Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D01133g6.20ON1067106756810.0
Sklu_YGOB_Anc_6.20b6.20ON1088110218650.0
Ecym_30246.20ON1079108515940.0
TDEL0G044906.20ON1093110115620.0
Sklu_YGOB_Anc_6.20singletonOFF84986215370.0
KLTH0C11242g6.20ON1097109515440.0
ACR006C6.20ON1071108415320.0
ZYRO0C07810g6.20ON1099111115170.0
Kwal_56.224246.20ON1089109614231e-178
Suva_13.1606.20ON1090110913681e-170
Skud_13.1526.20ON1090110513591e-169
Smik_13.1576.20ON1090109713411e-166
Kpol_1037.256.20ON1105109612461e-152
TPHA0J003306.20ON1107113612171e-148
KNAG0M011606.20ON1131112610771e-128
CAGL0L07634g6.20ON1130112910381e-122
YML002W6.20ON7377209511e-114
NCAS0H008206.20ON11467918851e-101
NDAI0D008006.20ON119311968791e-100
TBLA0A072606.20ON12047647627e-84
KAFR0L004006.20ON9427915061e-51
YML003WsingletonOFF2902993754e-39
KLLA0D10263g8.876ON43771810.63
YML097C (VPS9)8.876ON45173791.1
NDAI0K005408.819ON94550771.9
TPHA0I014302.143ON98441772.2
Ecym_40205.700ON112552744.7
CAGL0M06127g8.588ON230115708.0
KNAG0G022508.295ON4928192729.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D01133g
         (1067 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D01133g Chr4 (101580..104783) [3204 bp, 1067 aa] {ON} some ...  2192   0.0  
Sklu_YGOB_Anc_6.20b Chr5 (89924..92470,92474..93193) [3267 bp, 1...   723   0.0  
Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to...   618   0.0  
TDEL0G04490 Chr7 complement(814781..818062) [3282 bp, 1093 aa] {...   606   0.0  
Sklu_YGOB_Anc_6.20 Chr5 (89924..92473) [2550 bp, 849 aa] {OFF} A...   596   0.0  
KLTH0C11242g Chr3 complement(921970..925263) [3294 bp, 1097 aa] ...   599   0.0  
ACR006C Chr3 complement(364436..367651) [3216 bp, 1071 aa] {ON} ...   594   0.0  
ZYRO0C07810g Chr3 complement(591035..594334) [3300 bp, 1099 aa] ...   588   0.0  
Kwal_56.22424 s56 (121475..124744) [3270 bp, 1089 aa] {ON} YML00...   552   e-178
Suva_13.160 Chr13 (253437..256709) [3273 bp, 1090 aa] {ON} YML00...   531   e-170
Skud_13.152 Chr13 (249372..252644) [3273 bp, 1090 aa] {ON} YML00...   528   e-169
Smik_13.157 Chr13 (254644..257916) [3273 bp, 1090 aa] {ON} YML00...   521   e-166
Kpol_1037.25 s1037 (56141..59458) [3318 bp, 1105 aa] {ON} (56141...   484   e-152
TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.2...   473   e-148
KNAG0M01160 Chr13 (207940..211335) [3396 bp, 1131 aa] {ON} Anc_6...   419   e-128
CAGL0L07634g Chr12 complement(840409..843801) [3393 bp, 1130 aa]...   404   e-122
YML002W Chr13 (264541..266754) [2214 bp, 737 aa] {ON} Putative p...   370   e-114
NCAS0H00820 Chr8 (148184..151624) [3441 bp, 1146 aa] {ON} Anc_6....   345   e-101
NDAI0D00800 Chr4 (177862..181443) [3582 bp, 1193 aa] {ON} Anc_6....   343   e-100
TBLA0A07260 Chr1 (1807831..1811445) [3615 bp, 1204 aa] {ON} Anc_...   298   7e-84
KAFR0L00400 Chr12 (72520..75348) [2829 bp, 942 aa] {ON} Anc_6.20...   199   1e-51
YML003W Chr13 (263483..264355) [873 bp, 290 aa] {OFF} Putative p...   149   4e-39
KLLA0D10263g Chr4 complement(868131..869444) [1314 bp, 437 aa] {...    36   0.63 
YML097C Chr13 complement(78335..79690) [1356 bp, 451 aa] {ON}  V...    35   1.1  
NDAI0K00540 Chr11 complement(118248..121085) [2838 bp, 945 aa] {...    34   1.9  
TPHA0I01430 Chr9 (319975..322929) [2955 bp, 984 aa] {ON} Anc_2.1...    34   2.2  
Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON} ...    33   4.7  
CAGL0M06127g Chr13 (640057..640749) [693 bp, 230 aa] {ON} simila...    32   8.0  
KNAG0G02250 Chr7 complement(507525..522311) [14787 bp, 4928 aa] ...    32   9.3  

>KLLA0D01133g Chr4 (101580..104783) [3204 bp, 1067 aa] {ON} some
            similarities with uniprot|Q04257 Saccharomyces cerevisiae
            YML002W and some similarities with uniprot|Q04257
            Saccharomyces cerevisiae YML003W Hypothetical ORF
          Length = 1067

 Score = 2192 bits (5681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1067/1067 (100%), Positives = 1067/1067 (100%)

Query: 1    MPYHLPVLLNPLLNAIFNCPSPKTSSLKQMFSRLDDERFFILVPSTETLLQFQDLESGLE 60
            MPYHLPVLLNPLLNAIFNCPSPKTSSLKQMFSRLDDERFFILVPSTETLLQFQDLESGLE
Sbjct: 1    MPYHLPVLLNPLLNAIFNCPSPKTSSLKQMFSRLDDERFFILVPSTETLLQFQDLESGLE 60

Query: 61   LAELCYHYDFVASHIVVIKDPTKDVPDQRSIYNTDFTTLNGRKLSIRYRNSTIVTGDGFT 120
            LAELCYHYDFVASHIVVIKDPTKDVPDQRSIYNTDFTTLNGRKLSIRYRNSTIVTGDGFT
Sbjct: 61   LAELCYHYDFVASHIVVIKDPTKDVPDQRSIYNTDFTTLNGRKLSIRYRNSTIVTGDGFT 120

Query: 121  ERRKITIKEINLLPTFNDYLKGSNYTPILHISMPLCGDLVPLDELQVFSKVAGNKYSKQE 180
            ERRKITIKEINLLPTFNDYLKGSNYTPILHISMPLCGDLVPLDELQVFSKVAGNKYSKQE
Sbjct: 121  ERRKITIKEINLLPTFNDYLKGSNYTPILHISMPLCGDLVPLDELQVFSKVAGNKYSKQE 180

Query: 181  QAPLPFDEEQKKVLYFEQRIQSISDVAERVALTFHLTKARIKKAISVIGIRTEWLNTRDS 240
            QAPLPFDEEQKKVLYFEQRIQSISDVAERVALTFHLTKARIKKAISVIGIRTEWLNTRDS
Sbjct: 181  QAPLPFDEEQKKVLYFEQRIQSISDVAERVALTFHLTKARIKKAISVIGIRTEWLNTRDS 240

Query: 241  IRQIISLDKRLNHLEDLDAMIYDYVELKLFTDIQQQLSEIVEDQELEHRFDFKALRSISL 300
            IRQIISLDKRLNHLEDLDAMIYDYVELKLFTDIQQQLSEIVEDQELEHRFDFKALRSISL
Sbjct: 241  IRQIISLDKRLNHLEDLDAMIYDYVELKLFTDIQQQLSEIVEDQELEHRFDFKALRSISL 300

Query: 301  NQVPTNFYPKDEKSFSLASVVELEKSVNDALEYLKSIDLKTTHSGKLEVLSTTMRLLSRE 360
            NQVPTNFYPKDEKSFSLASVVELEKSVNDALEYLKSIDLKTTHSGKLEVLSTTMRLLSRE
Sbjct: 301  NQVPTNFYPKDEKSFSLASVVELEKSVNDALEYLKSIDLKTTHSGKLEVLSTTMRLLSRE 360

Query: 361  INGISTDADTLLSLFVLLICRSQVTGLVRTLTYLTNFEISETSIKFGLQGYVLSTFEAAL 420
            INGISTDADTLLSLFVLLICRSQVTGLVRTLTYLTNFEISETSIKFGLQGYVLSTFEAAL
Sbjct: 361  INGISTDADTLLSLFVLLICRSQVTGLVRTLTYLTNFEISETSIKFGLQGYVLSTFEAAL 420

Query: 421  SFFHQDTVDSLTKKCASNKKIWASIQKHSKVEAELLSSNLRIRTDSGESLLSICIQSHNN 480
            SFFHQDTVDSLTKKCASNKKIWASIQKHSKVEAELLSSNLRIRTDSGESLLSICIQSHNN
Sbjct: 421  SFFHQDTVDSLTKKCASNKKIWASIQKHSKVEAELLSSNLRIRTDSGESLLSICIQSHNN 480

Query: 481  EVLTTLLANFESEFPLEDILDDRDFALSTLLIQALQVQNSQAAAILSEIILKSCTESEVR 540
            EVLTTLLANFESEFPLEDILDDRDFALSTLLIQALQVQNSQAAAILSEIILKSCTESEVR
Sbjct: 481  EVLTTLLANFESEFPLEDILDDRDFALSTLLIQALQVQNSQAAAILSEIILKSCTESEVR 540

