = 12/122 (9%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVD- 159
           +GNK   A +FDEAIE Y  A E+   +  Y +NRAAA      YE  +     A+E   
Sbjct: 268 EGNKFYKAHQFDEAIEHYNRAWELH-KDITYLNNRAAAEYEKGDYETVIATLNDAVEKGR 326

Query: 160 ------PTYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKATDVMK--RDYETAKKK 211
                    SK F+R+G A + L   ++ ++ Y+K L     +  D++   R+ E  +KK
Sbjct: 327 DMRADYKVISKSFARIGNAYHKLGDLKKTIEYYQKSLT--EHRTADILAKLRNVEKEQKK 384

Query: 212 VE 213
            E
Sbjct: 385 AE 386

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 86.7 bits (213), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 41/94 (43%), Positives = 69/94 (73%), Gaps = 1/94 (1%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPS-NAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVD 159
           QGN A  AK +++A E +  AI+VS   N V YSNR+A Y+SLK++ + +KDAE+ ++++
Sbjct: 10  QGNAAFVAKDYEKAAELFGKAIDVSEQPNHVLYSNRSACYTSLKKFAEGLKDAEECVKIN 69

Query: 160 PTYSKGFSRLGFAKYALNKPEEALDAYKKVLDIE 193
           P +SKG++R+G A++ LN  E+A  +Y+K L+++
Sbjct: 70  PGWSKGYNRVGAAQFGLNNLEDAEKSYQKALELD 103

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 45/76 (59%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +G +  +   +  A++ YT  I+ SP +A  YSNRAAA + L  + +A+ D ++AIE DP
Sbjct: 388 EGKEYFSKADWPNAVKAYTEMIKRSPQDARGYSNRAAALAKLMSFPEAIADCDRAIEKDP 447

Query: 161 TYSKGFSRLGFAKYAL 176
            + + + R   A+ A+
Sbjct: 448 NFIRAYIRKASAQIAV 463

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 37/110 (33%), Positives = 59/110 (53%), Gaps = 10/110 (9%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAI---- 156
           +GNK   A+KFDEAIE Y  A E+   +  Y +NRAAA      YE A+     A+    
Sbjct: 254 EGNKFYKARKFDEAIEHYNKAWELH-KDITYLNNRAAAEYEKGDYETAIATLTNAVDEGR 312

Query: 157 EVDPTY---SKGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKATDVMKR 203
           E+   Y   +K F+R+G A + L   +++++ Y+K L     ++ DV+ +
Sbjct: 313 EMRADYKVIAKSFARIGNAYHKLGDLKKSINFYQKSLT--EHRSADVLNK 360

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 86.3 bits (212), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 42/94 (44%), Positives = 67/94 (71%), Gaps = 1/94 (1%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPS-NAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVD 159
           QGN A  AK +++A E +T AIE S + N V YSNR+A ++SLK++ +A+ DA + ++++
Sbjct: 9   QGNAAFVAKDYEKASELFTKAIEASEAPNHVLYSNRSACFTSLKKFNEALNDANECVKIN 68

Query: 160 PTYSKGFSRLGFAKYALNKPEEALDAYKKVLDIE 193
           P +SKG++R+G A + L K +EA   YKK L+I+
Sbjct: 69  PAWSKGYNRVGAAYFGLGKLDEAEQGYKKALEID 102

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 60/119 (50%), Gaps = 8/119 (6%)

Query: 79  PVKVHIPVEDXXXXXXXXXXXXQGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAA 138
           P++V  P  +            +GNK   A+KFDEAIE Y  A ++   +  Y +NR+AA
Sbjct: 251 PMEVDEPQPEQDSKKNADAEKAEGNKFYKARKFDEAIEHYNKAWDLH-KDVTYLNNRSAA 309

Query: 139 YSSLKQYEQAVKD----AEQAIEVDPTY---SKGFSRLGFAKYALNKPEEALDAYKKVL 190
                 YEQA+K      EQ  E+   Y   SK F+R+G A   L   ++A++ Y+K L
Sbjct: 310 EYEKGDYEQAIKTLTEAVEQGREMRADYKLISKSFARIGNAYLKLEDFKKAIEFYQKSL 368

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 42/76 (55%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           QG +      +  A++ YT   + +P +A  YSNRAAA + L  + +A+KD + AI  DP
Sbjct: 407 QGKEYFTKGDWPNAVKAYTEMTKRAPEDARGYSNRAAALAKLMSFPEAIKDCDMAISKDP 466

Query: 161 TYSKGFSRLGFAKYAL 176
            + + + R   A+ A+
Sbjct: 467 NFIRAYIRKATAQIAV 482

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 85.9 bits (211), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 66/95 (69%), Gaps = 1/95 (1%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPS-NAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVD 159
           +GN A A+K F  AIE +T AI  S + N V YSNR+A Y+SLKQ+++A+ DA+Q ++++
Sbjct: 10  KGNAAFASKDFTGAIEYFTEAIAASTTPNHVLYSNRSACYTSLKQFQEALNDAQQCVKIN 69

Query: 160 PTYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEG 194
           P +SKG++R+G A   L   ++A   YKK L+++ 
Sbjct: 70  PDWSKGYNRMGAAHLGLGDLDDAESNYKKALELDS 104

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 58/107 (54%), Gaps = 5/107 (4%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +G +      +  A++ YT  I+ +P +A  YSNRAAA + L  + +A+KD E+AIE DP
Sbjct: 396 EGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIKDCEKAIEKDP 455

Query: 161 TYSKGFSRLGFAKYALN---KPEEALDAYKKVLDI--EGEKATDVMK 202
            + + + R   A+ A+    K  E L+  KK  D    G  + ++MK
Sbjct: 456 NFVRAYLRKATAQIAIKDFVKALETLEEAKKKDDEVNNGASSNEIMK 502

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 64/128 (50%), Gaps = 14/128 (10%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKD----AEQAI 156
           +GNK   + KFDEAI +Y  A ++   +  Y +NR+AA      +E A+       EQ  
Sbjct: 262 EGNKLYKSHKFDEAIAEYNKAWDLH-KDITYLNNRSAAEFEKGDFETAMNTLNEAVEQGR 320

Query: 157 EVDPTY---SKGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKATDVMKR----DYETAK 209
           E+   Y   +K F+R+G A       ++A++ Y+K L     +  D++ +    + E  K
Sbjct: 321 ELRADYKLIAKSFARMGNAYSKQKNLKKAIEYYQKSLT--EHRTADILTKLRTCEKELKK 378

Query: 210 KKVETSMN 217
           +++E  +N
Sbjct: 379 QEIEEYIN 386

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 84.7 bits (208), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 66/95 (69%), Gaps = 1/95 (1%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPS-NAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVD 159
           QGN A  AK + +AI+ +T AIEVS + N V YSNR+A Y+SLK++  A+ DA + ++++
Sbjct: 11  QGNAAFTAKDYGKAIDLFTKAIEVSEAPNHVLYSNRSACYTSLKKFTDALNDATECVKIN 70

Query: 160 PTYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEG 194
           P++SKG++RLG A   L   ++A   YKK L+++ 
Sbjct: 71  PSWSKGYNRLGAAHLGLGDLDDAESNYKKALELDA 105

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/137 (33%), Positives = 65/137 (47%), Gaps = 10/137 (7%)

Query: 63  PELLASAPSSGGVSGEPVKVHIP--VEDXXXXXXXXXXXXQGNKAMAAKKFDEAIEKYTA 120
           P+   S  SS     E  K   P  V++            +GNK   A++F+EAIE Y  
Sbjct: 225 PQTTKSESSSKAPQQEETKEAEPMEVDEDDSKVEADKEKAEGNKFYKARQFEEAIEHYNK 284

Query: 121 AIEVSPSNAVYYSNRAAAYSSLKQYEQAV---KDA-EQAIEVDPTY---SKGFSRLGFAK 173
           A E+   +  Y +NRAAA      YE A+    DA EQ  E+   Y   SK F+R+G A 
Sbjct: 285 AWELH-RDITYLNNRAAAEYEKGDYETAIATLTDAVEQGREMRADYKVISKSFARIGNAY 343

Query: 174 YALNKPEEALDAYKKVL 190
           + L   ++ +D Y+K L
Sbjct: 344 HKLGDLKKTIDNYQKSL 360

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 43/76 (56%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +G +      +  A++ YT  I+ SP +A  YSNRAAA + L  + +A+ D  +AIE DP
Sbjct: 399 EGKEYFTKSDWPNAVKAYTEMIKRSPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDP 458

Query: 161 TYSKGFSRLGFAKYAL 176
            + + + R   A+ A+
Sbjct: 459 NFVRAYIRKATAQIAV 474

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 82.8 bits (203), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 68/95 (71%), Gaps = 1/95 (1%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPS-NAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVD 159
           +GN+A A+K + +AIE +T AIEVS   N V +SNR+A Y+S K + +A+ DA + ++++
Sbjct: 9   EGNQAFASKDYAKAIELFTKAIEVSEQPNHVLFSNRSACYASNKDFVKALDDANECVKIN 68

Query: 160 PTYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEG 194
           P+++KG++RLG A Y L   +EA  +YKK L+++ 
Sbjct: 69  PSWAKGYNRLGAAHYGLGDLDEAEQSYKKALELDS 103

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 54/97 (55%), Gaps = 8/97 (8%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAV----KDAEQAI 156
           +GNK    +KFDEAIEKY  A E   ++  Y +NRAAA      YE A+    K  EQ  
Sbjct: 261 EGNKLYKQRKFDEAIEKYNEAWETH-NDITYLNNRAAAEYEKGDYEAAIETLTKAVEQGR 319

Query: 157 EVDPTY---SKGFSRLGFAKYALNKPEEALDAYKKVL 190
           E+   Y   SK F+R+G + + L   ++A+D Y+K L
Sbjct: 320 ELRADYKVISKSFARMGNSYHKLGDLKKAIDYYEKSL 356

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 45/76 (59%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           QG +      + +A+E YT  I+ +P++A  YSNRAAA S L  +  A++D ++AIE DP
Sbjct: 395 QGKEYFTKADWPKAVEAYTEMIKRNPNDARGYSNRAAALSKLMSFADAIRDCDKAIEKDP 454

Query: 161 TYSKGFSRLGFAKYAL 176
            + + + R    + A+
Sbjct: 455 NFVRAYIRKATGQIAI 470

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 80.1 bits (196), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 64/95 (67%), Gaps = 1/95 (1%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPS-NAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVD 159
           +GN A  AK F  A+E +T AI+ S   N V YSNR+ AY+SLK++++A+ DA + +++ 
Sbjct: 10  EGNAAFVAKDFKRAVELFTNAIQESEEPNHVLYSNRSGAYASLKKFDEALSDATECVKIK 69

Query: 160 PTYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEG 194
             +SKG +RLG A + L   +EA ++YKK L+++ 
Sbjct: 70  ADWSKGHNRLGAAHFGLGNLDEAEESYKKALELDA 104

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 52/90 (57%), Gaps = 4/90 (4%)

Query: 111 FDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLG 170
           +  A++ Y+  I  +P +A  YSNRAAA S L  +  A+KD ++AIE+DP++ + + R  
Sbjct: 408 WPSAVKAYSEMIMRAPHDARGYSNRAAALSKLMSFPDAIKDCDKAIEIDPSFVRAYIRKA 467

Query: 171 FAKYALNKPEEALDAYKKVLDIEGEKATDV 200
            A+ A+ +   A++     LD+   K  +V
Sbjct: 468 TAQIAVQEYSAAIE----TLDVARTKDAEV 493

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 63/129 (48%), Gaps = 14/129 (10%)

Query: 69  APSSGGVSGEPVKVHIPVEDXXXXXXXXXXXXQGNKAMAAKKFDEAIEKYTAAIEVSPSN 128
           AP       EP++V +  E+            +GN+    +KFDEAI KY  A  +   +
Sbjct: 238 APGKTQTPPEPMEVDLDRENAEKAKA------EGNQLYKQRKFDEAIAKYEEAWNLQ-KD 290

Query: 129 AVYYSNRAAAYSSLKQYEQAVKD----AEQAIEVDPTY---SKGFSRLGFAKYALNKPEE 181
             Y +NRAAA      Y  A+K      EQ  E+   Y   +K F+RLG A Y L++ ++
Sbjct: 291 ITYLNNRAAAEYEKGDYNSAIKTLNEAVEQGRELRADYKVIAKSFARLGNAYYKLDEVKK 350

Query: 182 ALDAYKKVL 190
           A++ Y+K L
Sbjct: 351 AVEYYEKSL 359

>NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 58/92 (63%), Gaps = 1/92 (1%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSN-AVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           GNK    K +++A+  +T+A+    +N  + YSNRAAA+  LK Y +A++D +  +E+ P
Sbjct: 15  GNKTYKEKGYEQAVHYFTSALSQPSTNKHILYSNRAAAHIGLKHYAEALEDGKNCVELAP 74

Query: 161 TYSKGFSRLGFAKYALNKPEEALDAYKKVLDI 192
            + KG+SR+G A   L K +EA + +KK L +
Sbjct: 75  NWDKGYSRVGVAYLGLQKLDEAEENFKKALQL 106

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 51/86 (59%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +G +    +++ +A++ YT  I+ +P++ V + NRAA +  L    Q + D ++AI VDP
Sbjct: 435 EGKQHFLNREYFKAMKCYTEMIKTNPTSPVGWCNRAAVFEKLLTCPQVIDDCDKAISVDP 494

Query: 161 TYSKGFSRLGFAKYALNKPEEALDAY 186
           +Y K + R GFA+      +EAL+ +
Sbjct: 495 SYIKAYVRKGFAQITERDLDEALETW 520

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 51/120 (42%), Gaps = 12/120 (10%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAI----E 157
           GN     + F EAI  YT A      +  Y +N  AA      Y   +K   QA+     
Sbjct: 302 GNDLYKKRNFKEAIIHYTKAWNTF-QDITYLNNIGAAQFERGDYGNVLKSLGQAVFFAEH 360

Query: 158 VDP---TYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEG----EKATDVMKRDYETAKK 210
            +P     +K + R+G A + +   E A+ AY+  L + G    +K    ++ ++E  KK
Sbjct: 361 TNPEPQVLAKSYIRMGNAYHRIWDHEHAITAYEYGLMLNGNEEHKKKLASLRVEFEKVKK 420

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 67.4 bits (163), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 37/98 (37%), Positives = 60/98 (61%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           QGNK +A+K + +AIE YT AIE+    ++++SNRA A   L +++ A++D+ +AIE+D 
Sbjct: 15  QGNKFVASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQSALEDSSKAIELDS 74

Query: 161 TYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKAT 198
           +  KG+ R G A   L     A    + VL ++  +AT
Sbjct: 75  SNVKGYHRRGMAYAGLQDFISAKRDLEVVLRVKPGEAT 112

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 47/98 (47%), Gaps = 8/98 (8%)

Query: 129 AVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNKPEEALDAYKK 188
           A+ Y ++   + + K Y QA++   +AIE+D   S  FS    A   L++ + AL+   K
Sbjct: 9   ALEYKDQGNKFVASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQSALEDSSK 68

Query: 189 VLDIEGEKATDVMKR--------DYETAKKKVETSMNL 218
            ++++        +R        D+ +AK+ +E  + +
Sbjct: 69  AIELDSSNVKGYHRRGMAYAGLQDFISAKRDLEVVLRV 106

>SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 58/108 (53%), Gaps = 5/108 (4%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           QGN  +  K F +A E Y+ AIE+  + ++Y+SNRA A+  L  ++ A+ D  +AIE+DP
Sbjct: 18  QGNVFIKGKNFSKAAELYSKAIELDGTQSIYFSNRAFAHLKLDNFQTALNDCNKAIELDP 77

Query: 161 TYSKGFSRLGFAKYALNKPEEALDAYKKVLDIE-----GEKATDVMKR 203
              K + R G +   L +  +A    K VL  +       +A DV +R
Sbjct: 78  KNVKAYHRRGLSYIGLLEFNKARKDLKIVLRAKPNEPVATRALDVCER 125

>NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa]
           {ON} Anc_3.481
          Length = 523

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 55/98 (56%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +GNK +  KK+ +A+E YT AIE+  + ++++SNRA A   L  ++  + D   A+E+DP
Sbjct: 19  EGNKYIKEKKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKLDNFQSCLDDCNSALELDP 78

Query: 161 TYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKAT 198
              K + R G ++  L   ++A +    VL  +   AT
Sbjct: 79  KNIKAYHRRGLSQLGLLHFKKAKNDLSIVLKAKPSDAT 116

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 32/65 (49%)

Query: 129 AVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNKPEEALDAYKK 188
           A+   N    Y   K+Y +AV+   +AIE+D T S  FS    A+  L+  +  LD    
Sbjct: 13  AIDLKNEGNKYIKEKKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKLDNFQSCLDDCNS 72

Query: 189 VLDIE 193
            L+++
Sbjct: 73  ALELD 77

>KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON}
           Anc_3.481 YGR123C
          Length = 511

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 59/114 (51%), Gaps = 4/114 (3%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +GNK +  + F  A E YT AIE  P+ +++YSNRA A   L  +  A+ D   AIE++ 
Sbjct: 15  EGNKFLKQQDFQRANELYTKAIETDPTQSIFYSNRALANLKLDNFMNALNDCTNAIELNS 74

Query: 161 TYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKATDVM-KRDYETAKKKVE 213
           +  K + R G A   L   + A + +  VL     K  D++ K  ++T +K + 
Sbjct: 75  SNLKAYHRRGLANIGLLNFKSARNDFNIVLKY---KPNDIIAKNGFDTCEKVIR 125

>Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 61.6 bits (148), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 48/76 (63%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +GN  +  K F +AIEKYT AI++  + ++Y+SNRA A+  +  ++ A+ D ++AI++DP
Sbjct: 18  EGNVFVKEKHFLKAIEKYTEAIDLDATQSIYFSNRAFAHFKVDNFQSALNDCDEAIKLDP 77

Query: 161 TYSKGFSRLGFAKYAL 176
              K + R   +  AL
Sbjct: 78  KNIKAYHRRALSCMAL 93

>Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155W
           (CNS1) - component of Hsp90p chaperone machinery [contig
           27] FULL
          Length = 334

 Score = 61.2 bits (147), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 54/101 (53%), Gaps = 4/101 (3%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPS----NAVYYSNRAAAYSSLKQYEQAVKDAEQAI 156
           QGN+    K++ +A E Y   IE+       N   +SNRAA    LK Y + V D  QA+
Sbjct: 84  QGNELYKVKRYKDAREIYNKGIEIKCDSNKINESLFSNRAACELELKNYRRCVNDCRQAL 143

Query: 157 EVDPTYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKA 197
           + +PT  K F R+  A + L+K E+A +A +  L ++ E A
Sbjct: 144 QFNPTNIKCFYRIARAFFLLDKCEDAKEAIEFGLKLDSESA 184

>YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}
           PPT1Protein serine/threonine phosphatase, regulates
           Hsp90 chaperone by affecting its ATPase and cochaperone
           binding activities; has similarity to human phosphatase
           PP5; present in both the nucleus and cytoplasm;
           expressed during logarithmic growth
          Length = 513

 Score = 61.6 bits (148), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 48/76 (63%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +GN  +  K F +AIEKYT AI++  + ++Y+SNRA A+  +  ++ A+ D ++AI++DP
Sbjct: 18  EGNVFVKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEAIKLDP 77

Query: 161 TYSKGFSRLGFAKYAL 176
              K + R   +  AL
Sbjct: 78  KNIKAYHRRALSCMAL 93

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 45/68 (66%), Gaps = 1/68 (1%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +GN+    KK+DEAI+ Y+ AIEV   + V+YSNR+A Y SL Q E+ V+D   A+++ P
Sbjct: 101 KGNEFFKNKKYDEAIQYYSWAIEVK-EDPVFYSNRSACYVSLGQQEKVVEDTTAALKLKP 159

Query: 161 TYSKGFSR 168
            YSK   R
Sbjct: 160 DYSKCLLR 167

 Score = 33.9 bits (76), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEV 158
            +K  A + FD     +  A+++ PS A  Y +R   Y   +Q+EQA KD E+A E+
Sbjct: 350 ADKGQATEYFD----NFEKALKLDPSCAAVYYHRGQMYFITQQFEQAGKDFEKAKEL 402

>Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 48/76 (63%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +GN  +  K F +AIEKYT AI++  + ++Y+SNRA A+  +  ++ A+ D ++A+++DP
Sbjct: 18  EGNVFIKEKHFLKAIEKYTQAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEALKLDP 77

Query: 161 TYSKGFSRLGFAKYAL 176
              K + R   +  AL
Sbjct: 78  KNIKAYHRRALSCMAL 93

 Score = 34.3 bits (77), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 45/98 (45%), Gaps = 8/98 (8%)

Query: 123 EVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKY-------A 175
           E   +NA+   N    +   K + +A++   QAI++D T S  FS   FA +       A
Sbjct: 6   EADRANALERKNEGNVFIKEKHFLKAIEKYTQAIDLDSTQSIYFSNRAFAHFKVDNFQSA 65

Query: 176 LNKPEEALDAYKKVLDIEGEKATDVMK-RDYETAKKKV 212
           LN  +EAL    K +     +A   M   +++ AKK +
Sbjct: 66  LNDCDEALKLDPKNIKAYHRRALSCMALLEFKKAKKDL 103

>Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 47/76 (61%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +GN  +  K F +AIEKYT AI++  +  +Y+SNRA ++  +  ++ A+ D ++AI++DP
Sbjct: 18  EGNVLVKEKHFLKAIEKYTEAIDLDSTQTIYFSNRALSHFKVDNFQSALNDCDEAIKLDP 77

Query: 161 TYSKGFSRLGFAKYAL 176
              K + R   +  AL
Sbjct: 78  KNIKAYHRRALSCMAL 93

>KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123C
          Length = 513

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 59/108 (54%), Gaps = 5/108 (4%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           QGN  +  KK+ EA+E Y+ AIE+  + ++++SNRA +   L  +  A++D  ++IE+DP
Sbjct: 18  QGNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDNFLTALEDCNKSIELDP 77

Query: 161 TYSKGFSRLGFAKYALNKPEEALDAYKKVLDIE-----GEKATDVMKR 203
              K   R G +   L +  +A    K +L ++       KA +V +R
Sbjct: 78  KNIKAIHRRGLSYVGLLEFSKARKDLKTILQVKPNEQSALKALEVCER 125

 Score = 36.6 bits (83), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 51/98 (52%), Gaps = 8/98 (8%)

Query: 129 AVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNKPEEALDAYKK 188
           A+ + N+  A+   K+Y +AV+   +AIE+D T S  FS   F++  L+    AL+   K
Sbjct: 12  ALEFKNQGNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDNFLTALEDCNK 71

Query: 189 VLDIEGEKATDVMKR--------DYETAKKKVETSMNL 218
            ++++ +    + +R        ++  A+K ++T + +
Sbjct: 72  SIELDPKNIKAIHRRGLSYVGLLEFSKARKDLKTILQV 109

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 46/68 (67%), Gaps = 1/68 (1%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +GN+   AK F++AIE YT AI +   + V+YSNR+AAY S+  +E+ V+D   A+++ P
Sbjct: 110 KGNEFFKAKDFEKAIEYYTLAISLK-EDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKP 168

Query: 161 TYSKGFSR 168
            YSK + R
Sbjct: 169 DYSKCWLR 176

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 45/76 (59%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +GN  +  + + +AIEKY  AIE+  + +VY+SNRA  +  L  ++ A +D ++A+ +DP
Sbjct: 15  EGNACVKVQDYAKAIEKYDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCDKALALDP 74

Query: 161 TYSKGFSRLGFAKYAL 176
              K + R G A   L
Sbjct: 75  KNVKAYHRRGLACVGL 90

>AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR123C
           (PPT1)
          Length = 538

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 52/101 (51%), Gaps = 3/101 (2%)

Query: 76  SGEPVKVHIPVEDXXXXXXXXXXXXQGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNR 135
           SG P     P  D            +GN+ + AK +  A+E YT AIE   + ++++SNR
Sbjct: 22  SGHPSP---PRRDSMTAATALDYKNEGNEWVKAKDYARAVEAYTRAIEADGTQSIFFSNR 78

Query: 136 AAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYAL 176
           A A   L +++ A++D+ +AIE+D    K + R G A   L
Sbjct: 79  ALANLKLDRFQSALEDSARAIELDAGNVKAYHRRGLAHCGL 119

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 28/61 (45%), Gaps = 3/61 (4%)

Query: 103 NKAMAAKKFDE---AIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVD 159
           N+A+A  K D    A+E    AIE+   N   Y  R  A+  L ++  A +D E  +   
Sbjct: 77  NRALANLKLDRFQSALEDSARAIELDAGNVKAYHRRGLAHCGLLEWGPAKRDLEVVVRAK 136

Query: 160 P 160
           P
Sbjct: 137 P 137

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 38/80 (47%)

Query: 124 VSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNKPEEAL 183
           ++ + A+ Y N    +   K Y +AV+   +AIE D T S  FS    A   L++ + AL
Sbjct: 33  MTAATALDYKNEGNEWVKAKDYARAVEAYTRAIEADGTQSIFFSNRALANLKLDRFQSAL 92

Query: 184 DAYKKVLDIEGEKATDVMKR 203
           +   + ++++        +R
Sbjct: 93  EDSARAIELDAGNVKAYHRR 112

>TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 62/108 (57%), Gaps = 5/108 (4%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +GN  +  + F +AI+ YT AI +  + ++Y+SNRA A+  L  ++ ++ D ++A+++DP
Sbjct: 18  EGNIFIKKQDFTKAIDLYTKAIGLDSTQSIYFSNRALAHLKLDNFQSSLNDCDEALKLDP 77

Query: 161 TYSKGFSRLGFAKYALNKPEEALDAYKKVL-----DIEGEKATDVMKR 203
             +K + R G +   L + ++A +  + VL     D    +A DV ++
Sbjct: 78  KNAKAYHRRGLSYIGLLEFKKAKNDLQIVLKAKPGDATASRALDVCEK 125

>Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}
           complement(91130..92671) [1542 nt, 514 aa]
          Length = 513

 Score = 58.9 bits (141), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 56/108 (51%), Gaps = 5/108 (4%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +GN  +  + + +AIE YT AIE+ P+ +++YSNRA A   L  ++ A  D  +A+ +D 
Sbjct: 18  EGNVFIKEQNYSKAIELYTKAIELDPNQSIFYSNRALAQLKLDNFQSAYNDCNEALTLDS 77

Query: 161 TYSKGFSRLGFAKYALNKPEEALDAYKKVL-----DIEGEKATDVMKR 203
              K + R G A   L + + A +    VL     D    +A +V +R
Sbjct: 78  KNVKAYHRRGLANVGLLEFKRARNDLNVVLKAKPSDATALRALNVCER 125

>KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {ON}
           Anc_8.506 YBR155W
          Length = 386

 Score = 58.2 bits (139), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 51/99 (51%), Gaps = 4/99 (4%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEV----SPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAI 156
           Q N     K+F +A E YT  I+V       N   ++NRAA    LK Y   V D ++A+
Sbjct: 91  QANDLYKVKRFRDARELYTKGIKVFCEDKSINESLFANRAACELELKNYRSCVADCQKAM 150

Query: 157 EVDPTYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEGE 195
           E++P   K F R+G A  AL K +EA DA    L I+ E
Sbjct: 151 EINPMNLKCFYRMGKAFLALGKFKEAHDAVSFGLKIDEE 189

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 55/98 (56%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +GN  +  + + +AIE Y+ AIE+ P+ ++++SNRA A   L  ++  + D + A+ +DP
Sbjct: 18  EGNTYIKEQNYMKAIELYSQAIELDPTQSIFFSNRALAQLKLDNFQSCMNDCDVALRLDP 77

Query: 161 TYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKAT 198
              K + R G +   L + ++A +  + VL  +   AT
Sbjct: 78  KNIKAYHRRGLSHLGLLQCKKARNDLQVVLKAKPTDAT 115

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 33/66 (50%)

Query: 119 TAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNK 178
           T+A   +   AV + N    Y   + Y +A++   QAIE+DPT S  FS    A+  L+ 
Sbjct: 2   TSAFADAKEQAVAFKNEGNTYIKEQNYMKAIELYSQAIELDPTQSIFFSNRALAQLKLDN 61

Query: 179 PEEALD 184
            +  ++
Sbjct: 62  FQSCMN 67

>KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa]
           {ON} Anc_3.481 YGR123C
          Length = 512

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 46/76 (60%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +GN  + ++ + +AIE YT AIE+  +++++YSNRA A+  L  ++ A+ D   AI++D 
Sbjct: 18  EGNVYIKSQDYQKAIELYTKAIELDSTSSIFYSNRALAHLKLDNFQSALHDCNDAIKLDN 77

Query: 161 TYSKGFSRLGFAKYAL 176
              K + R G A   L
Sbjct: 78  NNIKAYHRRGLAYVGL 93

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/83 (39%), Positives = 52/83 (62%), Gaps = 1/83 (1%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +GN+    K+F++A++ Y+ AIEV   + V+YSNR+A Y SL Q E+ V+D   A+++ P
Sbjct: 102 KGNEFFKNKQFEDALKYYSLAIEVK-EDPVFYSNRSACYVSLGQQEKVVEDTTAALKLKP 160

Query: 161 TYSKGFSRLGFAKYALNKPEEAL 183
            YSK   R   A  +L K  +A+
Sbjct: 161 DYSKCLLRRASANESLGKFADAM 183

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 32/58 (55%), Gaps = 4/58 (6%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVD 159
            +K  A + FD     +  A+E+ P+ A  Y +R   +   +Q+EQA KD E+A E++
Sbjct: 351 ADKGQATEYFD----NFEKALELDPNCAAVYYHRGQMHFITQQFEQAGKDFEKAKELN 404

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 58/108 (53%), Gaps = 5/108 (4%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +GN A+  + +  AIE YT AI++  + ++Y+SNRA  +  +  ++  + D ++A+E+DP
Sbjct: 18  RGNDAIKTQDYPGAIELYTEAIKLDDTVSIYFSNRAMGHLKMDNFQSGINDCDKALEIDP 77

Query: 161 TYSKGFSRLGFAKYALNKPEEALDAYKKVL-----DIEGEKATDVMKR 203
              K + R G +   L + + A    K VL     D   ++  DV ++
Sbjct: 78  KNIKAYHRRGMSYIGLLEFKNAQKDLKIVLASKPNDATAKRGLDVCEK 125

>NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 43/86 (50%), Gaps = 4/86 (4%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSN----AVYYSNRAAAYSSLKQYEQAVKDAEQAI 156
           QGN     K+F EA + Y   IE+   N       ++NRAA    LK Y   + D + A+
Sbjct: 86  QGNDLFTVKRFREARDIYNKGIEIKCENDKINEALFANRAACQLELKNYRSCINDCKHAL 145

Query: 157 EVDPTYSKGFSRLGFAKYALNKPEEA 182
            ++P   K + R+G A Y LN  EEA
Sbjct: 146 TLNPKNIKCYYRMGKAFYLLNNIEEA 171

>Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {ON}
           YGR123C (PPT1) - serine/threonine phosphatase [contig
           295] FULL
          Length = 511

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 52/93 (55%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           QGN  +  KK+ EA+E Y+ AIE+  + ++Y+SNRA +   L  +  A +D ++AI +DP
Sbjct: 16  QGNAYVKEKKYQEAVEYYSKAIELDDTQSIYFSNRAFSRLRLDNFLTAQEDCDKAIALDP 75

Query: 161 TYSKGFSRLGFAKYALNKPEEALDAYKKVLDIE 193
              K   R G +   L +  +A    + VL ++
Sbjct: 76  KNIKAIHRRGLSYVGLLEFFKARKDLRVVLQVK 108

 Score = 34.3 bits (77), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 40/75 (53%)

Query: 129 AVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNKPEEALDAYKK 188
           A+ + N+  AY   K+Y++AV+   +AIE+D T S  FS   F++  L+    A +   K
Sbjct: 10  ALEFKNQGNAYVKEKKYQEAVEYYSKAIELDDTQSIYFSNRAFSRLRLDNFLTAQEDCDK 69

Query: 189 VLDIEGEKATDVMKR 203
            + ++ +    + +R
Sbjct: 70  AIALDPKNIKAIHRR 84

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 60/118 (50%), Gaps = 10/118 (8%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPS----NAVYYSNRAAAYSSLKQYEQAVKDAEQAI 156
           QGN     K+F +A E Y+  I+V       N   Y+NRAA    +K Y + + D +QA+
Sbjct: 87  QGNDLYKVKRFRDARELYSKGIDVKCQVNTINESLYANRAACELEIKNYRRCINDCKQAL 146

Query: 157 EVDPTYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKATDVMKRDYETAKKKVET 214
           +++P   K + R+  A  AL + +EAL++      IE  +  D   +  +T K  +ET
Sbjct: 147 QLNPKNIKCYYRIAKAFTALERLDEALES------IEFGEKIDNTNKSLKTLKLHIET 198

>YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}
           TOM71Mitochondrial outer membrane protein with
           similarity to Tom70p; probable minor component of the
           TOM (translocase of outer membrane) complex responsible
           for recognition and import of mitochondrially directed
           proteins
          Length = 639

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 47/83 (56%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +GN    AK F+EAI+ Y  AIE+ P+  V+YSN +A Y S    E+ ++   +A+E+ P
Sbjct: 133 RGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKP 192

Query: 161 TYSKGFSRLGFAKYALNKPEEAL 183
            +SK   R   A  +L    +A+
Sbjct: 193 DHSKALLRRASANESLGNFTDAM 215

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 42/84 (50%), Gaps = 4/84 (4%)

Query: 124 VSPSN----AVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNKP 179
           +SPS     AV   NR   + + K + +A+K  + AIE+DP     +S +     +    
Sbjct: 118 LSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDL 177

Query: 180 EEALDAYKKVLDIEGEKATDVMKR 203
           E+ ++   K L+I+ + +  +++R
Sbjct: 178 EKVIEFTTKALEIKPDHSKALLRR 201

>SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 380

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 48/89 (53%), Gaps = 4/89 (4%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPS----NAVYYSNRAAAYSSLKQYEQAVKDAEQAI 156
           QGN    A+++ +A E Y   +EV       N   + NRAA    LK + + + D ++A+
Sbjct: 86  QGNDLYRARRYKDARELYNKGVEVHCDDDAINESLFLNRAACELELKNHRRCINDCKEAL 145

Query: 157 EVDPTYSKGFSRLGFAKYALNKPEEALDA 185
             +P   K F R+G A ++LNK EEA +A
Sbjct: 146 RYNPKNVKCFYRMGRAFFSLNKLEEAKEA 174

>TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa]
           {ON} Anc_2.152 YHR117W
          Length = 610

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 42/68 (61%), Gaps = 1/68 (1%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +GN    A KF+EAI+ Y  AIE+   N ++YSN +A Y SL + E+ +K   +A+E+ P
Sbjct: 117 KGNSLFKADKFEEAIKYYNWAIELK-ENPIFYSNLSACYVSLNKLEEIIKYCNKALELKP 175

Query: 161 TYSKGFSR 168
            YSK   R
Sbjct: 176 DYSKVLLR 183

>Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W
           (REAL)
          Length = 638

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 47/83 (56%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +GN    +K FD+AI+ Y  AIE+ P++ V+YSN +A Y S     + V+   +A+E+ P
Sbjct: 131 KGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKP 190

Query: 161 TYSKGFSRLGFAKYALNKPEEAL 183
            +SK   R   A  +L    +A+
Sbjct: 191 DHSKALLRRASANESLGNFTDAM 213

>Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABR131W
          Length = 597

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 46/76 (60%), Gaps = 1/76 (1%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +GN+    KK++EAI+ Y+ A+ +   + V+YSNR+A +  L + E+ V+D   A+E+ P
Sbjct: 104 KGNECFKEKKYEEAIKYYSCALRLK-KDPVFYSNRSACWVPLNKLEKVVEDTTAALELKP 162

Query: 161 TYSKGFSRLGFAKYAL 176
            YSK   R   A  +L
Sbjct: 163 DYSKCLLRRATANESL 178

 Score = 37.7 bits (86), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 40/71 (56%)

Query: 112 DEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGF 171
           DE ++ +  A+E++P+++  Y +R   Y   +Q+E++ KD ++A E +P     + +L  
Sbjct: 359 DEYLQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLAC 418

Query: 172 AKYALNKPEEA 182
             Y  NK E+ 
Sbjct: 419 LAYRENKFEDC 429

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 55.1 bits (131), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 47/89 (52%), Gaps = 4/89 (4%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPS----NAVYYSNRAAAYSSLKQYEQAVKDAEQAI 156
           QGN+   AK+F +A E Y+  + V       N   Y+NRAA    LK Y + ++D  +A+
Sbjct: 89  QGNELYKAKRFKDARELYSKGLAVECEDKSINESLYANRAACELELKNYRRCIEDCSKAL 148

Query: 157 EVDPTYSKGFSRLGFAKYALNKPEEALDA 185
            ++P   K + R   A + LNK EEA  A
Sbjct: 149 TINPKNVKCYYRTSKAFFQLNKLEEAKSA 177

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 49/76 (64%), Gaps = 1/76 (1%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +GN+     KF++AI+ Y  A+++   + +YYSN +A Y+SL QYE+ ++ A +A+++ P
Sbjct: 116 KGNELFKTSKFEDAIKYYHYALKLK-DDPIYYSNISACYASLLQYEKVIEYATKALKLRP 174

Query: 161 TYSKGFSRLGFAKYAL 176
           T+SK   R   A  A+
Sbjct: 175 TFSKVLMRRALAYEAM 190

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 29/47 (61%)

Query: 113 EAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVD 159
           E ++ +  A+E+ P+N   Y +R  +Y   +QYE+A KD ++  E+D
Sbjct: 372 EYLQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELD 418

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 48/89 (53%), Gaps = 4/89 (4%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPS----NAVYYSNRAAAYSSLKQYEQAVKDAEQAI 156
           QGN+   AK+F +A E YT  I V       N   ++NRAA    LK Y + ++D  +A+
Sbjct: 89  QGNELYKAKRFKDARELYTKGIAVECEDKSINESLFANRAACELELKNYRRCIEDCSKAL 148

Query: 157 EVDPTYSKGFSRLGFAKYALNKPEEALDA 185
            ++P   K + R   A ++L+K EEA  A
Sbjct: 149 TINPKNIKCYYRTSKAFFSLSKLEEAKSA 177

>SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 600

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 46/76 (60%), Gaps = 1/76 (1%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +GN+    KKFD+AI+ Y  A+E+   + V+YSNR+A Y S+ Q E+ V+D   A+++  
Sbjct: 108 KGNEFFKEKKFDDAIKYYNLALELK-KDPVFYSNRSACYVSMGQLEKVVEDTTAALKLKS 166

Query: 161 TYSKGFSRLGFAKYAL 176
            YSK   R   A  +L
Sbjct: 167 DYSKCLLRRASANESL 182

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 50/115 (43%), Gaps = 19/115 (16%)

Query: 113 EAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFA 172
           E  E +  A+E+ P+ A  Y +R   Y   +QYE A KD ++A E +      + +L   
Sbjct: 364 EYFENFDKALELDPNCAAVYYHRGQMYFITQQYENAGKDFDKAKECNENNIFPYIQLACL 423

Query: 173 KYALNKPE-----------------EALDAYKKVLDIEGEKATDVMKRDYETAKK 210
            Y  NK E                 E  + Y ++L  +G+ A    K+ YE A+K
Sbjct: 424 AYRENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLAN--AKKQYEIARK 476

>Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117W
           (REAL)
          Length = 644

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 47/83 (56%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +GN    AK F +AI+ Y  AIE+ P++ V+YSN +A Y S    ++ V+   +A+E+ P
Sbjct: 137 KGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKP 196

Query: 161 TYSKGFSRLGFAKYALNKPEEAL 183
            +SK   R   A  +L    +A+
Sbjct: 197 DHSKALLRRASANESLGNFTDAM 219

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 46/89 (51%), Gaps = 4/89 (4%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIE----VSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAI 156
           QGN     K+F +A E YT  IE    V+  N   Y+NRAA    LK +   + D + A+
Sbjct: 84  QGNDLYKVKRFRDAREIYTKGIEMKCDVAKINESLYANRAACQLELKNFRSCISDCKTAL 143