Query: 541  SYLNSPNLHNRITAHYIMQDISLLESVGRYFNWEHKDINGHTPLFAVFRSYDAVNYDEIV 600
            SYLNSPNLHNRITAHYIMQDISLLESVGRYFNWEHKDINGHTPLFAVFRSYDAVNYDEIV
Sbjct: 541  SYLNSPNLHNRITAHYIMQDISLLESVGRYFNWEHKDINGHTPLFAVFRSYDAVNYDEIV 600

Query: 601  TKVLDQVVKWYANNNKPFNFKIHEDPKGNTLLHVMKSGIESLLKLPDVNVNKPDSKGLTP 660
            TKVLDQVVKWYANNNKPFNFKIHEDPKGNTLLHVMKSGIESLLKLPDVNVNKPDSKGLTP
Sbjct: 601  TKVLDQVVKWYANNNKPFNFKIHEDPKGNTLLHVMKSGIESLLKLPDVNVNKPDSKGLTP 660

Query: 661  LMIYSRYNRITNIETIMKDERLLCDLVQQPLVMTSLDFTKNPKVTKTILDATFNREPVVI 720
            LMIYSRYNRITNIETIMKDERLLCDLVQQPLVMTSLDFTKNPKVTKTILDATFNREPVVI
Sbjct: 661  LMIYSRYNRITNIETIMKDERLLCDLVQQPLVMTSLDFTKNPKVTKTILDATFNREPVVI 720

Query: 721  HSLRFEERKWKIGIFSEGIFKKYSLDLIQYYLRYLKIMYPCSFHPVQLLTNELRLLGIYG 780
            HSLRFEERKWKIGIFSEGIFKKYSLDLIQYYLRYLKIMYPCSFHPVQLLTNELRLLGIYG
Sbjct: 721  HSLRFEERKWKIGIFSEGIFKKYSLDLIQYYLRYLKIMYPCSFHPVQLLTNELRLLGIYG 780

Query: 781  VPGVLRLQSYHTFKKLDMLFSYVNTRGKLWLGKDEEELKVLLDVPTPYLSESERFIKLEP 840
            VPGVLRLQSYHTFKKLDMLFSYVNTRGKLWLGKDEEELKVLLDVPTPYLSESERFIKLEP
Sbjct: 781  VPGVLRLQSYHTFKKLDMLFSYVNTRGKLWLGKDEEELKVLLDVPTPYLSESERFIKLEP 840

Query: 841  EEINGIQTFLKYNLAEFQKLRNCLIILKKLAIVQQIKHRDVITMRNSFLSLGNQMSQKGV 900
            EEINGIQTFLKYNLAEFQKLRNCLIILKKLAIVQQIKHRDVITMRNSFLSLGNQMSQKGV
Sbjct: 841  EEINGIQTFLKYNLAEFQKLRNCLIILKKLAIVQQIKHRDVITMRNSFLSLGNQMSQKGV 900

Query: 901  AKSFENTNCAWSYDLSYYEFTRNLEYLEHSVVTLLNNFESLLAKTTLWWKHFGELMELKK 960
            AKSFENTNCAWSYDLSYYEFTRNLEYLEHSVVTLLNNFESLLAKTTLWWKHFGELMELKK
Sbjct: 901  AKSFENTNCAWSYDLSYYEFTRNLEYLEHSVVTLLNNFESLLAKTTLWWKHFGELMELKK 960

Query: 961  EWKKNFPNDKAPPSSANRNFIDTYIEGKRSKFRNKLSNQLKMSSLNLKKIGGEIKTTHES 1020
            EWKKNFPNDKAPPSSANRNFIDTYIEGKRSKFRNKLSNQLKMSSLNLKKIGGEIKTTHES
Sbjct: 961  EWKKNFPNDKAPPSSANRNFIDTYIEGKRSKFRNKLSNQLKMSSLNLKKIGGEIKTTHES 1020

Query: 1021 IAVGINLFIEFKEQFYHDHIVKSIVDQRIRENKQIMQQLIDTMKGHV 1067
            IAVGINLFIEFKEQFYHDHIVKSIVDQRIRENKQIMQQLIDTMKGHV
Sbjct: 1021 IAVGINLFIEFKEQFYHDHIVKSIVDQRIRENKQIMQQLIDTMKGHV 1067

>Sklu_YGOB_Anc_6.20b Chr5 (89924..92470,92474..93193) [3267 bp, 1088
            aa] {ON} ANNOTATED BY YGOB -
          Length = 1088

 Score =  723 bits (1865), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/1102 (36%), Positives = 630/1102 (57%), Gaps = 56/1102 (5%)

Query: 1    MPYHLPVLLNPLLNAIFNCPSPKTSSLKQMFSRLDDERFFILVPSTETLLQFQDLESGLE 60
            MPYHLP+LLNPL+N++FNCP+P TS LK++F+ L D+RF ++VP+   LL +QDL++G  
Sbjct: 1    MPYHLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSS 60

Query: 61   LAELCYHYDFVASHIVVIKDPTKDVPDQRSIYNTDFTTLNGRKLSIRYRNSTIVTGDGFT 120
            L +LCY Y+FVA+HI+++K  +K   DQ      +F TLNG+ + IR +N  ++TGDGF 
Sbjct: 61   LQDLCYTYEFVANHIIILKKDSK-YSDQ------EFKTLNGKTVLIRSQNGIVLTGDGFP 113

Query: 121  ERRKITIKEINLLPTFNDYLKGSNYTPILHISMPLCGDLVPLDELQVFSKVAGNKYSKQE 180
             +R+  I    L   FNDYLKGS Y P++HI  PL  D V  DELQVF    G + +   
Sbjct: 114  SKRRCKITNTELFINFNDYLKGSKYFPLIHIDKPLMSDAVKNDELQVF----GVRSTNTS 169

Query: 181  QAPLPFDEEQKKVLYFEQRIQSISDVAERVALTFHLTKARIKKAISVIGIRTEWLNTRD- 239
              PL  D  Q++V  FEQ  +    + +R +  F   +  I      +    ++ +  + 
Sbjct: 170  SLPLSTDLTQREVSSFEQLFRLHPQLGDRFSGLFKEQRQEINANFKGLDSLVDFFDKFNY 229

Query: 240  SIRQIISLDKRLNHLEDLDAMIYDYVELKLFTDIQQQLSEIVEDQELEHRFDFKALRSIS 299
               ++I  ++R  +   L   +++YVEL L+ DI +Q++++  D E+E  +D+  L+ I+
Sbjct: 230  EAFELIRHERRFENHSKLHQTVHNYVELNLYDDIWKQITQLYRDDEIEATYDYNLLKYIA 289

Query: 300  LNQVPTNFYPKDEKSFSLASVVELEKSVNDALEYLKSIDLKTTHSGKLEVLSTTMRLLS- 358
            ++QVPT FYP+ +  FSL  V   EKS+  A +  K +   ++HS K +++  T++ L+ 
Sbjct: 290  ISQVPTPFYPEKQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKTKIIMDTLQTLTD 349

Query: 359  ------REINGISTDADTLLSLFVLLICRSQVTGLVRTLTYLTNFEISETSIKFGLQGYV 412
                   +I  ++ DADTL+ L VL++CRSQV  L   L YL NF + E +IKFG+  Y 
Sbjct: 350  YSEFPDADIEDVTIDADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENTIKFGVVAYA 409

Query: 413  LSTFEAALSFF----HQDTVDSLTKKCASNKKIWASIQKHSKVEAELLSSN--LRIRTDS 466
            LST EA L +F    +   + SL   C  NK+ W  +   +     L S    LRIRT  
Sbjct: 410  LSTLEAVLCYFEDAENSGKIRSLEFNCRRNKQFWDHLSCKAVSFDSLKSYRDILRIRTAG 469

Query: 467  GESLLSICIQSHNNEVLTTLLANFESEFPLEDILDDRDFALSTLLIQALQVQNSQAAAIL 526
            GES LS+CIQ  N   +  LL NFE E PLEDILDD+    STLL+Q L+  N++ A +L
Sbjct: 470  GESCLSVCIQKGNFSGIECLLQNFEHELPLEDILDDQTINGSTLLMQTLETGNTRMADVL 529

Query: 527  SEIILKSCTESEVRSYLNSPNLHNRITAHYIMQDISLLESVGRYFNWEHKDINGHTPLFA 586
             EI+ +SCT +E+R YLN  N   R  AHY+ QD+ + + +G +F+WE KDI+GHTPLFA
Sbjct: 530  LEILCQSCTINELREYLNRRNRWKRTAAHYLTQDLQMADKIGIFFDWEAKDISGHTPLFA 589

Query: 587  VFRSYDAVNYDEIVTKVLDQVVKWYANNNKPFNFKIHEDPKGNTLLHVMKSGIESLLKLP 646
            +FRSYD  +Y ++VT       KWY    + FNF  H+D KGNTLLHVMK+ IE LL+  
Sbjct: 590  IFRSYDHPDYAQMVTNAFRTASKWYEIRGENFNFSAHKDTKGNTLLHVMKTNIEILLEQE 649

Query: 647  DVNVNKPDSKGLTPLMIYSRYNRITNIETIMKDERLLCDLVQQPLVMTSLDFTKNPKVTK 706
            +++VN+ + KGLTPLM+Y +YNR+ N++ I++D RL+ +  Q+ L +   D+ KNP +  
Sbjct: 650  NIDVNEVNKKGLTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSLFLNCFDYVKNPVIQA 709

Query: 707  TILDATFNREP---VVIHSLRFEERKWKIGIFSEGIFKKYSLDLIQYYLRYLKIMY---- 759
             +      +     VV H+ RFE  +W + I  +G  ++     +++ +R ++ +     
Sbjct: 710  ELGFHAAEKTKFGEVVAHTFRFENNRWFLWITLKGKDRETDFQTVKHNIRAIQGLLQVYL 769

Query: 760  ---PCSFHPVQLLTNELRLLGIYGVPGVLRLQSYHTFKKLDMLFSYVNTRGKLWLGKDEE 816
               P SF P+  +  +L  +G  G+  V +L+ +    +L ++   +  +         E
Sbjct: 770  RRNPMSFLPIDAVLEDLHEIGKTGLVSVGKLEVHRFLCELTLVLKLICQK---------E 820

Query: 817  ELKVLLDVPTP----YLSESER-----FIKLEPEEINGIQTFLKYNLAEFQKLRNCLIIL 867
            E K  L +P      ++ ES R       ++EPEEIN IQ+FL++NL+E   +R+ + IL
Sbjct: 821  EFKKALYLPASDLVNWIRESGRKRTNVSRRIEPEEINSIQSFLRFNLSELSLIRDKISIL 880

Query: 868  KKLAIVQQIKHRDVITMRNSFLSLGNQMSQKGVAKSFENTNCAW--SYDLSYYEFTRNLE 925
            +KL+I  ++K +D+   R    S   ++    ++++F  +  +   S DLS    T N++
Sbjct: 881  QKLSIFSELKAQDINQARCMLFSQSVRLEDTAISQAFGISGLSEKDSEDLSATILTSNID 940

Query: 926  YLEHSVVTLLNNFESLL-AKTTLWWKHFGELMELKKEWKKNFPNDKAPPSSANRNFIDTY 984
            +L+     L+   + LL  K T WWK + EL++ + ++ KNFPN   P    N+    TY
Sbjct: 941  FLKECTNKLVGKIDQLLQGKLTRWWKLYAELLDARNQYNKNFPNSVKPHLDDNKGLFGTY 1000

Query: 985  IEGKRSKFRNKLSNQLKMSSLNLKKIGGEIKTTHESIAVGINLFIEFKEQFYHDHIVKSI 1044
            +EGKRSK   KLS Q+K     L+ +  E+K  HE++A  +++++EFK  +    I++  
Sbjct: 1001 VEGKRSKLEEKLSAQIKSCLERLQTLTYEVKQEHEALAEELSIYLEFKTNYLRTGIIQDF 1060

Query: 1045 VDQRIRENKQIMQQLIDTMKGH 1066
               +I   K  M+    ++K +
Sbjct: 1061 TVGKINTLKDTMRHFKRSLKNY 1082

>Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to
            Ashbya gossypii ACR006C
          Length = 1079

 Score =  618 bits (1594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/1085 (34%), Positives = 616/1085 (56%), Gaps = 49/1085 (4%)

Query: 1    MPYHLPVLLNPLLNAIFNCPSPKTSSLKQMFSRLDDERFFILVPSTETLLQFQDLESGLE 60
            MPYHLPVLLNPL+NA+FNCP+P TS LK++F+ +  +RF +LVPST+ LLQ+QDL+SGL 
Sbjct: 1    MPYHLPVLLNPLVNAVFNCPTPTTSPLKKLFNNVKGQRFILLVPSTDVLLQYQDLDSGLP 60

Query: 61   LAELCYHYDFVASHIVVIKDPTKDVPDQRSIYNTDFTTLNGRKLSIRYRNSTIVTGDGFT 120
            L+ELCY+YDFVASHI++    +K V +Q      ++ TLNG  + IR +   +++     
Sbjct: 61   LSELCYNYDFVASHILIQLQESK-VTEQ------EYRTLNGNSVIIRSQAGIVMSK---P 110

Query: 121  ERRKITIKEINLLPTFNDYLKGSNYTPILHISMPLCGDLVPLDELQVFSKVAGNKYSKQE 180
            E RK  +K   +L  FNDYL    Y P+LHI  PL G LV  DELQVF     +  SK +
Sbjct: 111  ELRKCRVKSYEVLRNFNDYLSNVIYFPLLHIDRPLVGALVRNDELQVFGSYEMHNPSKSK 170

Query: 181  QAPLPFDEEQKKVLYFEQRIQSISDVAERVALTFHLTKARIKKAIS----VIGIRTEWLN 236
                  +   +  + FE+ I+    +  ++   F   + RI+  +     +I I  + + 
Sbjct: 171  T----INTISENHIPFEKFIRLYPQLGAQLDGYFQRDRQRIRNEVDQLDKLIKIFKDLV- 225

Query: 237  TRDSIRQIISLDKRLNHLEDLDAMIYDYVELKLFTDIQQQLSEIVEDQELEHRFDFKALR 296
                +  +I  DK   +  +L  +  +YVEL ++ DI  +L ++   +E +    + + +
Sbjct: 226  --IDVYGVIKEDKNFRNYMELLNVTQEYVELNMYEDIWLKLVQLNGSKEPDRVSGYSSTK 283

Query: 297  SISLNQVPTNFYPKDEKSFSLASVVELEKSVNDALEYLKSIDLKTTHSGKLEVLSTTMRL 356
             ISLN V T  YP+   SF L  V E+EK V  A +    + L  +H+ K +++ +T ++
Sbjct: 284  YISLNNVATILYPEGTNSFDLRVVTEVEKRVVKATDCFAKLSLTNSHNEKAKIVVSTFQI 343

Query: 357  LSREINGISTD----ADTLLSLFVLLICRSQVTGLVRTLTYLTNFEISETSIKFGLQGYV 412
            L+ ++   S D    ADTL+ L ++++CRSQV  L   L YL  F      +KFGL GY 
Sbjct: 344  LTTKMEYTSIDPTIDADTLIGLMLVVLCRSQVKNLKSHLEYLREFAPRPDDVKFGLTGYS 403

Query: 413  LSTFEAALSFFHQ-DTVDSLTKKCA---SNKKIWASIQKHSKVEAELLSSNLRIRTDSGE 468
            LST EA L++F   D  + L K  +   +N+  W  I+    V      ++L  R+ + E
Sbjct: 404  LSTIEAVLAYFEAGDGTEKLKKLISLSEANRVFWDLIRSGVAVSLSSYKNSLISRSSNCE 463

Query: 469  SLLSICIQSHNNEVLTTLLANFESEFPLEDILDDRDFALSTLLIQALQVQNSQAAAILSE 528
            S LSICI +   +++  +L N++ +  LED+L D + A STLLIQAL+  + + A +L +
Sbjct: 464  SSLSICIHAGRLDLIKEILLNYQEQIKLEDLLFDVNQANSTLLIQALETGHDEIAELLID 523

Query: 529  IILKSCTESEVRSYLNSPNLHNRITAHYIMQDISLLESVGRYFNWEHKDINGHTPLFAVF 588
            +++ +CT +E   Y+N  N   R  AHY+ Q  S++E +G Y +W  KD+N HTPLF + 
Sbjct: 524  VMISNCTNNEFYEYVNRSNSAGRTVAHYLPQAFSIIEKIGLYLDWRKKDVNMHTPLFIIC 583

Query: 589  RSYDAVNYDEIVTKVLDQVVKWYANNNKPFNFKIHEDPKGNTLLHVMKSGIESLLKLPDV 648
            R+YD ++Y E++++  + V ++     + F+F  HEDP GN+LLH+MK GI+S+L  P++
Sbjct: 584  RAYDQLHYSEMLSRSFEYVFEYCRRRGEDFSFTDHEDPMGNSLLHIMKGGIQSILSQPNI 643

Query: 649  NVNKPDSKGLTPLMIYSRYNRITNIETIMKDERLLCDLVQQPLVMTSLDFTKNPKVTKTI 708
            NVNK + KG+TPLM+Y++YNRI NI  I++D+RL+   +Q P  + ++D+ KNP +   I
Sbjct: 644  NVNKSNIKGMTPLMLYAKYNRIENIRDILEDKRLIVSKIQNPQTLKAIDYVKNPMILNLI 703

Query: 709  LDATFNREPVVIHS---LRFEERKWKIGI---FSEGIFK--KYSLDLIQYYLRYLKIMYP 760
                       + S   ++FE+  W + I   FS+  +   + S+  IQ  L++    +P
Sbjct: 704  GTHIAKNSLYGLLSADGIKFEDNCWYLWITVKFSDNSYSTLRQSVKNIQGLLQFYNKKHP 763

Query: 761  CSFHPVQLLTNELRLLGIYGVPGVLRLQSYHTFKKLDMLFSYVNTRGKLW--LGKDEEEL 818
             +F P+  + + L+ +G  G+  V+ L++      L  L S +  R +    L  +E +L
Sbjct: 764  MNFLPIDHILSILKNIGKPGILPVINLENSIFLGLLTQLLSVIGQRNEYMAVLRYNESDL 823