Query: 157 EVDPTYSKGFSRLGFAKYALNKPEEALDA 185
             +P   K + R+G A  A+NK E A ++
Sbjct: 144 TYNPKNIKCYFRMGKAFTAINKFESARES 172

>AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR155W
           (CNS1)
          Length = 379

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 50/99 (50%), Gaps = 4/99 (4%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNA----VYYSNRAAAYSSLKQYEQAVKDAEQAI 156
           QGN     K+F +A   Y   IEV   +A    +   NRAA    LK Y + + D  +A+
Sbjct: 83  QGNDLYKVKRFRDARVMYNKGIEVKCDDAGISELLLLNRAACELELKNYRRCINDCREAL 142

Query: 157 EVDPTYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEGE 195
           +++P   K F R+G A   L+K EEA +A    L ++ E
Sbjct: 143 KLNPKNPKAFFRIGKAFLQLDKLEEAAEAVDFGLRVDTE 181

>ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 59/108 (54%), Gaps = 5/108 (4%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           QGN  +  + F +A E YT AIE+  + ++++SNRA A+     ++ ++ D ++A+E+D 
Sbjct: 18  QGNDFVKKQDFIKAAELYTKAIELDDTKSIFFSNRALAHLKQDNFQLSLNDCDKALELDS 77

Query: 161 TYSKGFSRLGFAKYALNKPEEALDAYKKVL-----DIEGEKATDVMKR 203
              K + R G +   L + ++A    K VL     D+  ++A  + ++
Sbjct: 78  KNIKAYHRRGLSYVGLLEFKKARTDLKTVLKSKPGDVAADRALQICEK 125

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 42/72 (58%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +GN+ +    +D AIE Y+ AI +  + ++Y+SNRA A+     +  AV D + A+++DP
Sbjct: 18  KGNEYIKKSDYDSAIEFYSKAIALDSTQSIYFSNRALAHLKQDNFYSAVVDCDNALKLDP 77

Query: 161 TYSKGFSRLGFA 172
              K + R G +
Sbjct: 78  KNIKAYHRRGLS 89

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 47/89 (52%), Gaps = 4/89 (4%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPS----NAVYYSNRAAAYSSLKQYEQAVKDAEQAI 156
           QGN+   AK+F +A E Y   + V       N   ++N+AA    LK Y + ++D  +A+
Sbjct: 89  QGNELYKAKRFKDARELYIKGLNVECEDKFINESLFANKAACELELKNYRRCIEDCSKAL 148

Query: 157 EVDPTYSKGFSRLGFAKYALNKPEEALDA 185
            ++P  +K + R   A + LNK EEA  A
Sbjct: 149 SINPKNTKCYYRTSKAFFQLNKLEEAKSA 177

>KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} similar
           to uniprot|P53043 Saccharomyces cerevisiae YGR123C
          Length = 512

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 40/68 (58%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +GNK +  K + +A E YT AIE  P N + YSNRA     L  ++ ++ DA++AIE+D 
Sbjct: 19  EGNKFVKEKLYAKAAEYYTKAIEHDPENTILYSNRAFTNLKLDNFQSSLDDAKRAIELDN 78

Query: 161 TYSKGFSR 168
              K + R
Sbjct: 79  NNLKAYHR 86

>Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W
           (REAL)
          Length = 635

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 45/83 (54%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +GN     K F EAI+ Y  AIE+ P++ V+YSN +A Y S     + ++   +A+E+ P
Sbjct: 130 KGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKP 189

Query: 161 TYSKGFSRLGFAKYALNKPEEAL 183
            +SK   R   A  +L    +A+
Sbjct: 190 DHSKALLRRASANESLGNFTDAM 212

>TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 45/86 (52%), Gaps = 4/86 (4%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEV----SPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAI 156
           QGN    AK+F +A E Y   IE+    +  N   Y+NRAA    +K Y + + D + A+
Sbjct: 84  QGNDLYKAKRFKDARELYNKGIEIKCDDTSINESLYANRAACELEIKNYRRCLNDCKTAL 143

Query: 157 EVDPTYSKGFSRLGFAKYALNKPEEA 182
           + +P   K + R+G A  AL   EEA
Sbjct: 144 QYNPKNLKCYYRMGKAFLALELLEEA 169

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 47/89 (52%), Gaps = 4/89 (4%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPS----NAVYYSNRAAAYSSLKQYEQAVKDAEQAI 156
           QGN+   AK+F +A E YT  + V       N   ++NRAA    LK Y + V+D  +A+
Sbjct: 89  QGNELYKAKRFKDARELYTKGVAVECEDKSINESLFANRAACELELKNYRKCVEDCGKAL 148

Query: 157 EVDPTYSKGFSRLGFAKYALNKPEEALDA 185
            ++P   K + R+  + + L K EEA  A
Sbjct: 149 TINPKNIKCYYRISKSFFQLRKLEEAKSA 177

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 50/83 (60%), Gaps = 1/83 (1%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +GNK   AK +  AI+ Y  A++++  + ++YSN +A Y SL Q ++ ++ + +A+E++P
Sbjct: 128 KGNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQLDKVIESSTKALELNP 186

Query: 161 TYSKGFSRLGFAKYALNKPEEAL 183
            YSK   R   A  +L    +AL
Sbjct: 187 NYSKALLRRASANESLENYSDAL 209

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 49/94 (52%), Gaps = 2/94 (2%)

Query: 76  SGEPVKVHIPV-EDXXXXXXXXXXXXQGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSN 134
           +GEPV   + +  D            +GN     K F+ AI+ YT A+ +   + VYYSN
Sbjct: 75  NGEPVLGDVDLLNDKTKEEWAGALKEKGNALFKKKDFENAIKYYTFALSLK-EDPVYYSN 133

Query: 135 RAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSR 168
            +A YSSL  YE+ ++ A +A+ + P YSK   R
Sbjct: 134 ISACYSSLLNYEKVIEMATKALALRPDYSKVLVR 167

 Score = 34.3 bits (77), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 33/67 (49%)

Query: 112 DEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGF 171
           D     Y  A+++   NA  Y +R   Y   +QYE+A +D ++A E+DP     + +L  
Sbjct: 357 DNYFANYEKAMKLDDKNAALYYHRGQMYFITQQYEKAGEDFDKAKELDPENIFPYIQLAC 416

Query: 172 AKYALNK 178
             Y  NK
Sbjct: 417 LSYRENK 423

>ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL121C (TOM70) and
           YHR117W (TOM71)
          Length = 594

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 46/76 (60%), Gaps = 1/76 (1%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +GN+    ++++EAI+ Y  A+++   + V+YSNR+A Y  L + E+ V+D   A+++ P
Sbjct: 101 KGNECFKDQRYEEAIKFYDCALKLK-EDPVFYSNRSACYVPLNKLEKVVEDTTAALKLKP 159

Query: 161 TYSKGFSRLGFAKYAL 176
            YSK   R   A  +L
Sbjct: 160 DYSKCLLRRATANESL 175

 Score = 36.2 bits (82), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 35/63 (55%)

Query: 112 DEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGF 171
           DE  + +  A+E+ P ++  Y +RA     ++Q++QA KD ++A E DP+    + +L  
Sbjct: 356 DEYAQNFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLAC 415

Query: 172 AKY 174
             Y
Sbjct: 416 LAY 418

>NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON}
           Anc_8.506 YBR155W
          Length = 379

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 48/87 (55%), Gaps = 5/87 (5%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAV-----YYSNRAAAYSSLKQYEQAVKDAEQA 155
           QGN    AK+F +A + Y   I++  +  V      ++N+AA    LK + + + D + A
Sbjct: 82  QGNDLYKAKRFKDARDVYLKGIQIENNKDVKIKESLFANKAACELELKNFRRCINDCKNA 141

Query: 156 IEVDPTYSKGFSRLGFAKYALNKPEEA 182
           ++++P   K + R+  A +AL+K EEA
Sbjct: 142 LQLNPKNVKCYFRMTRAFFALDKLEEA 168

>ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 379

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 51/99 (51%), Gaps = 4/99 (4%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPS----NAVYYSNRAAAYSSLKQYEQAVKDAEQAI 156
           Q N    AK+F EA E Y   IE+  +    N   ++N AA    +K + + +   ++A+
Sbjct: 84  QANDLYKAKRFKEAREVYKKGIEIKCNDDKVNESLFANLAACELEIKNFRRCINLCQKAL 143

Query: 157 EVDPTYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEGE 195
           + +P   K + R+  A Y LNK +EA ++ K  L I+ E
Sbjct: 144 QFNPKNMKCYYRIAKAFYQLNKLDEAKESVKFGLTIDSE 182

>Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)
           [1125 nt, 375 aa]
          Length = 374

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 45/89 (50%), Gaps = 4/89 (4%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPS----NAVYYSNRAAAYSSLKQYEQAVKDAEQAI 156
           QGN     K+F +A E Y  AI+V       N   Y+NRAA    LK Y + + D + A+
Sbjct: 80  QGNDLYKVKRFRDARELYNKAIDVKCDDDKINESLYANRAACELELKNYRRCINDCKMAL 139

Query: 157 EVDPTYSKGFSRLGFAKYALNKPEEALDA 185
            ++P   K + R+  A  A+ K ++  +A
Sbjct: 140 SLNPKNIKCYFRMAKAFLAIEKFDDCKEA 168

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 49/83 (59%), Gaps = 1/83 (1%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +GN+    KK+D+AI+ Y  A+E+   + V+YSN +A Y S+   ++ V+ + +A+E+ P
Sbjct: 105 KGNQFFRNKKYDDAIKYYNWALELK-EDPVFYSNLSACYVSVGDLKKVVEMSTKALELKP 163

Query: 161 TYSKGFSRLGFAKYALNKPEEAL 183
            YSK   R   A   L K  +A+
Sbjct: 164 DYSKVLLRRASANEGLGKFADAM 186

 Score = 30.0 bits (66), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 32/61 (52%)

Query: 118 YTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALN 177
           +  A+++  +N+  Y +R      L+ Y+QA KD ++A E+DP     + +L    Y  N
Sbjct: 386 FDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445

Query: 178 K 178
           K
Sbjct: 446 K 446

>KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 378

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 61/115 (53%), Gaps = 5/115 (4%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEV----SPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAI 156
           QGN    AK++ +A E Y   I++    S  N   +SNRAA    LK Y + V D ++A+
Sbjct: 84  QGNDLYRAKRYKDAREIYNRGIDIKCDDSKVNESLFSNRAACELELKNYRRCVNDCKRAL 143

Query: 157 EVDPTYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEGE-KATDVMKRDYETAKK 210
           + +    K + R+  A   LNK E+A  A +  L ++ E +A + ++++ +  K+
Sbjct: 144 QYNVKNIKCYYRIAKAFLLLNKLEDAKQAAEFGLKLDPENQALNALRQNVDKKKQ 198

>Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar to
           Ashbya gossypii AGL268C
          Length = 370

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 41/86 (47%), Gaps = 4/86 (4%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPS----NAVYYSNRAAAYSSLKQYEQAVKDAEQAI 156
           QGN     K++ +A   Y+  IEV       N   Y NRAA    L+ +   + D ++A+
Sbjct: 85  QGNDLYKVKRYKDARTMYSKGIEVKCEDDSINGSLYLNRAACELELRNFRSCINDCKKAL 144

Query: 157 EVDPTYSKGFSRLGFAKYALNKPEEA 182
             +    K F R+G A + L K EEA
Sbjct: 145 NFNAKCVKAFYRMGQAYFKLKKLEEA 170

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 51/96 (53%), Gaps = 2/96 (2%)

Query: 74  GVSGEPVKVHIP-VEDXXXXXXXXXXXXQGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYY 132
           G +GEP+  +I  +              +GN+    K +D A++ Y  A+ V   + V+Y
Sbjct: 79  GQNGEPLLENIEELSQELRETYATALKDRGNEFFKKKDYDNALKYYNYAL-VVKKDPVFY 137

Query: 133 SNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSR 168
           SN +A Y SL Q ++ V+++ +A+E+ P YSK   R
Sbjct: 138 SNISACYVSLGQLDKVVENSTKALELKPDYSKALLR 173

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 43/68 (63%), Gaps = 1/68 (1%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +GN+    KK+D+AI+ Y  A+E+   + V+YSN +A Y S+   ++ V+ + +A+E+ P
Sbjct: 105 KGNQYFRNKKYDDAIKYYNWALELK-EDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKP 163

Query: 161 TYSKGFSR 168
            YSK   R
Sbjct: 164 DYSKVLLR 171

 Score = 33.9 bits (76), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 34/61 (55%)

Query: 118 YTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALN 177
           +  A++++P+N+  Y +R      L+ Y+QA KD ++A E+DP     + +L    Y  N
Sbjct: 386 FDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445

Query: 178 K 178
           K
Sbjct: 446 K 446

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 43/68 (63%), Gaps = 1/68 (1%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +GN+    KK+D+AI+ Y  A+E+   + V+YSN +A Y S+   ++ V+ + +A+E+ P
Sbjct: 105 KGNQFFRNKKYDDAIKYYNWALELK-DDPVFYSNLSACYVSVGDLKKVVEMSTKALELKP 163

Query: 161 TYSKGFSR 168
            YSK   R
Sbjct: 164 DYSKVLLR 171

 Score = 30.4 bits (67), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 32/61 (52%)

Query: 118 YTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALN 177
           +  A+++  +N+  Y +R      L+ Y+QA KD ++A E+DP     + +L    Y  N
Sbjct: 386 FDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445

Query: 178 K 178
           K
Sbjct: 446 K 446

>CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121c TOM70 or uniprot|P38825 Saccharomyces cerevisiae
           YHR117w TOM7
          Length = 600

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 42/68 (61%), Gaps = 1/68 (1%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +GN     K+F++AIE Y  AI++   + V++SN +A Y SL   ++ V+ + +A+E+ P
Sbjct: 99  KGNALFKEKRFEDAIEFYNHAIKLH-EDPVFHSNISACYVSLGDLDKVVESSTRALELKP 157

Query: 161 TYSKGFSR 168
            YSK   R
Sbjct: 158 DYSKALLR 165

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 32/65 (49%)

Query: 118 YTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALN 177
           +  AI + P+NA  Y +R   Y   + YE+A +D +++ E DP     + +L    Y  N
Sbjct: 369 FEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYREN 428

Query: 178 KPEEA 182
           K  E 
Sbjct: 429 KMAEC 433

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 54/96 (56%), Gaps = 4/96 (4%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +GN+    K +D A++ Y  A+ +   + V+YSN +A Y S+ Q ++ V+++ +A+E+ P
Sbjct: 112 KGNEFFKQKDYDNALKYYDYALTLK-KDPVFYSNISACYVSMNQLDKVVENSTKALELKP 170

Query: 161 TYSKGFSRLGFAKYAL-NKPEEALDAYKKVLDIEGE 195
            YSK   R   A  +L N P+   D    VL + G+
Sbjct: 171 DYSKALLRRASANESLENYPDAMFDL--SVLSLNGD 204

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 35/69 (50%)

Query: 110 KFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRL 169
           K +E  E +  AI++ P NA  Y +R   Y    QYE+A +D ++A +++      + +L
Sbjct: 365 KAEEYYEFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQL 424

Query: 170 GFAKYALNK 178
               Y  NK
Sbjct: 425 ACLAYRENK 433

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 43/68 (63%), Gaps = 1/68 (1%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +GN+    KK+D+AI+ Y  A+E+   + V+YSN +A Y S+   ++ V+ + +A+E+ P
Sbjct: 105 KGNQYFRNKKYDDAIKYYNWALELK-EDPVFYSNLSACYVSVGDLKKVVEMSTKALELKP 163

Query: 161 TYSKGFSR 168
            YSK   R
Sbjct: 164 DYSKVLLR 171

>TBLA0F03220 Chr6 complement(782214..783824) [1611 bp, 536 aa] {ON}
           Anc_3.395 YPR088C
          Length = 536

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 41/65 (63%), Gaps = 5/65 (7%)

Query: 268 NPQVMQAAEKMM-QNPGLMQDMMSNPAMKQMANQFSSGGGMP---DLSQMMNDPSIRDMA 323
           +PQ+MQ A++ + QNPG+M++MM+            S GGMP   D+ +MM DP +++MA
Sbjct: 472 SPQMMQQAQQRLRQNPGMMENMMNMFGGAGGMPGMGSAGGMPNMNDMMKMMQDPKMQEMA 531

Query: 324 KNMFG 328
           +  FG
Sbjct: 532 RQ-FG 535

>KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON}
           Anc_6.328 YCR060W
          Length = 117

 Score = 44.3 bits (103), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 40/85 (47%), Gaps = 7/85 (8%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAI---- 156
           QGN A     F  A E Y   I + P N + YSNRA A   L+++ + +   ++ +    
Sbjct: 10  QGNVAFRNSNFSSAAEYYGKCICLEPENPIGYSNRAMALIKLQKFSETIDTCQRGLGKLE 69

Query: 157 ---EVDPTYSKGFSRLGFAKYALNK 178
              + +P   K   RL  A+ +LNK
Sbjct: 70  DNEKDEPIRKKLLYRLHLAQESLNK 94

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 54/95 (56%), Gaps = 2/95 (2%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +GN+   +K  + AI+ Y  A+ +   + V+YSN +A Y ++ Q ++ ++ + +A+E+ P
Sbjct: 164 KGNQYFKSKDNENAIKYYEYALRLD-QDPVFYSNISACYFAMNQLDKVIESSNKALELKP 222

Query: 161 TYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEGE 195
            YSK   R   A  AL   +EAL  +  +L + GE
Sbjct: 223 DYSKALLRRANAYEALGNNKEALYDF-SILSLFGE 256

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 48/83 (57%), Gaps = 1/83 (1%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +GN+    +K+++A++ Y  A+++   + V+YSN +A Y SL   E+ V+ + +A+E+ P
Sbjct: 105 KGNQFFKEQKYEDALKYYNYALDLK-QDPVFYSNISACYVSLGNLEKVVESSTKALELKP 163

Query: 161 TYSKGFSRLGFAKYALNKPEEAL 183
            YSK   R   A   L    EA+
Sbjct: 164 DYSKALLRRASANENLENFAEAM 186

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 41/68 (60%), Gaps = 1/68 (1%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +GN+    K  +EAI+ Y  A+E    + V+Y+N +A Y SL  +E+ +++  +A+E+ P
Sbjct: 112 KGNELFKEKAVEEAIKYYQWALEFK-KDPVFYANISACYVSLNDFEKVLENCNKALELKP 170

Query: 161 TYSKGFSR 168
            YSK   R
Sbjct: 171 DYSKVLLR 178

>NCAS0I00870 Chr9 (160192..161949) [1758 bp, 585 aa] {ON} Anc_3.395
           YPR088C
          Length = 585

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 44/68 (64%), Gaps = 15/68 (22%)

Query: 268 NPQVMQAAE-KMMQNPGLMQDMMSNPAMKQMANQF-SSGGGMPDLSQ---MMNDPSIRDM 322
           +PQ+MQ A+ ++ QNPG+MQ+         M N F  +GGGMPD+++   MM DP+++ M
Sbjct: 527 SPQMMQQAQQRLRQNPGMMQN---------MQNMFGGAGGGMPDMNEMMKMMQDPNMQKM 577

Query: 323 AKNMFGGG 330
           A+  FG G
Sbjct: 578 AQQ-FGMG 584

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 41/64 (64%), Gaps = 1/64 (1%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +GN     K ++ AI  Y  A+++  ++ V+YSN AA Y SL+  ++A++   +A+E++P
Sbjct: 92  RGNAYFKVKDYENAINYYKFALQLK-NDPVFYSNMAACYISLEHNKEAIEACSKALELNP 150

Query: 161 TYSK 164
            YSK
Sbjct: 151 DYSK 154

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 106 MAAKKFDEAI-EKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           MA K  DE     +  AI++ P+ A  Y +R      +++YE+A +D ++A E DPT
Sbjct: 341 MADKGLDEEYYSNFQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPT 397

>TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.506
           YBR155W
          Length = 375