Query: 819  KVLLDVPT--PYLSESERFIKLEPEEINGIQTFLKYNLAEFQKLRNCLIILKKLAIVQQI 876
               L      P  ++ ER   +EPEE++ IQ+FLK+NL+EF +++    IL+KL + Q +
Sbjct: 824  STWLRTNNFKPRANKDER---IEPEEVSSIQSFLKFNLSEFSEIKEKFTILRKLVVFQSL 880

Query: 877  KHRDVITMRNSFLSLGNQMSQKGVAKSFENTNCAWSYDLSYYEFTRNLEYLEHSVVTLLN 936
            K +D I      +    ++    V  S E T    + + S   F + +E++   + TL +
Sbjct: 881  KAQD-IECAQRIIYQQMEIVSNSVGPSVEKTFIGSNENYSLDSFQQAIEFIAMCLETLSS 939

Query: 937  NFESLL-AKTTLWWKHFGELMELKKEWKKNFPND-KAPPSSA--NRNFIDTYIEGKRSKF 992
              + +L +K TLWW+ +GEL  L++E+++NFP+D K+   S   ++ F ++YIEGKR K 
Sbjct: 940  KIQYVLDSKVTLWWRLYGELSSLRREYQRNFPSDFKSSDVSGEESKGFFESYIEGKRQKT 999

Query: 993  RNKLSNQLKMSSLNLKKIGGEIKTTHESIAVGINLFIEFKEQFYHDHIVKSIVDQRIREN 1052
             +KL  +L++    L+ + GE+K  HE++A  I+ F+ FK   Y   ++K+  +  I+ +
Sbjct: 1000 EDKLQARLRVCITKLQTLSGELKKDHENLAEEISFFVTFKNFAYESFVMKTYANICIKHH 1059

Query: 1053 KQIMQ 1057
            + I+Q
Sbjct: 1060 RNILQ 1064

>TDEL0G04490 Chr7 complement(814781..818062) [3282 bp, 1093 aa] {ON}
            Anc_6.20 YML002W
          Length = 1093

 Score =  606 bits (1562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/1101 (34%), Positives = 601/1101 (54%), Gaps = 65/1101 (5%)

Query: 1    MPYHLPVLLNPLLNAIFNCPSPKTSSLKQMFSRLDDERFFILVPSTETLLQFQDLESGLE 60
            MPYHLPVLLNPL+NA+FNCP+P TS+LK++FS L D +F +LVP  + LL   D  SG  
Sbjct: 1    MPYHLPVLLNPLVNAVFNCPNPSTSNLKKLFSNLKDRKFILLVPPCDRLLDCNDKLSGSP 60

Query: 61   LAELCYHYDFVASHIVVIKDPTKDVPDQRSIYNTDFTTLNGRKLSIRYRNSTIVTGDGFT 120
            L ELCY Y+FVASH+++I +   +           F TLNG+K+ +R +N  I+T DGF 
Sbjct: 61   LQELCYSYEFVASHVLLIDEQNAEYMTTAPPSQVKFDTLNGKKVIVRSQNRIILTSDGFQ 120

Query: 121  ERRKITIKEINLLPTFNDYLKGSNYTPILHISMPLCGDLVPLDELQVFSKVAGNKYSKQE 180
             +++  I + +L   FN+YL      PIL I  P+C + V    +Q+   +   K   ++
Sbjct: 121  VKKRCHITKTDLFVNFNEYLLQEYKFPILCIDEPICAESVRTQRVQISQTLGSGKRETKD 180

Query: 181  QAPLPFDEEQKKVLYFEQRIQSISDVAERVALTFHLTKARIKKAISVIGIRTEWLNTRDS 240
             +    D  Q     F+    +I  +    AL F+   A  +          E  +  D 
Sbjct: 181  GSSPTLDSSQGSKSSFD----NILRIHPDWALKFNELFAEYRSTPEGDDPHIELFH--DI 234

Query: 241  IRQIISL---DKRLNHLEDLDAMIYDYVELKLFTDIQQQLSEIVEDQELEHRFDFKALRS 297
            IR+  S    D     + DL  +IYDYVEL L+ DI  +++   +D E+E       LR 
Sbjct: 235  IRRAYSAMRSDALFASMPDLSDLIYDYVELNLYDDIWVRITHHFKDSEVES----NGLRY 290

Query: 298  ISLNQVPTNFYPKDEKSFSLASVVELEKSVNDALEYLKSIDLKTTHSGKLEVLSTTMRLL 357
            +SL+Q+ T  YP   + F+L SVV +E ++  A+     + L   H+ K   L  T+R L
Sbjct: 291  LSLHQLETGLYPDKFEEFNLKSVVSMENNIELAMNSFSRLPLAHAHADKAMYLIDTLRNL 350

Query: 358  SR------EINGISTDADTLLSLFVLLICRSQVTGLVRTLTYLTNFEISETSIKFGLQGY 411
            SR      E++ ++  ADTLLSLFVL+ICR+Q+  L   L YL NF  +ETSI FG+ GY
Sbjct: 351  SRVDKSIQEVSPVAIGADTLLSLFVLVICRTQLRNLKGQLFYLQNFAKNETSITFGVLGY 410

Query: 412  VLSTFEAALSFFHQ----DTVDSLTKKCASNKKIWASIQ-KHSKVEAELLSSNLRIRTDS 466
             +ST EAA+ +F +      +  L  +C + + +   +  + S V        L  RT+ 
Sbjct: 411  AISTLEAAVCYFDELKGSKKMSRLESECENARSLVDKLSSESSSVNLIHYQKTLSYRTEQ 470

Query: 467  GESLLSICIQSHNNEVLTTLLANFESEFPLEDILDDRDFALSTLLIQALQVQNSQAAAIL 526
            GESLLSICI +  N++L  LL++ E  FPLEDIL+D+     TLL+Q+L+  N  AA+++
Sbjct: 471  GESLLSICIANGKNDILQELLSD-ERSFPLEDILEDQTTEGCTLLMQSLKCGNGDAASLI 529

Query: 527  SEIILKSCTESEVRSYLNSPNLHNRITAHYIMQDISLLESVGRYFNWEHKDINGHTPLFA 586
             ++I  SCT+ E+ +Y N  +   R  AHY+  +I++LE +G +F+W+ KD +GHT LF 
Sbjct: 530  VDLIKSSCTQEEMFAYFNRSDKDKRTAAHYLTHEINILEQIGNFFDWDVKDSSGHTALFT 589

Query: 587  VFRSYDAVNYDEIVTKVLDQVVKWYANNNKPFNFKIHEDPKGNTLLHVMKSGIESLLKLP 646
            +FRSYD  NYD+++        +WYA   +PF F +HED K NTLLH++K  I  LL+  
Sbjct: 590  IFRSYDQPNYDDMIRASFRCAAEWYACRMRPFCFTVHEDRKENTLLHILKRSISILLEYE 649

Query: 647  DVNVNKPDSKGLTPLMIYSRYNRITNIETIMKDERLLCDLVQQPLVMTSLDFTKNPKVTK 706
             V+VN  + KGLTPLM+Y++YNR+ N ++I+ D+R++   +Q PL++ S+D+ KNP +  
Sbjct: 650  SVDVNARNRKGLTPLMVYAKYNRLDNTKSILTDKRVILGKIQHPLLLCSIDYAKNPLILH 709

Query: 707  TI-----LDATFNREPVVIHSLRFEERKWKIGIFSE----GIFK--KYSLDLIQYYLRYL 755
             I     +D  F +    +H+L++E   W + I  +    G F+  ++ L  +Q + R +
Sbjct: 710  EIAKQSAMDTAFGK--CFVHTLKYESSSWLVNITVQADRKGNFETVEFHLKTVQNFFRTV 767

Query: 756  KIMYPCSFHPVQLLTNELRLLGIYGVPGVLRLQSYHTFKKLDMLFSY-VNTRGKLWLGKD 814
                P +F P+    N+L  LG   +  + +L++    + L   F+  +N++    L KD
Sbjct: 768  LRTCPMTFLPLDSTLNQLASLGKARLSSIGKLETVCYLRSLTNCFNVLINSQE---LPKD 824

Query: 815  ----EEELKVLLDVPTPYLSESERFI---KLEPEEINGIQTFLKYNLAEFQKLRNCLIIL 867
                E +L   + V           I   K+EPEE++ IQ FL++N AE   LR+ L ++
Sbjct: 825  ILANESKLLSWIKVQYKAFRNGTTHIFSKKVEPEEMSIIQGFLRFNQAELSTLRSKLHVM 884

Query: 868  KKLAIVQQIKHRDVITMRNSFLSLGNQMSQKGVAKSFENTNCAWSYDLSYYE-----FTR 922
            KKLAI  ++K  DV       L LG++    G+   +  T+  +S    Y          
Sbjct: 885  KKLAIFLRLKSSDVEQSVELLLPLGSE----GMGDLYPLTDHKFSCTTVYGNDSMILLVE 940

Query: 923  NLEYLEHSVVTLLNNFESLL-AKTTLWWKHFGELMELKKEWKKNFPN-DKAPPSSANRNF 980
            +++ +    + L ++  +LL  K   WWK +GEL+  +K++ +NFP+  K   +S +   
Sbjct: 941  DIDLMLKCTIRLYDHINNLLQVKIPEWWKLYGELLNFRKQYAQNFPHLVKNGETSTDAGI 1000

Query: 981  IDTYIEGKRSKFRNKLSNQLKMSSLNLKKIGGEIKTTHESIAVGINLFIEFKEQFYHDHI 1040
            I   +EGK+ K   +LS  +  +  ++ + G  I   HES+A  ++ F+EFK  +    I
Sbjct: 1001 IGKILEGKKEKLEKRLSFSIAETRRSMNQAGAIIAHDHESLAEQLSKFMEFKGAY----I 1056

Query: 1041 VKSIVDQRIREN-KQIMQQLI 1060
             + ++ + +REN K++ ++LI
Sbjct: 1057 CRGVIKRWVRENIKELKERLI 1077

>Sklu_YGOB_Anc_6.20 Chr5 (89924..92473) [2550 bp, 849 aa] {OFF}
           ANNOTATED BY YGOB -
          Length = 849

 Score =  596 bits (1537), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/862 (37%), Positives = 499/862 (57%), Gaps = 48/862 (5%)

Query: 1   MPYHLPVLLNPLLNAIFNCPSPKTSSLKQMFSRLDDERFFILVPSTETLLQFQDLESGLE 60
           MPYHLP+LLNPL+N++FNCP+P TS LK++F+ L D+RF ++VP+   LL +QDL++G  
Sbjct: 1   MPYHLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSS 60

Query: 61  LAELCYHYDFVASHIVVIKDPTKDVPDQRSIYNTDFTTLNGRKLSIRYRNSTIVTGDGFT 120
           L +LCY Y+FVA+HI+++K  +K   DQ      +F TLNG+ + IR +N  ++TGDGF 
Sbjct: 61  LQDLCYTYEFVANHIIILKKDSK-YSDQ------EFKTLNGKTVLIRSQNGIVLTGDGFP 113

Query: 121 ERRKITIKEINLLPTFNDYLKGSNYTPILHISMPLCGDLVPLDELQVFSKVAGNKYSKQE 180
            +R+  I    L   FNDYLKGS Y P++HI  PL  D V  DELQVF    G + +   
Sbjct: 114 SKRRCKITNTELFINFNDYLKGSKYFPLIHIDKPLMSDAVKNDELQVF----GVRSTNTS 169

Query: 181 QAPLPFDEEQKKVLYFEQRIQSISDVAERVALTFHLTKARIKKAISVIGIRTEWLNTRD- 239
             PL  D  Q++V  FEQ  +    + +R +  F   +  I      +    ++ +  + 
Sbjct: 170 SLPLSTDLTQREVSSFEQLFRLHPQLGDRFSGLFKEQRQEINANFKGLDSLVDFFDKFNY 229

Query: 240 SIRQIISLDKRLNHLEDLDAMIYDYVELKLFTDIQQQLSEIVEDQELEHRFDFKALRSIS 299
              ++I  ++R  +   L   +++YVEL L+ DI +Q++++  D E+E  +D+  L+ I+
Sbjct: 230 EAFELIRHERRFENHSKLHQTVHNYVELNLYDDIWKQITQLYRDDEIEATYDYNLLKYIA 289

Query: 300 LNQVPTNFYPKDEKSFSLASVVELEKSVNDALEYLKSIDLKTTHSGKLEVLSTTMRLLS- 358
           ++QVPT FYP+ +  FSL  V   EKS+  A +  K +   ++HS K +++  T++ L+ 
Sbjct: 290 ISQVPTPFYPEKQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKTKIIMDTLQTLTD 349

Query: 359 ------REINGISTDADTLLSLFVLLICRSQVTGLVRTLTYLTNFEISETSIKFGLQGYV 412
                  +I  ++ DADTL+ L VL++CRSQV  L   L YL NF + E +IKFG+  Y 
Sbjct: 350 YSEFPDADIEDVTIDADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENTIKFGVVAYA 409

Query: 413 LSTFEAALSFF----HQDTVDSLTKKCASNKKIWASIQKHSKVEAELLSSN--LRIRTDS 466
           LST EA L +F    +   + SL   C  NK+ W  +   +     L S    LRIRT  
Sbjct: 410 LSTLEAVLCYFEDAENSGKIRSLEFNCRRNKQFWDHLSCKAVSFDSLKSYRDILRIRTAG 469

Query: 467 GESLLSICIQSHNNEVLTTLLANFESEFPLEDILDDRDFALSTLLIQALQVQNSQAAAIL 526
           GES LS+CIQ  N   +  LL NFE E PLEDILDD+    STLL+Q L+  N++ A +L
Sbjct: 470 GESCLSVCIQKGNFSGIECLLQNFEHELPLEDILDDQTINGSTLLMQTLETGNTRMADVL 529

Query: 527 SEIILKSCTESEVRSYLNSPNLHNRITAHYIMQDISLLESVGRYFNWEHKDINGHTPLFA 586
            EI+ +SCT +E+R YLN  N   R  AHY+ QD+ + + +G +F+WE KDI+GHTPLFA
Sbjct: 530 LEILCQSCTINELREYLNRRNRWKRTAAHYLTQDLQMADKIGIFFDWEAKDISGHTPLFA 589

Query: 587 VFRSYDAVNYDEIVTKVLDQVVKWYANNNKPFNFKIHEDPKGNTLLHVMKSGIESLLKLP 646
           +FRSYD  +Y ++VT       KWY    + FNF  H+D KGNTLLHVMK+ IE LL+  
Sbjct: 590 IFRSYDHPDYAQMVTNAFRTASKWYEIRGENFNFSAHKDTKGNTLLHVMKTNIEILLEQE 649

Query: 647 DVNVNKPDSKGLTPLMIYSRYNRITNIETIMKDERLLCDLVQQPLVMTSLDFTKNPKVTK 706
           +++VN+ + KGLTPLM+Y +YNR+ N++ I++D RL+ +  Q+ L +   D+ KNP +  
Sbjct: 650 NIDVNEVNKKGLTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSLFLNCFDYVKNPVIQA 709

Query: 707 TILDATFNREP---VVIHSLRFEERKWKIGIFSEGIFKKYSLDLIQYYLRYLKIMY---- 759
            +      +     VV H+ RFE  +W + I  +G  ++     +++ +R ++ +     
Sbjct: 710 ELGFHAAEKTKFGEVVAHTFRFENNRWFLWITLKGKDRETDFQTVKHNIRAIQGLLQVYL 769

Query: 760 ---PCSFHPVQLLTNELRLLGIYGVPGVLRLQSYHTFKKLDMLFSYVNTRGKLWLGKDEE 816
              P SF P+  +  +L  +G  G+  V +L+ +    +L ++   +  +         E
Sbjct: 770 RRNPMSFLPIDAVLEDLHEIGKTGLVSVGKLEVHRFLCELTLVLKLICQK---------E 820

Query: 817 ELKVLLDVPTP----YLSESER 834
           E K  L +P      ++ ES R
Sbjct: 821 EFKKALYLPASDLVNWIRESGR 842

>KLTH0C11242g Chr3 complement(921970..925263) [3294 bp, 1097 aa] {ON}
            similar to uniprot|Q04263 Saccharomyces cerevisiae
            YML002W Hypothetical ORF
          Length = 1097

 Score =  599 bits (1544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/1095 (33%), Positives = 589/1095 (53%), Gaps = 58/1095 (5%)

Query: 1    MPYHLPVLLNPLLNAIFNCPSPKTSSLKQMFSRLDDERFFILVPSTETLLQFQDLESGLE 60
            MPY+LPVLLNPL+NA+FNCP+P+ S L+++F+R++ +RF ++ P+ E LL+++DLESG  
Sbjct: 1    MPYYLPVLLNPLINAVFNCPTPQNSPLRKVFTRIEKQRFALVTPTPEILLEYEDLESGSS 60

Query: 61   LAELCYHYDFVASHIVVIKDPTKDVPDQRSIYNTDFTTLNGRKLSIRYRNSTIVTGDGFT 120
            L +LCY   FV+ HI+++             +  ++ TL+G+ +++R +   + TG+GF 
Sbjct: 61   LQDLCYSASFVSDHILLLGGGGCS-------HEEEYKTLSGKTITLRNQQKALFTGEGFD 113

Query: 121  ERRKITIKEINLLPTFNDYLKGSNYTPILHISMPLCGDLVPLDELQVFSKVA-GNKYSKQ 179
             RR+  + E  LL  FN+Y +GS+  PI+H+  PL G L   DE   F      +  +  
Sbjct: 114  ARRRCQVLETELLSNFNEYFQGSSTYPIIHVDFPLTGRLARRDEWPGFKAYRFASTDTTS 173

Query: 180  EQAPLPFDEEQKKVLYFEQRIQSISDVAERVALTFHLTKARIKKAI-SVIGIRTEWLNTR 238
              + L    E K  L  EQ +++     ++++      +A +  +  +   +   ++ T 
Sbjct: 174  ANSSLAASTEPKASL--EQMLRAHPSYGDKLSAIIRTQRAALSSSTYNADNLAAHFMQTC 231

Query: 239  DSIRQIISLDKRLNHLEDLDAMIYDYVELKLFTDIQQQLSEIVEDQELEHRFDFKALRSI 298
            +     I  D+      +L   I++YVE+ L+ D   QL+  ++D E+E++ DF  LR+I
Sbjct: 232  EKALAAIQEDQSFRAFPNLRLQIHEYVEMNLYDDFWAQLTNSLKDSEIENQSDFSILRNI 291