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 62/121 (51%), Gaps = 10/121 (8%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPS----NAVYYSNRAAAYSSLKQYEQAVKDAEQAI 156
           +GN+    K++ +A E YT  I+V       N   Y+NRAA    LK + + ++D ++A+
Sbjct: 80  RGNEFYKLKQYRDAREVYTKGIDVKCDDDKINESLYANRAACELELKNFRKCIEDCKKAL 139

Query: 157 EVDPTYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKAT------DVMKRDYETAKK 210
             +    K + R+G A  ++++ +E+ ++ +  L I+ E  +       + KR  E  ++
Sbjct: 140 SFNVKNIKCYYRMGKAFLSVDRFDESKESIEFGLKIDSENKSLKNLLQAIEKRQLEIQRR 199

Query: 211 K 211
           K
Sbjct: 200 K 200

>KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 370

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 55/119 (46%), Gaps = 13/119 (10%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPS----NAVYYSNRAAAYSSLKQYEQAVKDAEQAI 156
           QGN     K+F +A   Y  A++V       N   Y N AA    +K Y   +    +A+
Sbjct: 76  QGNDLYKGKRFKDARAMYLKALDVKCDVLSINESLYLNLAACELEIKNYRSCINYCREAL 135

Query: 157 EVDPTYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEGE---------KATDVMKRDYE 206
           +++    K F R+G A   L + E++L+A +  L ++ E         KAT+ +KR  E
Sbjct: 136 KLNAKNVKAFFRIGKAYLELGRFEDSLEAVQVGLAVDPENGALKSIQSKATEKLKRKKE 194

>YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Component
           of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1);
           contains a single TPR domain with at least two TPR
           motifs; R2TP complex interacts with Hsp90 (Hsp82p and
           Hsc82p) to mediate assembly large protein complexes such
           as box C/D snoRNPs and RNA polymerase II
          Length = 111

 Score = 40.0 bits (92), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 29/61 (47%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           QGN       + EA+  Y   I   P N V YSN+A A   L +Y QA++  +Q +    
Sbjct: 10  QGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTS 69

Query: 161 T 161
           T
Sbjct: 70  T 70

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 46/83 (55%), Gaps = 1/83 (1%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +GN+    K ++ A++ Y  A+ +   + V+YSN +A Y SL + ++ ++ + +A+E+ P
Sbjct: 114 KGNEYFKEKDYENALKFYDFAL-ILKKDPVFYSNMSACYVSLNELDKVIEMSTKALELKP 172

Query: 161 TYSKGFSRLGFAKYALNKPEEAL 183
            YSK   R   A   L    +A+
Sbjct: 173 DYSKALLRRATANEQLENYSDAM 195

>NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {ON}
           Anc_7.412 YBL084C
          Length = 809

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 61/126 (48%), Gaps = 10/126 (7%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           G  +M   ++++A+  +  A  ++PSNA+           L   E+A+   E A ++ PT
Sbjct: 665 GMCSMKLGEYEQALVYFEKARSINPSNAILICCCGVTMEKLGNQEKALNYYELACQIQPT 724

Query: 162 YSKGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKAT---------DVMKRDYETAKKKV 212
            S    +     Y++ K  +ALDA+++++ I  E+AT          +M R  + A K+ 
Sbjct: 725 SSLAKFKRAHLLYSMAKYTQALDAFEELIKIAPEEATVQFILGQLYQIMGRK-KDAIKRY 783

Query: 213 ETSMNL 218
             +MNL
Sbjct: 784 TIAMNL 789

 Score = 30.4 bits (67), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 43/103 (41%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           QG++ ++   +D A   Y  AI     +   Y         L +YEQA+   E+A  ++P
Sbjct: 630 QGHEYLSMDSYDTAKTFYRKAISNDLHHYNAYYGMGMCSMKLGEYEQALVYFEKARSINP 689

Query: 161 TYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKATDVMKR 203
           + +      G     L   E+AL+ Y+    I+   +    KR
Sbjct: 690 SNAILICCCGVTMEKLGNQEKALNYYELACQIQPTSSLAKFKR 732

>CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {ON}
           weakly similar to uniprot|P25638 Saccharomyces
           cerevisiae YCR060w
          Length = 142

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 36/63 (57%), Gaps = 4/63 (6%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           GN+     ++D AIE+Y   I + P+NAV YSN A AY  LK   +   +A+ A E+  +
Sbjct: 42  GNEHFKKGEYDLAIEQYRKCISLEPTNAVGYSNLAMAY--LKN--RCPDEAKTACEMGLS 97

Query: 162 YSK 164
           Y K
Sbjct: 98  YCK 100

>ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR080W (DIA2)
          Length = 685

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 45/100 (45%), Gaps = 11/100 (11%)

Query: 126 PSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNKPEEALDA 185
           P   V   NRAA +  L + ++A+ DA   I VD    KG+ R G     L + EEAL  
Sbjct: 67  PRFFVLLDNRAATFEKLNKLDRALADAAYMITVDAYNLKGYIRRGKVLQKLGRYEEALQV 126

Query: 186 YKKVLDIEGE-----------KATDVMKRDYETAKKKVET 214
           Y+  L   GE           K  D++ R   T K+ +++
Sbjct: 127 YENGLKQAGEAEKTHAIHAPQKFLDIVYRQRSTIKELLQS 166

>TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8.506
           YBR155W
          Length = 374

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 44/86 (51%), Gaps = 4/86 (4%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSN----AVYYSNRAAAYSSLKQYEQAVKDAEQAI 156
           QGN+A   K++  A   Y   IEV+ +N     + + N+AA    +K Y   + D ++A+
Sbjct: 80  QGNEAYKLKQYRNARVLYERGIEVNCNNDKINELLFVNKAACELEMKNYRSCINDCKKAL 139

Query: 157 EVDPTYSKGFSRLGFAKYALNKPEEA 182
             +P   K + R+  A  A+ K +E+
Sbjct: 140 SFNPLNVKCYFRMAKAFSAIEKYDES 165

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 32/58 (55%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEV 158
           +GN +     + EAI  Y   I + PSN + YSN+A A     ++++A+   E+ +++
Sbjct: 9   KGNISFKNGSYSEAISWYNRCISIDPSNPIGYSNKAMALLKADRFDEAITTCEKGLQL 66

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 39/68 (57%), Gaps = 1/68 (1%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +GN     + F+ A++ Y  A+ +   + V+YSN +A Y SL Q E+ V+ + +A+++  
Sbjct: 111 KGNDYFKKQDFENALKYYNYALTLK-QDPVFYSNISACYVSLGQLEKVVESSTEALKLKH 169

Query: 161 TYSKGFSR 168
            YSK   R
Sbjct: 170 DYSKALLR 177

 Score = 36.6 bits (83), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 37/67 (55%)

Query: 112 DEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGF 171
           +E+I+ + AAI +  +NA  Y +R   Y   +QYE+A  D ++A E+D +    + +L  
Sbjct: 366 EESIKNFDAAINLDATNAATYYHRGQLYFLTQQYEKAGIDFDKAKELDESNILPYIQLAC 425

Query: 172 AKYALNK 178
             Y  NK
Sbjct: 426 LAYKENK 432

>KAFR0B00250 Chr2 complement(58608..62870) [4263 bp, 1420 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1420

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 60/108 (55%), Gaps = 8/108 (7%)

Query: 113 EAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP--TYSKGFSRLG 170
           ++IE + +A+ V P++   +     AY +  + E ++K  E+A+E+ P   Y+K F+ + 
Sbjct: 702 DSIEWFQSALRVDPNDIESWVGLGQAYFACGRVEASIKVFEKAVELSPDHNYAKYFNSVA 761

Query: 171 FAKYALNKPEEALDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNL 218
            A+  +++ E A+D  + VL  E EK  +V K   E A + V+ S +L
Sbjct: 762 LAQ--MDEFERAIDILRHVLKDEPEK--EVFKM--ELATQIVDYSFDL 803

>SAKL0E14542g Chr5 (1199439..1201511) [2073 bp, 690 aa] {ON} weakly
           similar to uniprot|Q7LGN4 Saccharomyces cerevisiae
           YOR080W DIA2 Protein of unknown function involved in
           invasive and pseudohyphal growth
          Length = 690

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 35/62 (56%)

Query: 134 NRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNKPEEALDAYKKVLDIE 193
           NRAA++  L + ++A+KDA+  I V+P   K + R G     LNK +EA   Y + L + 
Sbjct: 76  NRAASWEKLGKLDKALKDAKNMIRVEPHNLKCYIRCGKILQKLNKDKEAYSNYSQGLKMA 135

Query: 194 GE 195
            E
Sbjct: 136 KE 137

>TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {ON}
           Anc_7.412 YBL084C
          Length = 746

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 42/91 (46%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           GN     K   EAI+ +  A +V P  A  Y+ +   Y+S   ++ A +   +AI  DP 
Sbjct: 535 GNFLSLQKNHHEAIKAFEKATQVDPKFAYAYTLQGHEYTSSDSFDVAKRCYRKAIACDPG 594

Query: 162 YSKGFSRLGFAKYALNKPEEALDAYKKVLDI 192
           +   +  LG     L + EEAL  ++K   I
Sbjct: 595 HYNAYYGLGMVSMKLGQYEEALLFFEKARSI 625

 Score = 33.9 bits (76), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 44/103 (42%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           QG++  ++  FD A   Y  AI   P +   Y         L QYE+A+   E+A  ++P
Sbjct: 568 QGHEYTSSDSFDVAKRCYRKAIACDPGHYNAYYGLGMVSMKLGQYEEALLFFEKARSINP 627

Query: 161 TYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKATDVMKR 203
                    G A   L+  E+AL  Y+   +++   +    KR
Sbjct: 628 INVVLVCCGGVALEKLSYQEKALQYYELACELQPSSSLATFKR 670

 Score = 30.4 bits (67), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 22/97 (22%), Positives = 46/97 (47%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           G  +M   +++EA+  +  A  ++P N V       A   L   E+A++  E A E+ P+
Sbjct: 603 GMVSMKLGQYEEALLFFEKARSINPINVVLVCCGGVALEKLSYQEKALQYYELACELQPS 662

Query: 162 YSKGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKAT 198
            S    +     Y++ +   AL  ++++  +  ++AT
Sbjct: 663 SSLATFKRAHLLYSMGRYTLALKFFEELKHVAPDEAT 699

>Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON}
           (123502..125622) [2121 nt, 707 aa]
          Length = 706

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 45/98 (45%), Gaps = 11/98 (11%)

Query: 126 PSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNKPEEALDA 185
           P     Y N +A Y  L++ ++A + + + I ++P   KG+ R+G       K  EA   
Sbjct: 68  PKLVKLYDNLSATYEKLQELDKAYESSSRMIHIEPYNMKGYIRMGKVLQRQGKDPEAYKC 127

Query: 186 YKKVL-----------DIEGEKATDVMKRDYETAKKKV 212
           YKK L            +  EK  D++K+  +  KK++
Sbjct: 128 YKKGLLMSREMLQKFDIVVPEKFRDIIKQQRDIVKKRI 165

>CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON}
           similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244w PAS10 peroxisomal targeting signal receptor
          Length = 590

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/92 (22%), Positives = 51/92 (55%), Gaps = 3/92 (3%)

Query: 107 AAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGF 166
           A  +FD  I+ + AA++V+P++ + ++   A+ ++  + E+A++   +A+++ P++ +  
Sbjct: 436 ANDEFDRTIDCFQAALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRAR 495

Query: 167 SRLGFAKYALNKPEEALDAYKKVL---DIEGE 195
             L  +   +   +EA +     L   D+EGE
Sbjct: 496 YNLAVSSMNIGCYKEAAEHLLTALSMHDVEGE 527

>Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W
           (REAL)
          Length = 118

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 30/57 (52%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIE 157
           QGN       + EA++ Y   I   P N V YSN+A A   L ++ QA++  +Q ++
Sbjct: 14  QGNALFKQGLYLEAVDSYDRLIAAQPQNPVGYSNKAMALIKLGEHAQAIQACQQGLQ 70

>KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 710

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 41/87 (47%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           GN     K  DEAI  +  AI++ P  A  Y+ +   YS+   ++ A     +A+ ++ T
Sbjct: 499 GNLHSLNKDHDEAITAFGKAIQLDPFFAYAYTLQGHEYSNNDAFDNAKSCFRKALTIEKT 558

Query: 162 YSKGFSRLGFAKYALNKPEEALDAYKK 188
           +      LG     L K EEAL  ++K
Sbjct: 559 HYNALYGLGMCCVKLGKFEEALLFFEK 585

>YNL313C Chr14 complement(45308..48022) [2715 bp, 904 aa] {ON}
           EMW1Essential conserved protein with a role in
           maintaining cell wall integrity; contains six TPR
           (tetratricopeptide repeat) domains clustered in the
           C-terminal region; conditional mutant is suppressed by
           overexpression of GFA1
          Length = 904

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 49/97 (50%), Gaps = 1/97 (1%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           G   +   K   A E +T  + + P +A+ +SN +AAY+ + + ++A    ++AI  D  
Sbjct: 644 GCVGLQCGKMQIAAEAFTRCVSLDPYHALSWSNLSAAYTKMDKLKEAYSCLKRAISCDAQ 703

Query: 162 YS-KGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKA 197
            + K +         LN+ E+ L A K+++ I  +K+
Sbjct: 704 KNWKIWENYMLVAVKLNEWEDVLTACKQLVSIRRDKS 740

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 43/86 (50%), Gaps = 8/86 (9%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEV-- 158
           +GN+      +  AI+ Y   IE++P N + YSN+A A     + ++AV+  +  ++   
Sbjct: 9   EGNQYFKEGNYASAIKSYEKCIEINPENPIGYSNKAMALIKANKNQEAVRTCQDGLKRVS 68

Query: 159 --DPTY----SKGFSRLGFAKYALNK 178
             D T+     K   RL  A+ ALNK
Sbjct: 69  KNDATHETIQKKLEYRLELAEKALNK 94

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 35/74 (47%), Gaps = 5/74 (6%)

Query: 145 YEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKATDVMKRD 204
           Y  A+K  E+ IE++P    G+S    A    NK +EA+   +     +G K        
Sbjct: 19  YASAIKSYEKCIEINPENPIGYSNKAMALIKANKNQEAVRTCQ-----DGLKRVSKNDAT 73

Query: 205 YETAKKKVETSMNL 218
           +ET +KK+E  + L
Sbjct: 74  HETIQKKLEYRLEL 87

>NDAI0F00400 Chr6 complement(96274..98568) [2295 bp, 764 aa] {ON}
           Anc_5.689 YOR080W
          Length = 764

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 37/69 (53%), Gaps = 1/69 (1%)

Query: 134 NRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNKPEEALDAYKKVLDIE 193
           NRAA +  + + E+A++DA +   ++P   K F R G     L+K ++A + YK  L   
Sbjct: 99  NRAACWEKMGELEKALRDATKMCFIEPYNLKCFIRKGKILQKLHKLKDAYNTYKTALR-N 157

Query: 194 GEKATDVMK 202
              ATD +K
Sbjct: 158 ANFATDSLK 166

>NCAS0C04490 Chr3 complement(919665..922421) [2757 bp, 918 aa] {ON}
           Anc_3.32 YNL313C
          Length = 918

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 51/97 (52%), Gaps = 1/97 (1%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           G  A+   K + A E ++  + + P++A+ +SN +AAY  L + ++A    +++I  D  
Sbjct: 651 GCVALECNKMEVAAEAFSRCVSLDPTHAMAWSNLSAAYVELNKLKEAFSCLKRSIACDSQ 710

Query: 162 YS-KGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKA 197
            + + +         LN+ ++ L A K++++I   K+
Sbjct: 711 RNWRIWENYMLVSAKLNEWDDVLIACKQLVNIRRNKS 747

>Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {ON}
           YBR112C (REAL)
          Length = 1020

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 43/79 (54%)

Query: 112 DEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGF 171
           D A   Y A ++ +PS+A   ++ A  Y S   +++A +  E+A+ V+P  S  ++ LG 
Sbjct: 65  DRAAMAYDATLQFNPSSAKALTSLAHLYRSRDMFQRAAELYERALLVNPELSDVWATLGH 124

Query: 172 AKYALNKPEEALDAYKKVL 190
               L+  + A +AY++ L
Sbjct: 125 CYLMLDDLQRAYNAYQQAL 143

>Kwal_23.5408 s23 (1146253..1150485) [4233 bp, 1410 aa] {ON} YPR189W
           (SKI3) - Contains 8 copies of the TPR domain [contig 8]
           FULL
          Length = 1410

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 37/66 (56%), Gaps = 2/66 (3%)

Query: 113 EAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT--YSKGFSRLG 170
           E+IE + +A+ V PS+   +     AY +  + E +VK  E+A+EV+PT  Y+  F  L 
Sbjct: 698 ESIEWFQSALRVDPSDLESWVGLGQAYYACGRVEASVKVFEKALEVEPTSAYAHYFKALS 757

Query: 171 FAKYAL 176
            ++  L
Sbjct: 758 LSRMGL 763

>CAGL0E01573g Chr5 complement(149084..151798) [2715 bp, 904 aa] {ON}
           similar to uniprot|P42842 Saccharomyces cerevisiae
           YNL313c
          Length = 904

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 54/104 (51%), Gaps = 5/104 (4%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           G  A+   K + A E +T    + P++A+ +SN +AAY    + ++A    +QAI  D  
Sbjct: 640 GCIALECNKMEIAAEAFTRCTALDPTHAMSWSNLSAAYVQQGKLKEAHSCLKQAISSDSQ 699

Query: 162 YS-KGFSRLGFAKYALNKPEEALDAYKKVLDIE----GEKATDV 200
            + + +         L++ E+ L A K++++I+    GE+A D+
Sbjct: 700 KNWRIWENFLLVSVKLDEWEDVLAACKQLIEIKKDKSGEQAIDL 743

>Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON}
           YBR112C (REAL)
          Length = 984

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 43/79 (54%)

Query: 112 DEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGF 171
           D A   Y A ++ +PS+A   ++ A  Y S   +++A +  E+A+ V+P  S  ++ LG 
Sbjct: 57  DRAAMAYDATLQFNPSSAKALTSLAHLYRSRDMFQRAAELYERALLVNPELSDVWATLGH 116

Query: 172 AKYALNKPEEALDAYKKVL 190
               L+  + A +AY++ L
Sbjct: 117 CYLMLDDLQRAYNAYQQAL 135

>ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} similar
           to uniprot|P38042 Saccharomyces cerevisiae YBL084C CDC27
           Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 727

 Score = 38.5 bits (88), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 40/91 (43%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           GN     +  DEAI  +  A EV P  A  Y+ +   +SS    + A     +AI  DP 
Sbjct: 516 GNLYSLQRDHDEAIRYFEKATEVDPHFAYGYTLQGHEHSSNDSIDMAKTCYRKAIASDPQ 575

Query: 162 YSKGFSRLGFAKYALNKPEEALDAYKKVLDI 192
           +   +  LG     L + EEAL  ++K   I
Sbjct: 576 HYNAYYGLGMCCMKLGQYEEALLYFEKARSI 606

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 16/69 (23%), Positives = 35/69 (50%)

Query: 122 IEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNKPEE 181
           +E  P     + +    YS  + +++A++  E+A EVDP ++ G++  G    + +  + 
Sbjct: 502 LETQPDKPQTWCSLGNLYSLQRDHDEAIRYFEKATEVDPHFAYGYTLQGHEHSSNDSIDM 561

Query: 182 ALDAYKKVL 190
           A   Y+K +
Sbjct: 562 AKTCYRKAI 570

>Suva_4.361 Chr4
           complement(631697..632812,632933..633154,633188..634741)
           [2892 bp, 963 aa] {ON} YBR112C (REAL)
          Length = 963

 Score = 38.5 bits (88), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 43/79 (54%)

Query: 112 DEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGF 171
           D A   Y A ++ +PS+A   ++ A  Y S   +++A +  E+A+ V+P  S  ++ LG 
Sbjct: 67  DRAAMAYDATLQFNPSSAKALTSLAHLYRSRDMFQRAAELYERALLVNPELSDVWATLGH 126

Query: 172 AKYALNKPEEALDAYKKVL 190
               L+  + A +AY++ L
Sbjct: 127 CYLMLDDLQRAYNAYQQAL 145

>NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON}
           Anc_8.470
          Length = 590

 Score = 38.1 bits (87), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 21/93 (22%), Positives = 48/93 (51%), Gaps = 3/93 (3%)

Query: 111 FDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLG 170
           FD+ +E +  A++++P++ + ++   A+ ++  + E+A+K   +AI + P++ +    L 
Sbjct: 457 FDKTLECFQNALKINPNDELMWNRLGASLANSNRSEEAIKAYHKAINLKPSFVRARYNLA 516

Query: 171 FAKYALNKPEEALDAYKKVL---DIEGEKATDV 200
            A   +   +EA      VL    + G+  T V
Sbjct: 517 VASMNIGCYQEAAGHLLTVLKMHQVHGQDNTSV 549

>KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.367
           YBR112C
          Length = 973

 Score = 38.5 bits (88), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 43/79 (54%)

Query: 112 DEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGF 171
           D A   Y A ++ +PS+    ++ A  Y S   +++A +  E+A++V+P  S  ++ LG 
Sbjct: 82  DRAALAYDATLQYNPSSTKALTSLAHLYRSRDMFQRAAELYERALQVNPELSDVWATLGH 141

Query: 172 AKYALNKPEEALDAYKKVL 190
               L+  + A +AY++ L
Sbjct: 142 CYLMLDDLQRAYNAYQQAL 160

 Score = 30.8 bits (68), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 17/72 (23%), Positives = 34/72 (47%)

Query: 121 AIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNKPE 180
           ++EV PS+A  + +    +     Y  A    +QA+  D      +  +G   Y +++  
Sbjct: 307 SLEVDPSDATTWYHLGRVHMVRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYR 366

Query: 181 EALDAYKKVLDI 192
           +ALDAY + + +
Sbjct: 367 DALDAYTRAIRL 378

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 35.8 bits (81), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 34/77 (44%), Gaps = 5/77 (6%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +GN+      +  A E Y   +++ P N + YSN+A A   L +Y + V+   + +   P
Sbjct: 9   EGNRNFKEGSYKVAAELYQKCVDIEPENPIGYSNKAMALIKLGRYTEVVELCRKGLTFTP 68

Query: 161 -----TYSKGFSRLGFA 172
                 Y K   RL  A
Sbjct: 69  NTTDTVYKKLNYRLEMA 85

>YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}
           CYC8General transcriptional co-repressor, acts together
           with Tup1p; also acts as part of a transcriptional
           co-activator complex that recruits the SWI/SNF and SAGA
           complexes to promoters; can form the prion [OCT+]
          Length = 966

 Score = 38.1 bits (87), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 43/79 (54%)

Query: 112 DEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGF 171
           D A   Y A ++ +PS+A   ++ A  Y S   +++A +  E+A+ V+P  S  ++ LG 
Sbjct: 63  DRAAMAYDATLQFNPSSAKALTSLAHLYRSRDMFQRAAELYERALLVNPELSDVWATLGH 122

Query: 172 AKYALNKPEEALDAYKKVL 190
               L+  + A +AY++ L
Sbjct: 123 CYLMLDDLQRAYNAYQQAL 141

>Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W
           (REAL)
          Length = 115

 Score = 35.8 bits (81), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 35/72 (48%), Gaps = 2/72 (2%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIE--VD 159
           GN       + EA++ Y   I   P N V YSN+A A   L +Y  A++  ++ +   + 
Sbjct: 15  GNALFKQGLYREAVDSYDQLITAQPQNPVGYSNKAMALIKLAEYTHAIQTCQEGLRYALG 74

Query: 160 PTYSKGFSRLGF 171
           P ++   S+L +
Sbjct: 75  PEHAAIRSKLQY 86

>KNAG0B01290 Chr2 (244938..246551) [1614 bp, 537 aa] {ON} Anc_3.395
           YPR088C gene spans a gap in the genome sequence
          Length = 537

 Score = 37.7 bits (86), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 41/71 (57%), Gaps = 14/71 (19%)

Query: 268 NPQVMQAAE-KMMQNPGLMQDMM-----SNPAMKQMANQFSSGGGMPDLSQMMNDPSIRD 321
           +PQ+MQ A+ ++ QNPG+M++MM     +N     M N       M D+ +MM DP ++ 
Sbjct: 474 SPQMMQQAQQRLKQNPGMMKNMMDMFGGANGGAGGMPN-------MNDMMKMMQDPKMQQ 526

Query: 322 MAKNMFGGGNG 332
           MA+  FG G G
Sbjct: 527 MAQQ-FGAGMG 536

>Suva_14.26 Chr14 complement(41582..44296) [2715 bp, 904 aa] {ON}
           YNL313C (REAL)
          Length = 904

 Score = 37.7 bits (86), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 50/97 (51%), Gaps = 1/97 (1%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           G  A+   K + A E ++  + + P +A+ +SN +AAY  L + ++A    ++A+  D  
Sbjct: 644 GCVALQCGKMEVAAEAFSRCVSLDPHHALSWSNLSAAYIELDKLKEAYSCLKRAVASDAQ 703

Query: 162 YS-KGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKA 197
            + K +         LN+ E+ L A K+++ I  +K+
Sbjct: 704 KNWKIWENYMLVAAKLNEWEDVLIACKQLVSIRRDKS 740

>KLTH0F18150g Chr6 (1462613..1464682) [2070 bp, 689 aa] {ON} weakly
           similar to uniprot|Q7LGN4 Saccharomyces cerevisiae
           YOR080W DIA2 Protein of unknown function involved in
           invasive and pseudohyphal growth
          Length = 689

 Score = 37.7 bits (86), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 37/83 (44%), Gaps = 5/83 (6%)

Query: 124 VSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNKPEEAL 183
           V P       NRAA +  +   ++A+KDA +A   +P   K + R G     L    +AL
Sbjct: 66  VHPRLVKLLDNRAATWEKIGDLKKALKDANRATRFEPYNLKCYLRRGKILQKLRMDGQAL 125

Query: 184 DAYKKVLDIEGEKATDVMKRDYE 206
           + Y+     EG KA   M R Y 
Sbjct: 126 ENYE-----EGVKAIRDMTRKYH 143

>CAGL0K07986g Chr11 complement(792641..794239) [1599 bp, 532 aa]
           {ON} highly similar to uniprot|P20424 Saccharomyces
           cerevisiae YPR088c
          Length = 532

 Score = 37.0 bits (84), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 41/67 (61%), Gaps = 5/67 (7%)

Query: 268 NPQVMQAAE-KMMQNPGLMQDMMSNPAMKQMANQFSSGGGMPDLSQ---MMNDPSIRDMA 323
            PQ+MQ A+ K+ QNPGLM++MM+              GGMPD+++   MM DP ++DMA
Sbjct: 466 TPQLMQQAQQKLRQNPGLMKNMMNMFGGAGGMGGMGGPGGMPDMNEMMKMMQDPQMQDMA 525

Query: 324 KNMFGGG 330
           +  FG G
Sbjct: 526 RQ-FGMG 531

>KNAG0A04120 Chr1 complement(556919..558727) [1809 bp, 602 aa] {ON}
           Anc_8.470 YDR244W
          Length = 602

 Score = 37.0 bits (84), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 20/102 (19%), Positives = 53/102 (51%), Gaps = 3/102 (2%)

Query: 107 AAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGF 166
           A   F++ I+ +  A++V+P++ + ++   AA ++  + E+++K   +A+++ P++ +  
Sbjct: 458 ANDDFNKTIDCFKTALQVNPNDELMWNRLGAALANSNRSEESIKAYHRALQLKPSFVRAR 517

Query: 167 SRLGFAKYALNKPEEALDAYKKVL---DIEGEKATDVMKRDY 205
             L  +   +   +EA++     L   ++EG +  D     Y
Sbjct: 518 YNLAVSSMNIGCYKEAVEHLLTALSMHEVEGLRQKDKDSHHY 559

>YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}
           CDC27Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition
          Length = 758

 Score = 37.0 bits (84), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 59/125 (47%), Gaps = 8/125 (6%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           G  AM   +++EA+  +  A  ++P N V       +   L   E+A++  E A  + PT
Sbjct: 615 GTSAMKLGQYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYKEKALQYYELACHLQPT 674

Query: 162 YSKGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKATD--VMKRDYET------AKKKVE 213
            S    ++G   Y++ +   AL  +++++ +  + AT   ++ + Y        A K++ 
Sbjct: 675 SSLSKYKMGQLLYSMTRYNVALQTFEELVKLVPDDATAHYLLGQTYRIVGRKKDAIKELT 734

Query: 214 TSMNL 218
            +MNL
Sbjct: 735 VAMNL 739

 Score = 34.3 bits (77), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 42/91 (46%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           GN     K  D AI+ +  A ++ P+ A  Y+ +   +SS    + A     +A+  DP 
Sbjct: 547 GNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQ 606

Query: 162 YSKGFSRLGFAKYALNKPEEALDAYKKVLDI 192
           +   +  LG +   L + EEAL  ++K   I
Sbjct: 607 HYNAYYGLGTSAMKLGQYEEALLYFEKARSI 637

>KLTH0A00638g Chr1 complement(63363..67598) [4236 bp, 1411 aa] {ON}
           similar to uniprot|P17883 Saccharomyces cerevisiae
           YPR189W SKI3 dsRNA virus protection family member
           contains 8 copies of the tetratricopeptide (TPR) domain
          Length = 1411

 Score = 37.0 bits (84), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 44/79 (55%), Gaps = 4/79 (5%)

Query: 113 EAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP--TYSKGFSRLG 170
           E+IE + +A+ V P++   +     AY S  + E +VK  E+A+EV P   Y+  F  L 
Sbjct: 699 ESIEWFQSALRVEPADLESWLGLGQAYYSCGRVEASVKVFEKALEVSPGNAYAHYFKALS 758

Query: 171 FAKYALNKPEEALDAYKKV 189
            +K  L   +E+++ ++++
Sbjct: 759 LSKMGLY--DESIEIFREL 775

>AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR244W (PEX5)
          Length = 569

 Score = 36.6 bits (83), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 41/71 (57%), Gaps = 2/71 (2%)

Query: 107 AAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGF 166
           A + FD+ I+ + AA+ V P +   ++   A+ ++  + E+A++   +AI++ PT+ +  
Sbjct: 429 ANEDFDKTIDCFRAALAVRPDDECMWNRLGASLANSNRSEEAIQAYHRAIQLKPTFVR-- 486

Query: 167 SRLGFAKYALN 177
           +R   A  ++N
Sbjct: 487 ARYNLAVSSMN 497

>KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7.546
           YPR189W
          Length = 1418

 Score = 36.6 bits (83), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 46/86 (53%), Gaps = 4/86 (4%)

Query: 113 EAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP--TYSKGFSRLG 170
           E++E + +A+ V P++   +     AY +  + E + K  E+AIE+DP   Y++ F+ L 
Sbjct: 703 ESVEWFHSALRVDPNDVESWVALGQAYFACGRVEASTKVFEKAIEIDPLHLYAQYFNSLS 762

Query: 171 FAKYALNKPEEALDAYKKVLDIEGEK 196
            A+  +   EE ++  K +  +  E+
Sbjct: 763 LAE--MGCFEECIEILKNITQLNPEE 786

>Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON}
           (161135..162958) [1824 nt, 608 aa]
          Length = 607

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/68 (23%), Positives = 43/68 (63%), Gaps = 2/68 (2%)

Query: 110 KFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRL 169
           +FD+ I+ + AA++VSP++ + ++   A+ ++  + E+A++   +A+ + P++ +  +R 
Sbjct: 465 EFDKTIDCFKAALKVSPNDELLWNRLGASLANSNRSEEAIQAYHKALNLKPSFVR--ARY 522

Query: 170 GFAKYALN 177
             A  ++N
Sbjct: 523 NLAVSSIN 530

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 35/64 (54%), Gaps = 8/64 (12%)

Query: 130 VYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNKPEEALDAYKKV 189
           ++YSN         ++++ +   + A++V P     ++RLG +    N+ EEA+ AY K 
Sbjct: 459 LFYSN--------NEFDKTIDCFKAALKVSPNDELLWNRLGASLANSNRSEEAIQAYHKA 510

Query: 190 LDIE 193
           L+++
Sbjct: 511 LNLK 514

>TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {ON}
           Anc_7.412 YBL084C
          Length = 835

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 51/99 (51%), Gaps = 4/99 (4%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           G   M   ++D+A+  +  A  ++PSNA+      +A   L   E+A+   E A  + P 
Sbjct: 693 GTCCMRLGQYDQALLYFEKAKMINPSNAILLCCCGSALEKLNFNEKALNYYELACNLQP- 751

Query: 162 YSKGFSRLGFAK--YALNKPEEALDAYKKVLDIEGEKAT 198
            +  F++   AK  Y++++   AL+  ++V+++  E+ T
Sbjct: 752 -NSSFAKFKLAKLLYSMSRYNLALEILEQVIEMAPEEVT 789

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 44/93 (47%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +G++  +   FD A   Y  AI   P++   Y         L QY+QA+   E+A  ++P
Sbjct: 658 EGHEQASIDAFDTAKNCYRKAIACDPNHYNAYYGLGTCCMRLGQYDQALLYFEKAKMINP 717

Query: 161 TYSKGFSRLGFAKYALNKPEEALDAYKKVLDIE 193
           + +      G A   LN  E+AL+ Y+   +++
Sbjct: 718 SNAILLCCCGSALEKLNFNEKALNYYELACNLQ 750

>CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {ON}
           similar to uniprot|P38042 Saccharomyces cerevisiae
           YBL084c CDC27 subunit of anaphase-promoting complex
          Length = 769

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 41/91 (45%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           GN     K  ++AIE +  A ++ P  A  Y+ +    SS   ++ A K   +AI  DP 
Sbjct: 558 GNYLSLKKDHEDAIEAFEKATKIDPKFAYAYTLQGHECSSNDSFDAAKKCFRKAIACDPR 617

Query: 162 YSKGFSRLGFAKYALNKPEEALDAYKKVLDI 192
           +   +  +G     L   +EAL  ++K   I
Sbjct: 618 HYNAYYGMGIYSMKLGHYDEALLYFEKARQI 648

>KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90 cofactor interacts with Hsp82p Pih1p
           Rvb1 and Rvb2 contains a single TPR domain with at least
           two TPR motifs
          Length = 115

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 27/56 (48%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAI 156
           +GN A     F +A+  Y  AI   P+N V YSN A A   L  Y  A +  ++ +
Sbjct: 10  KGNTAYKQNNFTDAVNFYKKAITYDPTNPVGYSNCAMALIKLNNYADASQMCQRGL 65

>NDAI0G03870 Chr7 complement(926437..929220) [2784 bp, 927 aa] {ON}
           Anc_3.32 YNL313C
          Length = 927

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 53/104 (50%), Gaps = 5/104 (4%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           G  A+   K D A E ++  + +  ++A+ +SN +AAY  L + ++A    ++AI  D  
Sbjct: 661 GCVALECGKMDVAAEAFSRCVSLDQTHAMAWSNLSAAYVELNKLKEAHSCLKRAIASDAQ 720

Query: 162 YS-KGFSRLGFAKYALNKPEEALDAYKKVLDIE----GEKATDV 200
            + + +         LN+ ++ L A ++++DI     GE + D+
Sbjct: 721 KNWRIWENYMLVSVKLNEWDDVLVACRQLVDIRRDTSGEGSIDL 764

>Smik_14.18 Chr14 complement(29815..32529) [2715 bp, 904 aa] {ON}
           YNL313C (REAL)
          Length = 904

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 48/97 (49%), Gaps = 1/97 (1%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           G   +   K   A E ++  + + P +A+ +SN +AAY  + + ++A    ++AI  D  
Sbjct: 644 GCVGLQCGKMQIAAEAFSRCVSLDPYHALSWSNLSAAYMKMDKLKEAYSCLKRAIASDAQ 703

Query: 162 YS-KGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKA 197
            + K +         LN+ E+ L A K++++I  +K 
Sbjct: 704 KNWKIWENFMLVAVKLNEWEDVLMACKQLVNIRRDKC 740

>Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON}
           YBL084C (REAL)
          Length = 769

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 28/125 (22%), Positives = 59/125 (47%), Gaps = 8/125 (6%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           G  +M   +++EA+  +  A  ++P N V       +   L   E+A++  E A  + PT
Sbjct: 626 GTSSMKLGQYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYKEKALQYYELACHLQPT 685

Query: 162 YSKGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKATD--VMKRDYET------AKKKVE 213
            S    ++G   Y++ +   AL  +++++ +  + AT   ++ + Y        A K++ 
Sbjct: 686 SSLSKYKMGQLLYSMTRYNVALQTFEELVKLVPDDATAHYLLGQTYRIVGRKKDAIKELT 745

Query: 214 TSMNL 218
            +MNL
Sbjct: 746 VAMNL 750

>AEL281C Chr5 complement(111535..115707) [4173 bp, 1390 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR189W
           (SKI3)
          Length = 1390

 Score = 35.8 bits (81), Expect = 0.15,   Method: Composition-based stats.
 Identities = 19/79 (24%), Positives = 45/79 (56%)

Query: 113 EAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFA 172
           E+IE + +A+ +  S+   +     AY++  + E ++K  E+A+E+ P +      L  +
Sbjct: 678 ESIEWFQSALRIDSSDVEAWIGLGQAYAACGRIEASIKVFERALELSPEHKYAGLFLAIS 737

Query: 173 KYALNKPEEALDAYKKVLD 191
              L++ E++L+A +K+++
Sbjct: 738 LCQLSEFEKSLEALRKLVN 756

>Ecym_1396 Chr1 (820413..822134) [1722 bp, 573 aa] {ON} similar to
           Ashbya gossypii AFR453W
          Length = 573

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 17/71 (23%), Positives = 41/71 (57%), Gaps = 2/71 (2%)

Query: 107 AAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGF 166
           A  +FD+ I+ + AA+ V P++   ++   A+ ++  + E+A++   +AI++ P + +  
Sbjct: 433 ANDEFDKTIDCFKAALHVRPNDECMWNRLGASLANSNRSEEAIQAYHRAIQLKPAFVR-- 490

Query: 167 SRLGFAKYALN 177
           +R   A  ++N
Sbjct: 491 ARYNLAVSSMN 501

>Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON}
           (280224..282485) [2262 nt, 754 aa]
          Length = 753

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 44/91 (48%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           GN     K  ++AI+ +  A +V P+ A  Y+ +   +SS   ++ A     +A+  DP 
Sbjct: 542 GNFLSLQKDHEDAIKAFEKATQVDPNFAYAYTLQGHEHSSNDSFDTAKNCYRKALACDPQ 601

Query: 162 YSKGFSRLGFAKYALNKPEEALDAYKKVLDI 192
           +   +  LG +   L + +EAL  ++K   I
Sbjct: 602 HYNAYYGLGMSCMKLGQYDEALLHFEKARSI 632

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 22/97 (22%), Positives = 45/97 (46%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           G   M   ++DEA+  +  A  ++P N +       A   L+  E+A+   E A E+ P+
Sbjct: 610 GMSCMKLGQYDEALLHFEKARSINPINVILICCCGVALEKLQYQEKALSYYELACELQPS 669

Query: 162 YSKGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKAT 198
            S    +     Y++ +   AL  ++++  +  ++AT
Sbjct: 670 SSLANFKRAHLLYSMGRYSVALQYFEELTKLAPDEAT 706

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 44/105 (41%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           QG++  +   FD A   Y  A+   P +   Y     +   L QY++A+   E+A  ++P
Sbjct: 575 QGHEHSSNDSFDTAKNCYRKALACDPQHYNAYYGLGMSCMKLGQYDEALLHFEKARSINP 634

Query: 161 TYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKATDVMKRDY 205
                    G A   L   E+AL  Y+   +++   +    KR +
Sbjct: 635 INVILICCCGVALEKLQYQEKALSYYELACELQPSSSLANFKRAH 679

>NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.412
           YBL084C
          Length = 783