Query: 299  SLNQVPTNFYPKDEKSFSLASVVELEKSVNDALEYLKSIDLKTTHSGKLEVLSTTMRLLS 358
            S++QVP+  YP D + F +  V ++EK++ +A+E L+ + +  +HS K +V+  T++ +S
Sbjct: 292  SISQVPSFLYPTDRQKFDIRCVTQVEKNLREAVECLRRLPVTNSHSSKAKVIVETLQTVS 351

Query: 359  R--EING--ISTDADTLLSLFVLLICRSQVTGLVRTLTYLTNFEISETSIKFGLQGYVLS 414
            R  EIN   IS DADTL+SL V+++C+++V  L   L YL  F     SI FG+  Y +S
Sbjct: 352  RSLEINDKVISVDADTLVSLLVVVVCQAEVKDLKSHLFYLQEFAKDSNSITFGILAYGMS 411

Query: 415  TFEAALSFFH-QDTVDSLTKKCASNKKIWASIQKHSKVEAELLSSN----LRIRTDSGES 469
            T EA LS+F  ++ +  L K C+SN   W ++         L  S     LR RT +G S
Sbjct: 412  TLEAVLSYFESREKLKLLEKHCSSNASYWEALADGKLPLGSLNPSEVKDILRTRTPAGLS 471

Query: 470  LLSICIQSHNNEVLTTLLANFESEFPLEDILDDRDFALSTLLIQALQVQNSQAAAILSEI 529
             LSIC+Q+    +   L   FE  FPLED+L+D     S LLIQ L    S  +    E+
Sbjct: 472  CLSICLQNRQPNLFLHLATKFEHCFPLEDLLNDETVEGSNLLIQMLDNGCSSLSGNFIEM 531

Query: 530  ILKSCTESEVRSYLNSPNLHNRITAHYIMQDISLLESVGRYFNWEHKDINGHTPLFAVFR 589
            + +SCT++E+ S+LN  N + R + HY+M  + L+  VG++ NWE +D NGHTPLFA+ R
Sbjct: 532  LFRSCTKTELESFLNHVNRYQRSSGHYLMHALDLIVKVGKFINWEQRDCNGHTPLFAIIR 591

Query: 590  SYDAVNYDEIVTKVLDQVVKWYANNNKPFNFKIHEDPKGNTLLHVMKSGIESLLKLPDVN 649
            +YD  +YD +V +       W     K F    H+D KGNTLLHV+KS +  +L  P VN
Sbjct: 592  TYDHTDYDAMVLEAYKSARLWCTLKGKQFRLSKHQDNKGNTLLHVIKSNVSVVLDDPLVN 651

Query: 650  VNKPDSKGLTPLMIYSRYNRITNIETIMKDERLLCDLVQQPLVMTSLDFTKNPKVTKTIL 709
            VN  + KGLTP+M+Y+RYNR+ NI++I++D+RL+    Q    +T  D+ KNP V   + 
Sbjct: 652  VNSFNKKGLTPIMVYARYNRLDNIKSILRDKRLIIQKCQNGSYLTCFDYIKNPVVLGELG 711

Query: 710  DATF---NREPVVIHSLRFEERKWKIGIFSEGIFK-------KYSLDLIQYYLRYLKIMY 759
               F       +  H+++FE  +W + +   G          + SL  IQ +L       
Sbjct: 712  KHAFFLPQSYQIRAHNIKFEGDEWVLWMTLVGSVPNAPAKVIQRSLKFIQSFLISFSKTN 771

Query: 760  PCSFHPVQLLTNELRLLGIYGVPGVLRLQSYHTFKKLDMLFSYVNTRGKLWLGKDEEELK 819
              +F P + L  EL LL    +  + RL++ H  ++  ++ S +           +EE +
Sbjct: 772  SMTFIPAESLAEELSLLAKMKIISINRLETKHFLRRASVVLSLICR---------QEEFE 822

Query: 820  VLLDVPTPYLSESERFIK----------LEPEEINGIQTFLKYNLAEFQKLRNCLIILKK 869
             + + P+  L  +   ++          +EPEE+  IQ  +K+N  E   +++  ++LKK
Sbjct: 823  HIFNNPSGSLVNAAEHVQEQEANSTYGMIEPEEVASIQKIMKFNRTEILAIKSGALMLKK 882

Query: 870  LAIVQQIKHRDVITMRNSFLSLGNQMSQKGVAKSFENTNCAWSYDLSYYEF---TRNLEY 926
            LAI   +K +D+      F S GN  + K + +S  N   +  + L   EF     N   
Sbjct: 883  LAIFGILKGKDLERSHTMFQSHGNNFT-KIIGRS-TNVFGSLKHSLPQCEFGYLANNTAL 940

Query: 927  LEHSVVTLLNNFESLLAK-TTLWWKHFGELMELKKEWKKNFPNDKAPPSSANRNFIDTYI 985
            LE S   L+   + +L      WWK +GEL+ L+ E+ KNFP+D  P  + N  FI +YI
Sbjct: 941  LELSSRLLVQKIDKILNHDIPHWWKTYGELVSLRHEYNKNFPDDVRPRVAENTGFISSYI 1000

Query: 986  EGKRSKFRNKLSNQLKMSSLNLKKIGGEIKTTHESIAVGINLFIEFKEQFYHDHIVKSIV 1045
            E KR +    L  ++  SS NL +    ++ ++ES+AV +N FI FK +F+    +K   
Sbjct: 1001 ETKRVRLEQGLVGRINRSSKNLLRFSLMLRRSNESLAVELNNFINFKAEFWVSATIKEHA 1060

Query: 1046 DQRIRENKQIMQQLI 1060
               I   K + +QL+
Sbjct: 1061 AMNI---KWLQEQLV 1072

>ACR006C Chr3 complement(364436..367651) [3216 bp, 1071 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YML002W and
            YML003W; YML002W and YML003W represent one ORF in this
            genome
          Length = 1071

 Score =  594 bits (1532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/1084 (33%), Positives = 594/1084 (54%), Gaps = 50/1084 (4%)

Query: 1    MPYHLPVLLNPLLNAIFNCPSPKTSSLKQMFSRLDDERFFILVPSTETLLQFQDLESGLE 60
            MPYHLPVLLNPL+NA+FNCP+P  S LK++F+   D++F ++VP TE LLQ+QD  + + 
Sbjct: 1    MPYHLPVLLNPLVNAVFNCPAPGASPLKKLFNNAKDKKFILVVPRTEVLLQYQDATTYVP 60

Query: 61   LAELCYHYDFVASHIVVIKDPTKDVPDQRSIYNTDFTTLNGRKLSIRYRNSTIVTGDGFT 120
            L ELCY+Y+FVASH +V     +       +   +F T+NG+ + IR + S I+T     
Sbjct: 61   LTELCYNYEFVASHTLVQLQEAR-------VTELEFQTINGKSVVIRPQ-SGIITAQ--P 110

Query: 121  ERRKITIKEINLLPTFNDYLKGSNYTPILHISMPLCGDLVPLDELQVFSK----VAGNKY 176
              +K  I+   LL +FNDYL G     +L+I  PL G++  +  L+VF      +   + 
Sbjct: 111  SAKKCRIQRCELLRSFNDYLLGRTAFALLYIDRPLVGEIELITPLRVFGPQEQPLQYQRI 170

Query: 177  SKQEQAPLPFDEEQKKVLYFEQRIQSISDVAERVALTFHLTKARIKK-AISVIGIRTEWL 235
            ++   APLP           EQ ++    +  ++   F   K R++  A+S+  +   + 
Sbjct: 171  TQTADAPLPL----------EQFLRLHPQLGNQLDEVFKDAKERMRYIALSLKELVRLFH 220

Query: 236  NTRDSIRQIISLDKRLNHLEDLDAMIYDYVELKLFTDIQQQLSEIVEDQELEHRFDFKAL 295
               + +  +I LDK   +  +L  M+  YVEL ++ D+ ++L ++    E +    +   
Sbjct: 221  ELVEKVYCLIKLDKNFRNYLNLLEMVQGYVELNMYEDVWRKLVQLNGKNEPDRVPGYYIT 280

Query: 296  RSISLNQVPTNFYPKDEKSFSLASVVELEKSVNDALEYLKSIDLKTTHSGKLEVLSTTMR 355
            RSISLNQ+ T+ YP++   F+L+ V E+EK V  A E    + L  +H  K  +L +T +
Sbjct: 281  RSISLNQLSTSIYPEELDKFNLSPVTEIEKRVVQATECFSKLTLTNSHHEKARILISTFQ 340

Query: 356  LLSREINGIS----TDADTLLSLFVLLICRSQVTGLVRTLTYLTNFEISETSIKFGLQGY 411
             L+ + +  +     DADTLL L V+++CR+QV  L   L YL  F  +   +KFGL GY
Sbjct: 341  KLTTKTSQATLDPMIDADTLLGLMVVVVCRAQVKNLKSHLDYLREFAQNSDDVKFGLLGY 400

Query: 412  VLSTFEAALSFF----HQDTVDSLTKKCASNKKIWASIQKHSKVEAELLSSNLRIRTDSG 467
             LST EA + +F        ++ L  +C  NK  W  I++   +  +     L  RT S 
Sbjct: 401  SLSTLEAVVGYFDIGGSSIKLERLITQCQRNKIFWNLIEQGIPINLKEHEEVLISRTPSC 460

Query: 468  ESLLSICIQSHNNEVLTTLLANFESEFPLEDILDDRDFALSTLLIQALQVQNSQAAAILS 527
            ES+LS+CIQ    +V   ++AN++S F LEDIL D + +  +LLIQALQ  N      + 
Sbjct: 461  ESVLSLCIQYGRQDVFYDIIANYQSHFTLEDILQDVNQSNCSLLIQALQAGNKDITEAVI 520

Query: 528  EIILKSCTESEVRSYLNSPNLHNRITAHYIMQDISLLESVGRYFNWEHKDINGHTPLFAV 587
            ++++ +CT +E+ +Y+N  ++  R   HY+ Q+  +++ +G++ +W+ KD+N HTPLF V
Sbjct: 521  DLLIANCTNTEMYAYINKCDIAGRTVGHYLPQNYEIVDRLGKFVDWKRKDLNMHTPLFTV 580

Query: 588  FRSYDAVNYDEIVTKVLDQVVKWYANNNKPFNFKIHEDPKGNTLLHVMKSGIESLLKLPD 647
             R+YD  +Y E+++K       +Y+   K F+F  HEDP GNTLLH++K GI+  L  P 
Sbjct: 581  CRAYDHPSYLELLSKCFQHCFDFYSTRGKRFSFADHEDPLGNTLLHIIKDGIQLALSTPG 640

Query: 648  VNVNKPDSKGLTPLMIYSRYNRITNIETIMKDERLLCDLVQQPLVMTSLDFTKNPKVTKT 707
             NVNK +++G+TPLM+Y++YNRI NI  I+ D+RL+   +Q P  + ++D+ KNP +   
Sbjct: 641  ANVNKCNTRGMTPLMVYAKYNRIENIREILNDKRLILSKLQDPQSLKAIDYVKNPIILNL 700

Query: 708  ILDATFNRE---PVVIHSLRFEERKWKIGI---FSEGIFK--KYSLDLIQYYLRYLKIMY 759
            I  A         + +H++++EE  W + I    S   +K   Y+L  IQ  L+     +
Sbjct: 701  IGTAMAKNSLYGCLSVHNIKYEENAWYLWITSSLSPESYKTSSYALKDIQSLLQIYNKKH 760

Query: 760  PCSFHPVQLLTNELRLLGIYGVPGVLRLQSYHTFKKLDMLFSYVNTRG--KLWLGKDEEE 817
            P SF P+      L+ LG  G+  V+ L++    + L    S +  R   K      E E
Sbjct: 761  PMSFLPIDHHLETLKTLGKSGIISVINLENSMLLEALTFSLSIIQQREDYKNVFSYTESE 820

Query: 818  LKVLLDVPTPYLSESERFIKLEPEEINGIQTFLKYNLAEFQKLRNCLIILKKLAIVQQIK 877
            L   L         ++R  K+EPEEI+ IQ FLK++L EF  LR    +LKKL I +  K
Sbjct: 821  LSTWLRASMVKQKPNKR-DKIEPEEIHSIQNFLKFSLTEFNYLREKFTVLKKLIIFEHYK 879

Query: 878  HRDVITMRNSFLSLGNQMSQKGVAKSFENTNCAWSYDLSYYEFTRNLEYLEHSVVTLLNN 937
              D+   +    S G  ++    +K    +     ++     F + ++++   + +L + 
Sbjct: 880  SHDIECSQRILYSQGEIIASVVPSKRLRTSPFDNEFNDGIDPFEQAVDFMCMCLDSLTSK 939

Query: 938  F-ESLLAKTTLWWKHFGELMELKKEWKKNFPNDKAPPSSA----NRNFIDTYIEGKRSKF 992
              E L +K + WW  +GE+  L+KE+++NFP +K  P+SA    ++ F  +Y+E KR K 
Sbjct: 940  IVEVLDSKVSTWWTLYGEITNLQKEYQRNFP-EKGKPNSASSEDSKGFFVSYMEDKRQKL 998

Query: 993  RNKLSNQLKMSSLNLKKIGGEIKTTHESIAVGINLFIEFKEQFYHDHIVKSIVDQRIREN 1052
             +KL ++L + S NL+ +  E+K  HE +A  I+ FI  K   Y + +VK+ V++RI+++
Sbjct: 999  ESKLQSRLSVCSENLQHLDAELKHCHELLAEEISFFISSKNFAYMNFMVKAYVNRRIKQH 1058

Query: 1053 KQIM 1056
            K ++
Sbjct: 1059 KNML 1062

>ZYRO0C07810g Chr3 complement(591035..594334) [3300 bp, 1099 aa] {ON}
            similar to uniprot|Q04257 Saccharomyces cerevisiae
            YML003W/YML002W Hypothetical ORF
          Length = 1099

 Score =  588 bits (1517), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/1111 (34%), Positives = 607/1111 (54%), Gaps = 73/1111 (6%)

Query: 1    MPYHLPVLLNPLLNAIFNCPSPKTSSLKQMFSRLDDERFFILVPSTETLLQFQDLESGLE 60
            M YH+PVLLNPL+N++FNC +P  S  K++F +L  ERF +LVP TE LL   D ESG  
Sbjct: 1    MAYHIPVLLNPLVNSVFNCSNPSDSQFKKLFGKLKTERFILLVPPTEKLLYHVDAESGSS 60

Query: 61   LAELCYHYDFVASHIVVIK-DPTKDVPDQRSIYNTDFTTLNGRKLSIRYRNSTIVTGDGF 119
            + +LC +YDFVASHI++++ D   D     S   T++ TLN +++++R  +  I+T +GF
Sbjct: 61   MNDLCQNYDFVASHILLLQQDTYSDGGFNLSASQTEYKTLNDKRVAVRSSSGEILTTEGF 120

Query: 120  TERRKITIKEINLLPTFNDYLKGSNYTPILHISMPLCGDLVPLDELQVFSKVA-GNKYSK 178
              RR+  I+ + L+  FNDYL GS    ++HI  PL G L+   ++ +   +A GN    
Sbjct: 121  PLRRRARIQNVELITNFNDYLNGSEKFALVHIDHPLIGTLIR--KIDIPRGLAQGNFNGV 178

Query: 179  QEQAPLPFDEEQKKVLYFEQRIQSISDVAERVALTFH------LTKARIKKAISVIGIRT 232
              +  L  D  QK    FE  ++   D +  +   F+      LT+   ++   +I  + 
Sbjct: 179  DAKGSLVRDLTQKSWSSFENILRLHPDWSNILNGYFNRYRSTPLTEGPYEELFRMIVKQV 238

Query: 233  EWLNTRDSIRQIISLDKRLNHLEDLDAMIYDYVELKLFTDIQQQLSEIVEDQELEHRFDF 292
                  D       L +++ HL DL   I+DYVEL LF D+  ++       E+    D 
Sbjct: 239  HAKMVNDE------LFRKIPHLYDL---IFDYVELNLFDDVWIRIVNSYRKDEI----DT 285

Query: 293  KALRSISLNQVPTNFYPKDEKSFSLASVVELEKSVNDALEYLKSIDLKTTHSGKLEVLST 352
            + L+ +S+N++ T  Y K  + F L  V  +EK+++ A+     + L  TH+ K + L  
Sbjct: 286  EPLKFLSINELETELYQKKYEKFRLQDVTTMEKNIDLAINSFVGLPLTHTHAEKADCLIN 345

Query: 353  TMRLLS--REIN------GISTDADTLLSLFVLLICRSQVTGLVRTLTYLTNFEISETSI 404
            T++ LS  RE +       I+ DADTL+S FVL++CR+QV  +   L YL  F   E SI
Sbjct: 346  TLQSLSNTREQDMDIQTLPITMDADTLISFFVLVVCRTQVKNIKSHLFYLKKFSKDENSI 405

Query: 405  KFGLQGYVLSTFEAALSFFH----QDTVDSLTKKCASNKKIWASIQKHSKVEAEL----L 456
            KFG+ GY +ST EA + +F        +  L       K+++  I   S  +A L     
Sbjct: 406  KFGILGYAISTLEAVVFYFDGLKGTKKLQKLQDDSNKAKELYILISDKSTGQAVLDISQF 465

Query: 457  SSNLRIRTDSGESLLSICIQSHNNEVLTTLLANFESEFPLEDILDDRDFALSTLLIQALQ 516
             SNL  RT  GES+LS CI +  N +L  LL N+E  FPLEDILDD     STLLIQAL+
Sbjct: 466  RSNLEFRTPQGESVLSQCIINDKNGLLYELLKNYEDIFPLEDILDDETVDGSTLLIQALK 525

Query: 517  VQNSQAAAILSEIILKSCTESEVRSYLNSPNLHNRITAHYIMQDISLLESVGRYFNWEHK 576
              NS+AA ++ E++  SCTE E+R Y+N  + + R  AHY+  ++++LES+G+Y NW+ +
Sbjct: 526  CDNSEAAQMIVEVLQNSCTEQELREYVNRADKNRRTVAHYLTHEMNILESIGKYINWKSQ 585