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 58/126 (46%), Gaps = 10/126 (7%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           G  +M   +F+ A+  +  A  ++PSN +       A+  L   E+A+   E A +V P+
Sbjct: 640 GMCSMKLGEFEHALLYFEKARSINPSNVILICCCGVAFEKLSYPEKALSYYELACQVQPS 699

Query: 162 YSKGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKAT---------DVMKRDYETAKKKV 212
            S    +     Y++     AL+ ++++  +  E+AT         ++M R  + A K+ 
Sbjct: 700 SSLAKFKRAHLLYSMANYPLALECFEELTKLAPEEATVHFILGQLYNIMGRK-KDAVKEY 758

Query: 213 ETSMNL 218
             +MNL
Sbjct: 759 TIAMNL 764

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 33.9 bits (76), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDA 152
           GN       + +A+E Y   IEV P N + YSN A +   L +Y +A++  
Sbjct: 10  GNTYFKDGNYLKAVEYYKKCIEVEPENPIGYSNSAMSLIKLTKYTEALESC 60

>Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON}
           YBL084C (REAL)
          Length = 751

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 28/125 (22%), Positives = 59/125 (47%), Gaps = 8/125 (6%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           G  +M   +++EA+  +  A  ++P N V       +   L   E+A++  E A  + PT
Sbjct: 608 GTSSMKLGQYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYKEKALQYYELACHLQPT 667

Query: 162 YSKGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKATD--VMKRDYET------AKKKVE 213
            S    ++G   Y++ +   AL  +++++ +  + AT   ++ + Y        A K++ 
Sbjct: 668 SSLSKYKMGQLLYSMTRYSVALQTFEELVKLVPDDATAHYLLGQTYRIVGRKKDAIKELT 727

Query: 214 TSMNL 218
            +MNL
Sbjct: 728 VAMNL 732

 Score = 34.3 bits (77), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 42/91 (46%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           GN     K  D AI+ +  A ++ P+ A  Y+ +   +SS    + A     +A+  DP 
Sbjct: 540 GNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQ 599

Query: 162 YSKGFSRLGFAKYALNKPEEALDAYKKVLDI 192
           +   +  LG +   L + EEAL  ++K   I
Sbjct: 600 HYNAYYGLGTSSMKLGQYEEALLYFEKARSI 630

>Ecym_4031 Chr4 complement(73900..75966) [2067 bp, 688 aa] {ON}
           similar to Ashbya gossypii ADR230W
          Length = 688

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 33/62 (53%)

Query: 126 PSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNKPEEALDA 185
           P   +   NRAA++  +    +A+ DA++ I+VD    KG+ R G     + + +EAL  
Sbjct: 67  PRYLILLDNRAASWERINNLGKALIDADRMIKVDAYNLKGYIRKGKILQKMAQDKEALYV 126

Query: 186 YK 187
           Y+
Sbjct: 127 YR 128

>NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {ON}
           Anc_8.470
          Length = 578

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 21/92 (22%), Positives = 51/92 (55%), Gaps = 12/92 (13%)

Query: 105 AMAAKKFD---EAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           A+  KKF+   E++ ++ A +E+          R   Y +   +++ ++  +++++++P 
Sbjct: 413 AVMIKKFNRLAESLPEHDAKLELI---------RGLLYYAEDDFDKTIECFKESLKINPN 463

Query: 162 YSKGFSRLGFAKYALNKPEEALDAYKKVLDIE 193
               ++RLG +    NKPE+A+ AY + L+++
Sbjct: 464 DEVMWNRLGASLANSNKPEDAIQAYHRALNLK 495

 Score = 34.3 bits (77), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 24/112 (21%), Positives = 53/112 (47%), Gaps = 11/112 (9%)

Query: 107 AAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGF 166
           A   FD+ IE +  +++++P++ V ++   A+ ++  + E A++   +A+ + P++ +  
Sbjct: 443 AEDDFDKTIECFKESLKINPNDEVMWNRLGASLANSNKPEDAIQAYHRALNLKPSFVR-- 500

Query: 167 SRLGFAKYALNKPEEALDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNL 218
                A+Y L      +  YK+     GE    V++         VET  N+
Sbjct: 501 -----ARYNLAVASMNIGCYKEA----GEHLLTVLRMHQVEGVNNVETDNNV 543

>Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W
           (REAL)
          Length = 111

 Score = 33.1 bits (74), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 41/82 (50%), Gaps = 6/82 (7%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEV-- 158
           +GN+      + +AI  Y   I   P N V +SN+A A   L ++ QA++  +Q +++  
Sbjct: 10  EGNELYKQGLYRDAIGCYDRLIAAQPQNPVGHSNKAMALIKLGEHAQAIEACQQGLQLAA 69

Query: 159 DPTY----SKGFSRLGFAKYAL 176
            P +    +K   RL  A+ A+
Sbjct: 70  SPQHAALRAKLLYRLQLAQAAV 91

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 33.9 bits (76), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 30/56 (53%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAI 156
           +GN       ++ AI  Y  A  +  SN +Y+SN A A   L+++++AV   ++ +
Sbjct: 47  KGNTFFKNGDYETAILYYEKACALDSSNPIYFSNMATALIKLERWQEAVNACDKGL 102

>ZYRO0C02970g Chr3 (230414..233104) [2691 bp, 896 aa] {ON} similar
           to uniprot|P42842 Saccharomyces cerevisiae YNL313C
           Protein required for cell viability
          Length = 896

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 51/104 (49%), Gaps = 5/104 (4%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           G   + + K + A E ++  + + P++   +SN +AAY  L + ++A    +QA+  D  
Sbjct: 638 GCVGLESGKMELAAEAFSRCVSLDPTHGAAWSNLSAAYVELDKLKEAFSCLKQAVSTDAR 697

Query: 162 YS-KGFSRLGFAKYALNKPEEALDAYKKVLDIE----GEKATDV 200
            + + +         LN+ ++ L A K ++ I+    GE + D+
Sbjct: 698 KNWRIWENYMLVAMKLNEWQDVLMACKNLVTIKRDRVGEASIDL 741

>KLLA0D09020g Chr4 (758818..760410) [1593 bp, 530 aa] {ON} similar
           to uniprot|P20424 Saccharomyces cerevisiae YPR088C SRP54
           Signal recognition particle (SRP) subunit (homolog of
           mammalian SRP54) contains the signal sequence- binding
           activity of SRP interacts with the SRP RNA and mediates
           binding of SRP to signal receptor contains GTPase domain
          Length = 530

 Score = 34.7 bits (78), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 21/30 (70%), Gaps = 3/30 (10%)

Query: 303 SGGGMP---DLSQMMNDPSIRDMAKNMFGG 329
           SGGGMP   D+  MM DPS+++MAK   GG
Sbjct: 500 SGGGMPNMQDIMGMMQDPSMQEMAKQFSGG 529

>TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {ON}
           Anc_8.470 YDR244W
          Length = 549

 Score = 34.7 bits (78), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 20/91 (21%), Positives = 52/91 (57%), Gaps = 3/91 (3%)

Query: 107 AAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGF 166
           A  +FD+ I+ + AA+ V+P++ + ++   A+ ++  + E+A++   +A+++ P++ +  
Sbjct: 408 ADSEFDKTIDCFKAALSVNPNDELMWNRLGASLANSNRSEEAIQAYYKALQLKPSFVRAR 467

Query: 167 SRLGFAKYALNKPEEA---LDAYKKVLDIEG 194
             L  +   +   +EA   L +  K+ ++EG
Sbjct: 468 YNLAVSSINIGCYKEAAEYLLSALKMHEVEG 498

>Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 763
           aa] {ON} YBL084C (REAL)
          Length = 763

 Score = 34.7 bits (78), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 27/125 (21%), Positives = 59/125 (47%), Gaps = 8/125 (6%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           G  +M   +++EA+  +  A  ++P N V       +   L   E+ ++  E A ++ PT
Sbjct: 620 GTSSMKLGQYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYKEKVLQYYELACQLQPT 679

Query: 162 YSKGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKATD--VMKRDYET------AKKKVE 213
            S    ++G   Y++ +   AL  +++++ +  + AT   ++ + Y        A K++ 
Sbjct: 680 SSLSKYKMGQLLYSMTRYNVALQTFEELVKLVPDDATAHYLLGQTYRIVGRKKDAVKELT 739

Query: 214 TSMNL 218
            +MNL
Sbjct: 740 VAMNL 744

 Score = 34.3 bits (77), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 42/91 (46%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           GN     K  D AI+ +  A ++ P+ A  Y+ +   +SS    + A     +A+  DP 
Sbjct: 552 GNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQ 611

Query: 162 YSKGFSRLGFAKYALNKPEEALDAYKKVLDI 192
           +   +  LG +   L + EEAL  ++K   I
Sbjct: 612 HYNAYYGLGTSSMKLGQYEEALLYFEKARSI 642

>Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 34.7 bits (78), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 16/83 (19%), Positives = 46/83 (55%)

Query: 111 FDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLG 170
           FD+ I+ + +A++V+P++ + ++   A+ ++  + E+A++   +A+++ P++ +    L 
Sbjct: 473 FDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRARYNLA 532

Query: 171 FAKYALNKPEEALDAYKKVLDIE 193
            +   +   +EA      VL + 
Sbjct: 533 VSSMNIGCLKEAAGYLLSVLSMH 555

>AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL084C (CDC27)
          Length = 656

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 24/103 (23%), Positives = 48/103 (46%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           QG++      FD A   Y  A+ ++P++   +     +   L QY++A+   E+A  ++P
Sbjct: 478 QGHEYSNNDAFDNAKMCYRKALAINPNHYNAHYGLGMSCIKLGQYDEALLHFEKARSINP 537

Query: 161 TYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKATDVMKR 203
                    G A   L + E+ALD Y+   +++   +  + K+
Sbjct: 538 VNVILNCCCGVALERLGRREKALDFYQLACELQPNSSLALFKK 580

 Score = 33.5 bits (75), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 42/91 (46%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           GN     +  DEAI+    A  ++P  A  Y+ +   YS+   ++ A     +A+ ++P 
Sbjct: 445 GNLFSLNRDHDEAIKALKKATSLNPQFAYAYTLQGHEYSNNDAFDNAKMCYRKALAINPN 504

Query: 162 YSKGFSRLGFAKYALNKPEEALDAYKKVLDI 192
           +      LG +   L + +EAL  ++K   I
Sbjct: 505 HYNAHYGLGMSCIKLGQYDEALLHFEKARSI 535

>TBLA0B07970 Chr2 (1887119..1889182) [2064 bp, 687 aa] {ON} Anc_5.72
           YHR166C
          Length = 687

 Score = 34.7 bits (78), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 20/91 (21%), Positives = 43/91 (47%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           G++ +  K    AIE Y  A++++P +   +     AY  L  +  ++   ++A  + P 
Sbjct: 494 GHEFVELKNSHAAIECYRRAVDINPRDFKAWYGLGQAYEVLDMHLYSLYYFQKACALKPL 553

Query: 162 YSKGFSRLGFAKYALNKPEEALDAYKKVLDI 192
             + +  LG   + ++  + AL  YK+ L +
Sbjct: 554 DKRMWQALGECYFIVDNTDSALKCYKRALQL 584

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 33.1 bits (74), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 29/58 (50%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEV 158
           +GN       ++ A+  Y  AI   PSN + YSN A     L+++ +AV    + +++
Sbjct: 10  KGNVFFKKCDYETAVLYYQKAITADPSNPIGYSNNAMGLIKLEKWSEAVDACNKGLKM 67

>Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W
           (REAL)
          Length = 612

 Score = 34.7 bits (78), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 14/67 (20%), Positives = 43/67 (64%), Gaps = 2/67 (2%)

Query: 111 FDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLG 170
           FD+ I+ + +A++V+P++ + ++   A+ ++  + E+A++   +A+++ P++ +  +R  
Sbjct: 474 FDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVR--ARYN 531

Query: 171 FAKYALN 177
            A  ++N
Sbjct: 532 LAVSSMN 538

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 29/49 (59%)

Query: 145 YEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNKPEEALDAYKKVLDIE 193
           +++ +   E A++V+P     ++RLG +    N+ EEA+ AY + L ++
Sbjct: 474 FDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLK 522

>Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 34.3 bits (77), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 16/83 (19%), Positives = 46/83 (55%)

Query: 111 FDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLG 170
           FD+ I+ + +A++V+P++ + ++   A+ ++  + E+A++   +A+++ P++ +    L 
Sbjct: 473 FDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRARYNLA 532

Query: 171 FAKYALNKPEEALDAYKKVLDIE 193
            +   +   +EA      VL + 
Sbjct: 533 VSSMNIGCYKEAAGYLLTVLSMH 555

>YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}
           PEX5Peroxisomal membrane signal receptor for the
           C-terminal tripeptide signal sequence (PTS1) of
           peroxisomal matrix proteins, required for peroxisomal
           matrix protein import; also proposed to have
           PTS1-receptor independent functions
          Length = 612

 Score = 34.3 bits (77), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 14/67 (20%), Positives = 42/67 (62%), Gaps = 2/67 (2%)

Query: 111 FDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLG 170
           FD+ I+ + +A+ V+P++ + ++   A+ ++  + E+A++   +A+++ P++ +  +R  
Sbjct: 473 FDKTIDCFESALRVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVR--ARYN 530

Query: 171 FAKYALN 177
            A  ++N
Sbjct: 531 LAVSSMN 537

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 28/49 (57%)

Query: 145 YEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNKPEEALDAYKKVLDIE 193
           +++ +   E A+ V+P     ++RLG +    N+ EEA+ AY + L ++
Sbjct: 473 FDKTIDCFESALRVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLK 521

>KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {ON}
           Anc_7.412 YBL084C
          Length = 739

 Score = 34.3 bits (77), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 41/87 (47%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           QG++  A + +D A   Y  AI   P +   Y       S L +Y++A+   E+A  ++P
Sbjct: 561 QGHEHAANETYDTAKIMYRKAIACDPQHYNAYYGLGDCASRLGKYDKALLYFEKARVINP 620

Query: 161 TYSKGFSRLGFAKYALNKPEEALDAYK 187
             +      G +   LN P++AL  Y+
Sbjct: 621 VNAILICCCGHSLEKLNLPDQALTYYE 647

>Skud_14.26 Chr14 complement(38826..41624) [2799 bp, 932 aa] {ON}
           YNL313C (REAL)
          Length = 932

 Score = 34.3 bits (77), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 49/97 (50%), Gaps = 1/97 (1%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           G   +   K + A E ++  + + P +A+ +SN +AAY  + + ++A    ++AI  D  
Sbjct: 672 GCVGLQCGKMELAAEAFSRCVSLDPYHALSWSNLSAAYMKMDKLKEAYSCLKRAIASDAQ 731

Query: 162 YS-KGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKA 197
            + K +         LN+ ++ L A ++++ I  +KA
Sbjct: 732 KNWKIWENYMLVAVKLNEWDDVLVACRQLVSIRRDKA 768

>Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}
           similar to Ashbya gossypii AGL294W
          Length = 675

 Score = 34.3 bits (77), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 24/103 (23%), Positives = 48/103 (46%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           QG++      FD A   Y  A+ ++P++   +     +   L QY++A+   E+A  ++P
Sbjct: 497 QGHEYSNNDAFDNAKMCYRKALAINPNHYNAHYGLGMSCIKLGQYDEALLHFEKARSINP 556

Query: 161 TYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKATDVMKR 203
                    G A   L + E+ALD Y+   +++   +  + K+
Sbjct: 557 VNVILNCCCGVALERLGRREKALDFYQLACELQPNSSLALFKK 599

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 41/91 (45%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           GN     +  DEAI+    A  + P  A  Y+ +   YS+   ++ A     +A+ ++P 
Sbjct: 464 GNLFSLNRDHDEAIKALKKATNLDPRFAYAYTLQGHEYSNNDAFDNAKMCYRKALAINPN 523

Query: 162 YSKGFSRLGFAKYALNKPEEALDAYKKVLDI 192
           +      LG +   L + +EAL  ++K   I
Sbjct: 524 HYNAHYGLGMSCIKLGQYDEALLHFEKARSI 554

>AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR060W
          Length = 133

 Score = 32.7 bits (73), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 33/58 (56%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEV 158
           +GN   +  +++ A+  Y  A    PSN V+ +N + A   L+++E A+   ++A+E+
Sbjct: 14  KGNDLYSKGEYETAVLYYKNASLAEPSNPVHLANMSMALLKLERWEDALSACDRALEI 71

>Kpol_1050.112 s1050 (249717..252797,252855..252863,252906..253898)
           [4083 bp, 1360 aa] {ON}
           (249717..252797,252855..252863,252906..253898) [4083 nt,
           1361 aa]
          Length = 1360

 Score = 34.3 bits (77), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 113 EAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP--TYSKGFS 167
           +AIE + +A+ + P+N   +     +Y S  + E +++  E+A E+DP   Y+K F+
Sbjct: 686 DAIEWFQSALRIEPNNVESWVGLGQSYLSCGRIEASIRVFEKATELDPDHLYAKYFT 742

>Kwal_55.21839 s55 (998426..1000498) [2073 bp, 690 aa] {ON} YOR080W
           (DIA2) - may be involved in regulation of invasive
           growth and budding pattern [contig 126] FULL
          Length = 690

 Score = 34.3 bits (77), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 37/82 (45%), Gaps = 5/82 (6%)

Query: 124 VSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNKPEEAL 183
           V P       NRAA +  L    +A+KDA +A++ +P   K + R G     L   + AL
Sbjct: 66  VHPRFVKLLDNRAATWEKLGDLTKALKDANRAVKYEPYNLKCYLRKGKILQKLQLDDMAL 125

Query: 184 DAYKKVLDIEGEKATDVMKRDY 205
             Y+     EG +  D M+  Y
Sbjct: 126 KNYE-----EGLQKADEMRSRY 142

>Kwal_14.874 s14 complement(90148..92316) [2169 bp, 722 aa] {ON}
           YKL022C (CDC16) - putative metal-binding nucleic
           acid-binding protein, interacts with Cdc23p and Cdc27p
           to catalyze the conjugation of ubiquitin to cyclin B
           [contig 245] FULL
          Length = 722

 Score = 34.3 bits (77), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 48/105 (45%), Gaps = 2/105 (1%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           +G+ + A K   +A E   A    S S    ++N A  Y  L + E+AV   +  +E   
Sbjct: 552 KGDYSKAKKYLKKAWEAIKALDSESKSWVSIHTNLAHTYRKLGENEKAVTCFKLVLETAG 611

Query: 161 TYSKGFSRLGFAKYALNKPEEALDAYKKVLDIE--GEKATDVMKR 203
             +     LG+    +N+ E+A+DA    L +    + A D++K+
Sbjct: 612 KDTDTLCALGYVYLRMNRIEKAIDALHGALALRPSNQAAQDLLKQ 656

>Suva_16.521 Chr16 (895057..899331) [4275 bp, 1424 aa] {ON} YPR189W
           (REAL)
          Length = 1424

 Score = 34.3 bits (77), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 43/79 (54%), Gaps = 4/79 (5%)

Query: 113 EAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP--TYSKGFSRLG 170
           ++IE + +A+ V P++   +     AY +  + E ++K  ++AIE+ P  TY++ F  L 
Sbjct: 713 DSIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKVFDKAIELQPSHTYARYFRALS 772

Query: 171 FAKYALNKPEEALDAYKKV 189
                + +  E+L+  +KV
Sbjct: 773 LCD--MGEYLESLETLEKV 789

>Suva_16.417 Chr16 complement(718714..720333) [1620 bp, 539 aa] {ON}
           YPR088C (REAL)
          Length = 539

 Score = 33.9 bits (76), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 40/65 (61%), Gaps = 3/65 (4%)

Query: 268 NPQVMQAAE-KMMQNPGLMQDMMSNPAMKQMANQFSSGG-GMPDLSQMMNDPSIRDMAKN 325
           +PQ+MQ A+ K+ QNPGLMQ+MMS      M      G   M ++ +MM DP +++MAK 
Sbjct: 476 SPQMMQQAQQKLKQNPGLMQNMMSMFGGSGMGGGMGGGMPDMNEMMKMMQDPQMQEMAKQ 535

Query: 326 MFGGG 330
            FG G
Sbjct: 536 -FGMG 539

>NCAS0A15300 Chr1 (3006855..3011051) [4197 bp, 1398 aa] {ON} 
          Length = 1398

 Score = 33.9 bits (76), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 35/63 (55%), Gaps = 2/63 (3%)

Query: 113 EAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP--TYSKGFSRLG 170
           ++IE + +AI V P++   +     AY    + E ++K  E+AIE+D   TY+K F  + 
Sbjct: 683 DSIEWFQSAIRVDPNDVESWIGLGQAYLGCGRIEASIKVFEKAIELDSSHTYAKYFKSIA 742

Query: 171 FAK 173
            ++
Sbjct: 743 LSE 745

>KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 566

 Score = 33.9 bits (76), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 17/92 (18%), Positives = 48/92 (52%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           G    A ++F + I+ +  A+EV+P++ + ++   A+ ++  + E+A++   +A+ + P+
Sbjct: 423 GTLFYANEEFGKTIDCFRTALEVNPNDELMWNRLGASLANSNRSEEAIQAYHKALALKPS 482

Query: 162 YSKGFSRLGFAKYALNKPEEALDAYKKVLDIE 193
           + +    L  +   +   +EA ++    L + 
Sbjct: 483 FVRARYNLAISSMNIGCYKEAAESLLSALSMH 514

>Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)
           [1254 nt, 418 aa]
          Length = 418

 Score = 33.5 bits (75), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 41/79 (51%)

Query: 112 DEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGF 171
           D A   Y A ++ + S+    ++ A  Y S   +++A +  E+A+ V+P  S  ++ LG 
Sbjct: 80  DRAALAYDATLQYNQSSTKALTSLANLYRSRDMFQRAAELYERALSVNPELSDVWATLGH 139

Query: 172 AKYALNKPEEALDAYKKVL 190
               L+  + A +AY++ L
Sbjct: 140 CYLMLDDLQRAYNAYQQAL 158

>Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244W
           (PEX5) - 1:1 [contig 27] FULL
          Length = 575

 Score = 33.5 bits (75), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 14/67 (20%), Positives = 39/67 (58%), Gaps = 2/67 (2%)

Query: 111 FDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLG 170
           +D+ ++ + AA+ V P + + ++   A+ ++  + E+A++   +A+++ PT+ +  +R  
Sbjct: 442 YDKTVDCFRAALAVRPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPTFVR--ARCN 499

Query: 171 FAKYALN 177
            A   +N
Sbjct: 500 LAVSCMN 506

 Score = 30.8 bits (68), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 8/64 (12%)

Query: 130 VYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNKPEEALDAYKKV 189
           ++YSN          Y++ V     A+ V P     ++RLG +    N+ EEA+ AY+K 
Sbjct: 435 LFYSN--------DDYDKTVDCFRAALAVRPDDELMWNRLGASLANSNRSEEAIQAYRKA 486

Query: 190 LDIE 193
           L ++
Sbjct: 487 LQLK 490

>Kwal_23.3670 s23 (387536..389944) [2409 bp, 802 aa] {ON} YBR112C
           (CYC8) - 1:1 [contig 253] FULL
          Length = 802

 Score = 33.5 bits (75), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 40/79 (50%)

Query: 112 DEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGF 171
           D A   Y A ++ +PS+    ++ A  Y S   +++A +  ++A+ V+P     ++ LG 
Sbjct: 83  DRAAMAYDATLQYNPSSTKALTSLAHLYRSRDMFQRAAELYQRALTVNPELGDIWATLGH 142

Query: 172 AKYALNKPEEALDAYKKVL 190
               L+  + A  AY++ L
Sbjct: 143 CYLMLDDLQRAYAAYQQAL 161

>TBLA0B08680 Chr2 (2070444..2073188) [2745 bp, 914 aa] {ON} Anc_3.32
           YNL313C
          Length = 914

 Score = 33.5 bits (75), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 22/97 (22%), Positives = 47/97 (48%), Gaps = 1/97 (1%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           G   +   K   A E ++  + +  +NA+ +SN +AAY +  + ++A     +A   D  
Sbjct: 653 GCIGLECGKMQLAAEAFSRCVSLDDTNAMAWSNLSAAYVNQGKLKEAFSCLNRATRTDSQ 712

Query: 162 YS-KGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKA 197
            + + +       + L + +E L + KK++DI  ++A
Sbjct: 713 KNWRIWENYMIVAFKLREWDEVLLSCKKLIDINKDRA 749

>TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.352
           YDR320C
          Length = 840

 Score = 33.5 bits (75), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 33/63 (52%), Gaps = 4/63 (6%)

Query: 111 FDEAIEKYTAAIEV----SPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGF 166
           +D A+ +Y  ++       P   + YSN  AA   + +Y Q+VKD + A+E+ P   K +
Sbjct: 562 YDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCDVALELFPKNDKQW 621

Query: 167 SRL 169
           ++ 
Sbjct: 622 TQF 624

>KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {ON}
           some similarities with uniprot|P38042 Saccharomyces
           cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 627

 Score = 33.1 bits (74), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 24/103 (23%), Positives = 44/103 (42%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           QG++  +   FD A+  Y  A+  +P +   +         L QYE+ +   E+A  ++P
Sbjct: 449 QGHEYSSNDAFDTAMTCYRKALGSNPQHYNAHYGLGMCCLKLGQYEECLLHFEKARSINP 508

Query: 161 TYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKATDVMKR 203
                    G A   L+  E+AL  Y    +++   +  + KR
Sbjct: 509 VNVILICCCGVALEKLSHQEKALQYYDLACELQPVSSLALFKR 551

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 41/91 (45%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           GN     K  +E+I+ +  + ++ PS    Y+ +   YSS   ++ A+    +A+  +P 
Sbjct: 416 GNLFSLKKDHEESIKAFQRSTQLDPSFTYAYTLQGHEYSSNDAFDTAMTCYRKALGSNPQ 475

Query: 162 YSKGFSRLGFAKYALNKPEEALDAYKKVLDI 192
           +      LG     L + EE L  ++K   I
Sbjct: 476 HYNAHYGLGMCCLKLGQYEECLLHFEKARSI 506

>TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.367
           YBR112C
          Length = 689

 Score = 33.1 bits (74), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 47/101 (46%), Gaps = 4/101 (3%)

Query: 107 AAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIE--VDPTYSK 164
           A   F +A + Y  A+ + PS +  ++     Y  L   ++A    +QA+    DP   K
Sbjct: 210 ARDMFHKASQLYERALAIDPSLSDIWATLGHCYLMLDDLQKAYNAYQQALNNLSDPNVPK 269

Query: 165 GFSRLGFAKYALNKPEEALDAYKKVLDIEG--EKATDVMKR 203
            +  +G         + A +A+KKVLD++   EKA ++  R
Sbjct: 270 LWHGIGILYDRYGSLDFAEEAFKKVLDLDPNFEKANEIYFR 310

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 33/56 (58%)

Query: 136 AAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNKPEEALDAYKKVLD 191
           A+ Y +   + +A +  E+A+ +DP+ S  ++ LG     L+  ++A +AY++ L+
Sbjct: 205 ASLYRARDMFHKASQLYERALAIDPSLSDIWATLGHCYLMLDDLQKAYNAYQQALN 260

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 16/82 (19%), Positives = 38/82 (46%)

Query: 111 FDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLG 170
            D A+     ++E+ P+++  +      + + K +  A +  +QA+  D      +  +G
Sbjct: 396 LDIAMGHLVKSLELDPTDSTTWYYLGRIHMAKKDFTAAYESLQQAVNRDSRNPIFWCSIG 455

Query: 171 FAKYALNKPEEALDAYKKVLDI 192
              Y + +  +ALDAY + + +
Sbjct: 456 VLYYQIGQNHDALDAYTRAIRL 477

>KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 568

 Score = 33.1 bits (74), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 14/67 (20%), Positives = 39/67 (58%), Gaps = 2/67 (2%)

Query: 111 FDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLG 170
           +D+ ++ + AA+ V P + + ++   A+ ++  + E+A++   +A+++ PT+ +  +R  
Sbjct: 435 YDKTVDCFRAALAVKPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPTFVR--ARCN 492

Query: 171 FAKYALN 177
            A   +N
Sbjct: 493 LAVSCMN 499

 Score = 30.4 bits (67), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 8/63 (12%)

Query: 130 VYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNKPEEALDAYKKV 189
           ++YSN          Y++ V     A+ V P     ++RLG +    N+ EEA+ AY+K 
Sbjct: 428 LFYSN--------DDYDKTVDCFRAALAVKPDDELMWNRLGASLANSNRSEEAIQAYRKA 479

Query: 190 LDI 192
           L +
Sbjct: 480 LQL 482

>TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.412
           YBL084C
          Length = 700

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 58/126 (46%), Gaps = 10/126 (7%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           G   M   ++D+A+  +  A  ++P N +       A   L   E+A++  EQA E+ P+
Sbjct: 557 GMCYMKLGQYDKALLFFEKARNINPVNVILICCCGVALEKLSYQEKALQYYEQACELQPS 616

Query: 162 YSKGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKAT---------DVMKRDYETAKKKV 212
            S    +     Y++ +   AL+ ++++  +  ++AT          +M R  + A K+ 
Sbjct: 617 SSLAKFKKAHLLYSMARYSAALENFEELAKLAPDEATVHFLLGQLYQIMGRK-KDAVKEF 675

Query: 213 ETSMNL 218
             +MNL
Sbjct: 676 TVAMNL 681

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 41/93 (44%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           QG++  +    D A   Y  A+   P +   Y      Y  L QY++A+   E+A  ++P
Sbjct: 522 QGHEHSSNDSIDTAKNCYRRALACDPQHYNAYYGLGMCYMKLGQYDKALLFFEKARNINP 581

Query: 161 TYSKGFSRLGFAKYALNKPEEALDAYKKVLDIE 193
                    G A   L+  E+AL  Y++  +++
Sbjct: 582 VNVILICCCGVALEKLSYQEKALQYYEQACELQ 614

>NDAI0A08170 Chr1 complement(1870449..1872068) [1620 bp, 539 aa]
           {ON} Anc_3.395 YPR088C
          Length = 539

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 38/76 (50%), Gaps = 22/76 (28%)

Query: 268 NPQVMQAAE-KMMQNPGLMQDMMSNPAMKQMANQFSSGGG------------MPDLSQMM 314
            PQ+MQ A+ K+ QNP LM++MM         N F   GG            M ++ +MM
Sbjct: 472 TPQLMQQAQQKLSQNPNLMKNMM---------NMFGGAGGMPGMGGAGGMPDMNEMMKMM 522

Query: 315 NDPSIRDMAKNMFGGG 330
            DP +++MAK    GG
Sbjct: 523 QDPGMQEMAKQFGMGG 538

>Ecym_2033 Chr2 complement(51082..53811) [2730 bp, 909 aa] {ON}
           similar to Ashbya gossypii ADL177C
          Length = 909

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/104 (20%), Positives = 55/104 (52%), Gaps = 5/104 (4%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP- 160
           G   + + K + A E ++  + +  ++A+ +SN +AAY+ L ++++A    ++A+  D  
Sbjct: 648 GCIGLESAKMELAAEAFSRCVSLDETHALSWSNLSAAYTELGKFKEAHSCLKRAVSSDAQ 707

Query: 161 TYSKGFSRLGFAKYALNKPEEALDAYKKVLDIE----GEKATDV 200
           +  + +         +++ ++ L A K+++ I+    GE + D+
Sbjct: 708 SNWRIWENYMLVSAKIDQWDDVLVACKRLVQIKRDKTGEGSIDI 751

>Ecym_5092 Chr5 complement(208478..210358) [1881 bp, 626 aa] {ON}
           similar to Ashbya gossypii ABR206W
          Length = 626

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/100 (18%), Positives = 47/100 (47%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           G++ +  K    AIE Y  A++++P +   +     AY  L ++  A+   ++A  + P 
Sbjct: 437 GHEFVETKNSHAAIECYRRAVDINPCDFKAWYGLGQAYEVLDRHLYALYYLQKACSLKPL 496

Query: 162 YSKGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKATDVM 201
             + +  L      L++P +A+  +++   +  ++   ++
Sbjct: 497 DKRMWQALANCYDKLDRPNQAIKCFQRASQLSNDQDITIL 536

>SAKL0D11110g Chr4 (920630..921928) [1299 bp, 432 aa] {ON} similar
           to uniprot|P47103 Saccharomyces cerevisiae YJR032W CPR7
           Peptidyl-prolyl cis-trans isomerase (cyclophilin)
           catalyzes the cis-trans isomerization of peptide bonds
           N-terminal to proline residues binds to Hsp82p and
           contributes to chaperone activity
          Length = 432

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 46/94 (48%), Gaps = 13/94 (13%)

Query: 132 YSNRAAAYSSLKQYEQAVKDAEQAIEVD--PTY--SKGFSRLGFAKYALNKPEEALDAYK 187
           Y N +    +LK+Y+ A+  A   +E++  PT   +K + R G    A N+ EEAL  YK
Sbjct: 334 YLNISLVLFNLKKYDSAITHATYLLEMEKVPTLDKAKAYYRRGNCYLAKNRLEEALKDYK 393

Query: 188 ---------KVLDIEGEKATDVMKRDYETAKKKV 212
                    KV+D + E   ++++   E  +K +
Sbjct: 394 NCKENNPDDKVIDQKIESVENLLEERKEKTRKNI 427

>KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly
           similar to uniprot|P14922 Saccharomyces cerevisiae
           YBR112C CYC8 General transcriptional co- repressor acts
           together with Tup1p also acts as part of a
           transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 795

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 40/79 (50%)

Query: 112 DEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGF 171
           D A   Y A ++ +PS+    ++ A  Y S   +++A +  ++A+ ++P     ++ LG 
Sbjct: 79  DRAAMAYDATLQYNPSSTKALTSLAHLYRSRDMFQRAAELYQRALSINPELGDIWATLGH 138

Query: 172 AKYALNKPEEALDAYKKVL 190
               L+  + A  AY++ L
Sbjct: 139 CYLMLDDLQRAYAAYQQAL 157

>ADL344W Chr4 (103565..106297) [2733 bp, 910 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR112C (CYC8)
          Length = 910

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 40/79 (50%)

Query: 112 DEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGF 171
           D A   Y A ++ +PS+    ++ A  Y S   +++A +  ++A+ V+P     ++ LG 
Sbjct: 79  DRAAMAYDATLQYNPSSTKALTSLAHLYRSRDVFQRAAELYQRALAVNPELGDVWATLGH 138

Query: 172 AKYALNKPEEALDAYKKVL 190
               L+  + A  AY++ L
Sbjct: 139 CYLMLDDLQRAYAAYQQAL 157

>Ecym_3459 Chr3 (864878..868225) [3348 bp, 1115 aa] {ON} similar to
           Ashbya gossypii ADL344W
          Length = 1115

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 40/79 (50%)

Query: 112 DEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGF 171
           D A   Y A ++ +PS+    ++ A  Y S   +++A +  ++A+ V+P     ++ LG 
Sbjct: 145 DRAAMAYDATLQYNPSSTKALTSLAHLYRSRDVFQRAAELYQRALAVNPELGDIWATLGH 204

Query: 172 AKYALNKPEEALDAYKKVL 190
               L+  + A  AY++ L
Sbjct: 205 CYLMLDNLQRAYAAYQQAL 223

>ABR206W Chr2 (787387..789231) [1845 bp, 614 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR166C (CDC23)
          Length = 614

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/87 (20%), Positives = 42/87 (48%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           G++ +  K    AIE Y  A++++P +   +     AY  L ++  A+   ++A  + P 
Sbjct: 425 GHEFVEMKNSHAAIECYRRAVDINPCDFKAWYGLGQAYEVLDRHLYALYYLQKACSLKPL 484

Query: 162 YSKGFSRLGFAKYALNKPEEALDAYKK 188
             + +  L      L++P +A+  +++
Sbjct: 485 DKRMWQALANCYDKLDRPNQAIKCFQR 511

>ZYRO0A02926g Chr1 complement(238036..239769) [1734 bp, 577 aa] {ON}
           similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244W PEX5 Essential for import of proteins with SKL-
           like import signal into peroxisomal matrix 69-kDa
           protein containing tetratricopeptide repeat (TPR)
          Length = 577

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 14/68 (20%), Positives = 42/68 (61%), Gaps = 2/68 (2%)

Query: 110 KFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRL 169
           +FD+ I+ + AA+ V+ ++ + ++   A+ ++  + E+A++   +A+++ P++ +  +R 
Sbjct: 441 QFDKTIDCFKAALSVNSNDELMWNRLGASLANSSRSEEAIQAYHRALQLKPSFVR--ARY 498

Query: 170 GFAKYALN 177
             A  ++N
Sbjct: 499 NLAVSSIN 506

>SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]
           {ON} similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244W PEX5 Essential for import of proteins with SKL-
           like import signal into peroxisomal matrix 69-kDa
           protein containing tetratricopeptide repeat (TPR)
          Length = 573

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 15/71 (21%), Positives = 42/71 (59%), Gaps = 2/71 (2%)

Query: 107 AAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGF 166
           A + +D+ I+ + AA+ V P + + ++   A+ ++  + E+A++   +A+++ P++ +  
Sbjct: 434 ANEDYDKTIDCFKAALTVKPDDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVR-- 491

Query: 167 SRLGFAKYALN 177
           +R   A  ++N
Sbjct: 492 ARYNLAVSSMN 502

>TPHA0B01410 Chr2 (318162..319058) [897 bp, 298 aa] {ON} Anc_7.458
           YJR088C
          Length = 298

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 29/133 (21%), Positives = 65/133 (48%), Gaps = 21/133 (15%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSN---------AVYYSNRAAAYSSLKQ-------- 144
           G   ++A KFDE+I  +   + + P N          +++  ++   +S K+        
Sbjct: 167 GETYLSAGKFDESIFAFEEVVLIQPFNYMAFYKISEVIFFKYKSLTMNSNKKGNAKDKNE 226

Query: 145 -YEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNKPEEALD-AYKKVLDIEGEKATDVMK 202
              +++++A ++IE++  + +G+S +    + L    E L+ A+KK+ +I   K +   +
Sbjct: 227 ILNKSLQNALRSIELNEFFLRGWSIVALVSHQLGTKVEILNLAHKKLNEIAELKNSS--E 284

Query: 203 RDYETAKKKVETS 215
           +D  TAK  +E +
Sbjct: 285 KDKTTAKVIIEKT 297

>KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7.412
           YBL084C
          Length = 712

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 32/69 (46%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           GN     K  DEAI+ +  A E+ P  A  Y+ +   Y+S + ++ A     +A+  D  
Sbjct: 501 GNHFSLQKDHDEAIKAFNKATELDPRFAYAYTLQGHEYASNESFDTARTFYRKALACDSQ 560

Query: 162 YSKGFSRLG 170
           +   +  LG
Sbjct: 561 HYNAYYGLG 569

>ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]
           {ON} highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 974

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 41/79 (51%)

Query: 112 DEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGF 171
           D A   Y A ++ + ++    ++ A  Y S   +++A +  E+A+ V+P  S  ++ LG 
Sbjct: 71  DRAAMAYDATLQYNQASTKALTSLAHLYRSRDMFQRAAELYERALAVNPELSDVWATLGH 130

Query: 172 AKYALNKPEEALDAYKKVL 190
               L+  + A +AY++ L
Sbjct: 131 CYLMLDDLQRAYNAYQQAL 149

 Score = 31.2 bits (69), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 18/80 (22%), Positives = 38/80 (47%)

Query: 113 EAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFA 172
           +A+   + ++EV PS+A  + +    +     Y  A    +QA+  D      +  +G  
Sbjct: 288 KALSFLSKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVL 347

Query: 173 KYALNKPEEALDAYKKVLDI 192
            Y +++  +ALDAY + + +
Sbjct: 348 YYQISQYRDALDAYTRAIRL 367

>TBLA0C01010 Chr3 (198773..201367) [2595 bp, 864 aa] {ON} Anc_2.665
           YKL022C
          Length = 864

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/64 (23%), Positives = 34/64 (53%), Gaps = 3/64 (4%)

Query: 101 QGNKAMAAKK---FDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIE 157
           Q N A   +K   F+++++   + +E+S  N+    N    Y  L+Q++ A+ +   A+ 
Sbjct: 697 QINLAHTFRKLNEFEKSVQLIKSVLEISGKNSNLLCNLGFLYLKLRQFQYAIDNLHTALS 756

Query: 158 VDPT 161
           ++P+
Sbjct: 757 INPS 760

>CAGL0M08030g Chr13 complement(800149..801312) [1164 bp, 387 aa]
           {ON} similar to uniprot|P47103 Saccharomyces cerevisiae
           YJR032w Peptidyl-prolyl cis-trans isomerase CYP7
          Length = 387

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 47/94 (50%), Gaps = 13/94 (13%)

Query: 132 YSNRAAAYSSLKQYEQAVKDAEQAIEVDPT----YSKGFSRLGFAKYALNKPEEALDAYK 187
           Y N   A  +LK Y++++K     +E+D       +K + R+G + +A  + +EAL  Y+
Sbjct: 289 YLNICLALFNLKDYDESMKYGHYLLELDSVDDKDKAKAYYRIGNSLFAKKRYDEALKNYR 348

Query: 188 ---------KVLDIEGEKATDVMKRDYETAKKKV 212
                     V+  + EK  ++++++ E  KK +
Sbjct: 349 LCRDHNPDDNVIGQKIEKTENILEKEKERTKKNI 382

>CAGL0J09570g Chr10 complement(941571..943220) [1650 bp, 549 aa]
           {ON} some similarities with uniprot|P35056 Saccharomyces
           cerevisiae YDR244w PAS10 peroxisomal targeting signal
           receptor
          Length = 549

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 14/61 (22%), Positives = 33/61 (54%)

Query: 110 KFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRL 169
           + D AI+ +   +E  P + + +++  A  ++ K+Y+ A++     IE+ P++ +    L
Sbjct: 406 RSDNAIKCFEKLLEQDPKDEITWNHLGATLANSKRYDTAIQVYMNTIELKPSFVRARYNL 465

Query: 170 G 170
           G
Sbjct: 466 G 466

>TPHA0G00430 Chr7 complement(77860..80046) [2187 bp, 728 aa] {ON}
           Anc_5.689 YOR080W
          Length = 728

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 29/56 (51%)

Query: 132 YSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNKPEEALDAYK 187
           Y N +A Y  L+  ++A   +++ I VDP   KG+  +G      NK + A  AYK
Sbjct: 75  YGNLSATYDKLQNLDKASDCSQRMINVDPYNLKGYIMMGKILQKQNKDKLAYKAYK 130

>TBLA0A04170 Chr1 (1030218..1033082) [2865 bp, 954 aa] {ON}
           Anc_8.359 YLR148W
          Length = 954

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 54/126 (42%), Gaps = 17/126 (13%)

Query: 103 NKAMAAKKFD----EAIEKYTAAIEVSPSN----AVYYSNRAAAYSSLKQYEQAVKDAEQ 154
           N  M  KKF     E+ +KYT    +S       ++Y+ N    Y  +  Y    K+  +
Sbjct: 502 NIRMNLKKFLKTHLESFDKYTILQILSKQQGHEFSIYFENLLGHYDHVLSYWIDQKNWNE 561

Query: 155 AIEV-----DPTYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKATDVMKRDYETAK 209
           A+++     DP     F+ +      LN PEE + A+ K+  ++  K    +   +   +
Sbjct: 562 ALKLLVETQDPNSCIKFASI----LLLNCPEETIIAWMKIPQLQPTKLIPALLNYFTHYQ 617

Query: 210 KKVETS 215
           KK+ T+
Sbjct: 618 KKISTN 623

>TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {ON}
           Anc_3.367 YBR112C
          Length = 759

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 42/79 (53%)

Query: 112 DEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGF 171
           D A   Y A ++ + ++    ++ A  Y S   +++A +  E+A+ V+P  S  ++ LG 
Sbjct: 43  DRAAMAYDATLQYNQASTKALTSLAHLYRSRDMFQKAAELYEKALAVNPELSDVWATLGH 102

Query: 172 AKYALNKPEEALDAYKKVL 190
               L+  ++A +AY++ L
Sbjct: 103 CYLMLDDLQKAYNAYQQAL 121

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 17/72 (23%), Positives = 35/72 (48%)

Query: 121 AIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNKPE 180
           ++EV+PS+A  + +    +     Y  A    +QA+  D      +  +G   Y +++  
Sbjct: 268 SLEVNPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYR 327

Query: 181 EALDAYKKVLDI 192
           +ALDAY + + +
Sbjct: 328 DALDAYTRAIRL 339

>SAKL0H02244g Chr8 (216327..218213) [1887 bp, 628 aa] {ON} similar
           to uniprot|P16522 Saccharomyces cerevisiae YHR166C CDC23
           Subunit of the anaphase-promoting complex/cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 628

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 22/104 (21%), Positives = 48/104 (46%), Gaps = 2/104 (1%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           G++ +  K    AIE Y  A++++P +   +     AY  L  +  ++   ++A  + P 
Sbjct: 439 GHEFVELKNSHAAIESYRRAVDINPRDFKAWYGLGQAYEVLDMHLYSLYYFQKACALKPL 498

Query: 162 YSKGFSRLGFAKYALNKPEEALDAYKKV--LDIEGEKATDVMKR 203
             + +  L      L+K +E++  Y++   L I  +  T ++ R
Sbjct: 499 DKRMWQALASCYEKLSKKDESIKCYERALQLSISSDHDTAILYR 542

>TDEL0B07600 Chr2 (1331773..1334031) [2259 bp, 752 aa] {ON}
           Anc_2.665 YKL022C
          Length = 752

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 7/95 (7%)

Query: 103 NKAMAAKKF-DEAIEKYTAAIEVSPSNAVYYS---NRAAAYSSLKQYEQAVKDAEQAIEV 158
           N    AKKF   A+E   A  E+ P++    S   N A AY  L + E+A+K  +  ++V
Sbjct: 580 NDLQKAKKFLKRALE---AVEELDPTSKTSVSIQMNLAHAYRRLGENERAIKCFKSVLKV 636

Query: 159 DPTYSKGFSRLGFAKYALNKPEEALDAYKKVLDIE 193
               S  +  LGF      + ++A+D +   L + 
Sbjct: 637 SNKSSDTYCSLGFLYLKTKQLQKAIDHFHTALALR 671

>Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {ON}
           YBL084C (CDC27) - component of the anaphase-promoting
           complex [contig 33] FULL
          Length = 628

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 21/91 (23%), Positives = 41/91 (45%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           GN     K  +E+I+ +  + ++ PS    Y+ +   YSS   ++ A+    +A+  +  
Sbjct: 417 GNLFSLKKDHEESIKAFQRSTQLDPSFTYAYTLQGHEYSSNDAFDTAMTCYRKALASNSQ 476

Query: 162 YSKGFSRLGFAKYALNKPEEALDAYKKVLDI 192
           +   +  LG     L + EE L  ++K   I
Sbjct: 477 HYNAYYGLGMCSLKLGQYEECLLHFEKARSI 507

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 24/103 (23%), Positives = 42/103 (40%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160
           QG++  +   FD A+  Y  A+  +  +   Y         L QYE+ +   E+A  ++P
Sbjct: 450 QGHEYSSNDAFDTAMTCYRKALASNSQHYNAYYGLGMCSLKLGQYEECLLHFEKARSINP 509

Query: 161 TYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKATDVMKR 203
                    G A   L+  E AL  Y    +++   +  + KR
Sbjct: 510 VNVILICCCGVALEKLSHQERALQNYDLACELQPMSSLALFKR 552

>KLTH0C00572g Chr3 complement(57378..59540) [2163 bp, 720 aa] {ON}
           similar to uniprot|P09798 Saccharomyces cerevisiae
           YKL022C CDC16 Subunit of the anaphase-promoting
           complex/cyclosome (APC/C) which is a ubiquitin-protein
           ligase required for degradation of anaphase inhibitors
           including mitotic cyclins during the metaphase/anaphase
           transition required for sporulation
          Length = 720

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 47/104 (45%), Gaps = 3/104 (2%)

Query: 103 NKAMAAKKF-DEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           N  + AK++  +A E   A    S S    ++N A  Y  L   E+AVK     +E    
Sbjct: 553 NDYLKAKRYLKKAWEAIKALDSESKSWISIHTNLAHTYRKLGDNERAVKCFRLVLETTGK 612

Query: 162 YSKGFSRLGFAKYALNKPEEALDAYKKVLDIE--GEKATDVMKR 203
            +     LG+    +N+ E+A+D+    L +    + A D++K+
Sbjct: 613 DADTLCALGYVYLRMNRIEKAIDSLHSSLALRPSNQAAQDLLKQ 656

>TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8.470
           YDR244W
          Length = 588

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 13/68 (19%), Positives = 40/68 (58%), Gaps = 2/68 (2%)

Query: 110 KFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRL 169
           +FD+ I+ +  A+ + P + + ++   A+ ++  + E+A++   +A+++ P++ +  +R 
Sbjct: 446 EFDKTIDCFKTALVIHPEDELMWNRLGASLANSSRPEEAIQAYHKALQLKPSFVR--ARY 503

Query: 170 GFAKYALN 177
             A  ++N
Sbjct: 504 NLAVSSIN 511

 Score = 30.0 bits (66), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 16/64 (25%), Positives = 34/64 (53%), Gaps = 8/64 (12%)

Query: 130 VYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNKPEEALDAYKKV 189
           ++YSN         ++++ +   + A+ + P     ++RLG +    ++PEEA+ AY K 
Sbjct: 440 LFYSN--------NEFDKTIDCFKTALVIHPEDELMWNRLGASLANSSRPEEAIQAYHKA 491

Query: 190 LDIE 193
           L ++
Sbjct: 492 LQLK 495

>KNAG0E00680 Chr5 complement(122876..124795) [1920 bp, 639 aa] {ON}
           Anc_5.72 YHR166C
          Length = 639

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 20/100 (20%), Positives = 44/100 (44%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           G++ +  K    AIE Y  A++++  +   +     AY  L  +  ++   ++A  + P 
Sbjct: 449 GHEFVELKNSHAAIECYRRAVDINERDYKAWFGLGQAYEVLDMHLYSLYYFQKACTLKPL 508

Query: 162 YSKGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKATDVM 201
             + +  L      L   E+A++ Y++ L +      DV+
Sbjct: 509 DRRMWQALAECYGLLKNSEQAIECYRRALQLSSNAGQDVL 548

>KLLA0E07239g Chr5 complement(655635..658325) [2691 bp, 896 aa] {ON}
           similar to uniprot|P42842 Saccharomyces cerevisiae
           YNL313C Protein required for cell viability
          Length = 896

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 20/96 (20%), Positives = 48/96 (50%), Gaps = 1/96 (1%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           G   +   K + A E ++  + +  ++++ +SN +AAY  L + ++A    ++AI  D  
Sbjct: 635 GCIGLECGKMNLAAEAFSRCVALDETHSLSWSNLSAAYVQLDKLKEAHSCLKRAISSDAR 694

Query: 162 YS-KGFSRLGFAKYALNKPEEALDAYKKVLDIEGEK 196
            + + +         L + E+ L A++ ++D+  +K
Sbjct: 695 KNWRIWDNYMIVSMKLGEWEDVLLAFRNLVDLRKDK 730

>ZYRO0D00572g Chr4 complement(42511..44830,45510..45547) [2358 bp,
           785 aa] {ON} similar to uniprot|P09798 Saccharomyces
           cerevisiae YKL022C CDC16 Subunit of the
           anaphase-promoting complex/cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition required for sporulation
          Length = 785

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 52/115 (45%), Gaps = 9/115 (7%)

Query: 107 AAKKFDEAIEKYTAAIEVSPSNAVYYS---NRAAAYSSLKQYEQAVKDAEQAIEVDPTYS 163
           A +    A+E   A  E++P++    S   N A AY  L + E+A+K  +  +EV    S
Sbjct: 618 AKRYLKRALE---AVKELNPTSRTSVSIQMNLAHAYRRLGENERAIKCFKTVLEVSSKDS 674

Query: 164 KGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNL 218
             +  LGF      + + A+D     L +   K +++  ++      ++  SMNL
Sbjct: 675 DTYCSLGFLYLKTKELQRAIDHLHTALSL---KPSNLAAQELLLHALELNVSMNL 726

>TBLA0A01690 Chr1 complement(404419..406407) [1989 bp, 662 aa] {ON}
           Anc_8.470 YDR244W
          Length = 662

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 18/97 (18%), Positives = 48/97 (49%), Gaps = 2/97 (2%)

Query: 111 FDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLG 170
           +D+ I+ +  A+ V+P++ + ++   A+ ++  + E+AV    +A+ + P++ +    L 
Sbjct: 509 YDKTIDCFKTALTVNPNDELMWNRLGASLANSNRSEEAVAAYHRALTLKPSFVRARYNLA 568

Query: 171 FAKYALNKPEEALDAYKKVLDIEGEKATDVMKRDYET 207
            +   +   +EA +     L +   +   ++  D ET
Sbjct: 569 VSSINIGCFKEAAEHLLTALSM--HEINGILDTDLET 603

>SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 632

 Score = 31.2 bits (69), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 39/91 (42%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           GN     K  DEAI+ +  A ++ P     Y+ +   YSS   ++ A     +A+  +  
Sbjct: 421 GNMFSLNKDHDEAIKSFQKATQLDPRFTYAYTLQGHEYSSNDAFDTAKTCYRKALATNSQ 480

Query: 162 YSKGFSRLGFAKYALNKPEEALDAYKKVLDI 192
           +      LG     L + EE+L  ++K   I
Sbjct: 481 HYNASYGLGMCCLKLGQYEESLLHFQKAHSI 511

>CAGL0L09823g Chr12 (1052444..1054675) [2232 bp, 743 aa] {ON} some
           similarities with uniprot|P09798 Saccharomyces
           cerevisiae YKL022c CDC16
          Length = 743

 Score = 31.2 bits (69), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%)

Query: 134 NRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNKPEEALDAYKKVLDI 192
           N +  Y  L + E+A+K     +E     S+ +  LGF     N+ ++A+DA  +VL I
Sbjct: 603 NLSHTYRRLGENEKAIKYLTNILEDTENSSEIYCSLGFLYLKTNQLQKAIDALHRVLAI 661

>SAKL0C13068g Chr3 (1159968..1162676) [2709 bp, 902 aa] {ON} similar
           to uniprot|P42842 Saccharomyces cerevisiae YNL313C
           Protein required for cell viability
          Length = 902

 Score = 31.2 bits (69), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 20/97 (20%), Positives = 49/97 (50%), Gaps = 1/97 (1%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           G   +   K + A E ++  + +  ++++ +SN +AAY  L + +++    ++AI  D  
Sbjct: 641 GCIGLECNKMELAAEAFSRCVSLDETHSLSWSNLSAAYIQLDKVKESFSCLKKAISSDAQ 700

Query: 162 YS-KGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKA 197
            + + +         LN+ ++ L A K +++I  +K+
Sbjct: 701 NNWRIWENYMLVAVKLNEWDDVLLACKHLVNIRRDKS 737

>CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} similar
           to uniprot|P14922 Saccharomyces cerevisiae YBR112c CYC8
           general repressor of transcription
          Length = 1148

 Score = 31.2 bits (69), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 41/79 (51%)

Query: 112 DEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGF 171
           D A   Y A ++ + S+    ++ A  Y S   +++A +  E A++V+P  S  ++ LG 
Sbjct: 65  DRAAMAYDATLQHNASSTKGLTSLAHLYRSRDMFQKAAELYECALQVNPELSDVWATLGH 124

Query: 172 AKYALNKPEEALDAYKKVL 190
               L+  + A +AY++ L
Sbjct: 125 CYLMLDDLQRAYNAYQQAL 143

>CAGL0I02288g Chr9 complement(203605..205524) [1920 bp, 639 aa] {ON}
           similar to uniprot|P16522 Saccharomyces cerevisiae
           YHR166c CDC23
          Length = 639

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 20/99 (20%), Positives = 43/99 (43%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           G++ +  K  + AIE Y  A+++ P +   +     AY  L  +  ++   ++A  + P 
Sbjct: 451 GHEFVELKNSNAAIESYRRAVDIDPRDFRAWYGLGQAYEVLDMHLYSLYYFQRACILKPL 510

Query: 162 YSKGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKATDV 200
             + +  LG     +    EA+  Y++ L +  +   D 
Sbjct: 511 DKRMWQALGSCYAKVGNHAEAIKCYERALQLTTQSEQDT 549

>YKL022C Chr11 complement(394726..397248) [2523 bp, 840 aa] {ON}
           CDC16Subunit of the anaphase-promoting complex/cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition; required for sporulation
          Length = 840

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 38/66 (57%), Gaps = 4/66 (6%)

Query: 123 EVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAK-YALN-KPE 180
           E  P +A+ + + A  Y SL +  +A K   ++  +DP+++  +  LGFA  YAL  + +
Sbjct: 525 ETFPKSAITWFSVATYYMSLDRISEAQKYYSKSSILDPSFAAAW--LGFAHTYALEGEQD 582

Query: 181 EALDAY 186
           +AL AY
Sbjct: 583 QALTAY 588

>KLLA0C02453g Chr3 complement(216740..219826) [3087 bp, 1028 aa]
           {ON} similar to uniprot|P33339 Saccharomyces cerevisiae
           YGR047C
          Length = 1028

 Score = 30.8 bits (68), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 32/78 (41%)

Query: 113 EAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFA 172
           +AI  YT AI ++        NRA  Y  + Q  +A    ++    DP  +     L   
Sbjct: 197 QAIYCYTRAIRINNEEWECIYNRALLYKEIGQLGRAFDGFQKLYAYDPLDANILRELAVI 256

Query: 173 KYALNKPEEALDAYKKVL 190
               N+  EA++ Y KV 
Sbjct: 257 YVEYNRVSEAIELYMKVF 274

>NDAI0C03350 Chr3 complement(769764..771713) [1950 bp, 649 aa] {ON}
           Anc_5.72
          Length = 649

 Score = 30.4 bits (67), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 19/93 (20%), Positives = 42/93 (45%)

Query: 102 GNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161
           G++ +  K    AIE Y  A++++P +   +     AY  L+ +  ++   ++A  + P 
Sbjct: 461 GHEFVELKNSHAAIECYRRAVDINPKDFKAWYGLGQAYEVLEMHLYSLFYFQKACSLQPL 520

Query: 162 YSKGFSRLGFAKYALNKPEEALDAYKKVLDIEG 194
             + +  LG     +    +AL  +++ L   G
Sbjct: 521 DRRMWQALGTCYIKIGYKSDALKCFERALQHSG 553

>NCAS0G00350 Chr7 complement(60735..62831) [2097 bp, 698 aa] {ON}
           Anc_5.689 YOR080W
          Length = 698

 Score = 30.4 bits (67), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 32/57 (56%)

Query: 134 NRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNKPEEALDAYKKVL 190
           NRAA +  L + E+A++D+++   ++P   K + R G     L K ++A   YK+ L
Sbjct: 78  NRAACWEKLGELERALRDSQKMCYIEPYNLKCYLRRGRLLQRLGKDKDAYKNYKEAL 134

>TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6.328
           YCR060W
          Length = 124

 Score = 28.9 bits (63), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 25/53 (47%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAE 153
           QGN     + +  A+  Y   +E   +N + +SNRA     L + ++A K  +
Sbjct: 10  QGNSCYQQQDYAGALRWYDQCLEADATNPIAHSNRAMCLIKLNRSQEAQKACQ 62

>NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 28.9 bits (63), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 13/56 (23%), Positives = 27/56 (48%)

Query: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAI 156
           +GN+      +  A + Y   I   P+N + YSN+A +    + ++QA++     +
Sbjct: 9   EGNRLFKLGDYTAANKFYDLCIMEEPTNPIGYSNKAMSLIKQEHFDQAIRTCNTGL 64

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.126    0.341 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 27,294,292
Number of extensions: 1009638
Number of successful extensions: 3788
Number of sequences better than 10.0: 286
Number of HSP's gapped: 3490
Number of HSP's successfully gapped: 454
Length of query: 335
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 225
Effective length of database: 40,868,139
Effective search space: 9195331275
Effective search space used: 9195331275
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 66 (30.0 bits)