Query: 577  DINGHTPLFAVFRSYDAVNYDEIVTKVLDQVVKWYANNNKPFNFKIHEDPKGNTLLHVMK 636
            D NGHTPLF +FR YD  NY+ +++      V+WY  N + F F  HED KGNTLLH++K
Sbjct: 586  DSNGHTPLFTIFRCYDQQNYEAMISAAFRSAVRWYQANGEDFQFSDHEDNKGNTLLHIIK 645

Query: 637  SGIESLLKLPDVNVNKPDSKGLTPLMIYSRYNRITNIETIMKDERLLCDLVQQPLVMTSL 696
            + +  LL   +V++N  + KGLTPLMIY+RYNR  N++TI++D+R++ D +Q P  + S 
Sbjct: 646  NNVSILLDYDNVDINCTNKKGLTPLMIYTRYNRFDNVKTIIRDQRIILDKLQHPSFLNSF 705

Query: 697  DFTKNPKVTKTILDATFNR---EPVVIHSLRFEERKW------KIGIFSEGIFKKYSLDL 747
            D+ +NP V K ++         E   +H L++E   W      KIG  ++  +K   L +
Sbjct: 706  DYARNPLVLKELVSQAIKTTAFELAFVHHLKYEAPSWFFHITVKIGAGADEEYKTVKLHI 765

Query: 748  --IQYYLRYLKIMYPCSFHPVQLLTNELRLLGIYGVPGVLRLQSYHTFKKL----DMLFS 801
              +Q   + L  M+  SF P++    +L  L    +P + +L++ + F  L    D+L  
Sbjct: 766  KTLQNLFQVLLKMHFASFLPLEKALEDLSNLYKSRMPSIAKLETLYFFYMLTDCFDVLLR 825

Query: 802  YVNTRGKLWLGKDEEELKVLLDVPTPYLSESERFIK---LEPEEINGIQTFLKYNLAEFQ 858
            + N   KL L   E  L   +       + S++  K   +EPEEI  + +FL++N  E  
Sbjct: 826  HDNL-NKLVLR--ESRLVSWIRSQDKKCNNSKKLQKQKNVEPEEIGIMASFLRFNRGELS 882

Query: 859  KLRNCLIILKKLAIVQQIKHRDVITMRNSFLSL----GNQMSQKGVAKSFENTNCAWSYD 914
             ++  L+ +KKL I  ++K+ D +T    FLSL     N    + + K  E   CA+  +
Sbjct: 883  AVKLKLMTMKKLLIFLKLKNTD-LTHSYQFLSLFGTEYNLAQDRLLFKDLEINCCAFGEE 941

Query: 915  LSYYEFTRNLEYLEHSVVTLLNNFESLLA-KTTLWWKHFGELMELKKEWKKNFPNDKAPP 973
             +   F R + +LE+    LL+  E LL+     WWK +G+++E+ K +K+ FPN     
Sbjct: 942  AT-MTFVREIAFLENCTGKLLDRVEQLLSVDIPEWWKLYGDVLEMHKVYKQKFPN--ISR 998

Query: 974  SSANRNFIDTYIEGKRSKFRNKLSNQLKMSSLNLKKIGGEIKTTHESIAVGINLFIEFKE 1033
            + +    I ++ EGKR K  +KLS+ L      ++++G  I +THE +A  ++ ++EFK 
Sbjct: 999  NDSGTGIIASFFEGKREKMESKLSSDLADCKKRMRRVGDRISSTHEILAEELSKYMEFKS 1058

Query: 1034 QFYHDHIVKSIVDQRIRENKQIMQQLIDTMK 1064
             F+    +  I+ + +REN  I++  +  M+
Sbjct: 1059 NFF----INGILRRAVRENINILKGRLVEMR 1085

>Kwal_56.22424 s56 (121475..124744) [3270 bp, 1089 aa] {ON} YML002W -
            Hypothetical ORF [contig 185] FULL
          Length = 1089

 Score =  552 bits (1423), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 359/1096 (32%), Positives = 576/1096 (52%), Gaps = 62/1096 (5%)

Query: 1    MPYHLPVLLNPLLNAIFNCPSPKTSSLKQMFSRLDDERFFILVPSTETLLQFQDLESGLE 60
            MPY+LPVLLNPL+NA+FNCP+P  SSLK++FS ++  RF ++ P TE LL+++DLESGL 
Sbjct: 1    MPYYLPVLLNPLINAVFNCPTPLNSSLKKVFSAIEKVRFVLIAPPTELLLEYEDLESGLP 60

Query: 61   LAELCYHYDFVASHIVVIKDPTKDVPDQRSIYNTDFTTLNGRKLSIRYRNSTIVTGDGFT 120
            L +LCY   FV+ HIV++         +  +   ++ TL+G+ + +R +   I T   F 
Sbjct: 61   LQDLCYATGFVSDHIVLLDG-------REGLQEEEYKTLSGKTILLRSQQGIIFTAAAFD 113

Query: 121  ERRKITIKEINLLPTFNDYLKGSNYTPILHISMPLCGDLVPLDELQVFSKVAGNKYSKQE 180
             RR+  I+   LL  FN+YLKG    PI+H+  PL G L   DE Q F      +++   
Sbjct: 114  TRRRCRIQRAELLTNFNEYLKGDTTFPIIHVDFPLTGRLARRDEWQCFRVTKNQEHTNGP 173

Query: 181  QAPLPFDEEQKKVLYFEQ--RI-----QSISDV--AERVALTFHLTKARIKKAISVIGIR 231
            +           +   EQ  RI     +S++D+  A+R++L   +T            + 
Sbjct: 174  KNSGKLSHGDNNI-SLEQLLRINPEYGESLNDIVKAQRISLNSSVT--------GTTHLA 224

Query: 232  TEWLNTRDSIRQIISLDKRLNHLEDLDAMIYDYVELKLFTDIQQQLSEIVEDQELEHRFD 291
            + ++ T      ++        L +L   +++Y+EL L+ D   QL+  + D E+E   D
Sbjct: 225  SHFVQTCKKALDVVRAYPAFQVLPNLPICVHEYIELNLYDDYWAQLTNSLRDSEIESSSD 284

Query: 292  FKALRSISLNQVPTNFYPKDEKSFSLASVVELEKSVNDALEYLKSIDLKTTHSGKLEVLS 351
            +  L+ IS++QVP+  YP + + F L  + + EK+V  A+E  + I +   HS K +V+ 
Sbjct: 285  YSLLKHISVSQVPSFLYPSNPEKFDLRLITQAEKNVKGAVESFRKIAVTNCHSAKAKVII 344

Query: 352  TTMRLLSREI----NGISTDADTLLSLFVLLICRSQVTGLVRTLTYLTNFEISETSIKFG 407
             T++ LSR +      ++ DADTL+SLFV+++C +QV  L   L YL  F      + FG
Sbjct: 345  ETLQTLSRSLLVDDRAVTIDADTLVSLFVVVVCHAQVKDLRSHLFYLQEFTKDTNLVTFG 404

Query: 408  LQGYVLSTFEAALSFFHQ-DTVDSLTKKCASNKKIWASIQKHS-KVEAEL---LSSNLRI 462
            +  Y +ST EA L +F   + V SL K C +N   W SI + S  + A+    L   L+I
Sbjct: 405  ILAYGMSTLEAVLCYFESPEKVASLEKYCRANLSHWKSISEGSIDLNADTTVPLDDLLKI 464

Query: 463  RTDSGESLLSICIQSHNNEVLTTLLANFESEFPLEDILDDRDFALSTLLIQALQVQNSQA 522
            RT  G+S L++C+Q    E    +    E+ FPLED+L D     S LLI  L+    + 
Sbjct: 465  RTSDGQSCLAVCLQHRRTEEFELIKNTREAWFPLEDLLHDETTDGSNLLIHMLESGCDRL 524

Query: 523  AAILSEIILKSCTESEVRSYLNSPNLHNRITAHYIMQDISLLESVGRYFNWEHKDINGHT 582
            A +L   ++ +CT+ E+ ++LN  N + R   HY+M    L++ VG   NWE +D NGHT
Sbjct: 525  AVMLINTLISNCTKDELIAFLNHTNKYQRSCGHYLMHAPQLIDLVGDILNWEQRDCNGHT 584

Query: 583  PLFAVFRSYDAVNYDEIVTKVLDQVVKWYANNNKPFNFKIHEDPKGNTLLHVMKSGIESL 642
            PLFA+ R+YD  +Y ++V+      V      N  F    H D KGNTLLHV+KS +  L
Sbjct: 585  PLFAIVRAYDRPDYFDMVSAAYRAAVGQSKVRNSRFRVSNHTDDKGNTLLHVIKSDVSIL 644

Query: 643  LKLPDVNVNKPDSKGLTPLMIYSRYNRITNIETIMKDERLLCDLVQQPLVMTSLDFTKNP 702
            L  P ++VN  ++KGLTPLM+Y RYNRI N+ TI++D+RL+    Q    ++  D+ KNP
Sbjct: 645  LADPFIDVNATNAKGLTPLMVYVRYNRIGNVRTILQDQRLIIGKHQSGAYLSCFDYVKNP 704

Query: 703  KVTKTI------LDATFNREPVVIHSLRFEERKWKIGIFSEG--------IFKKYSLDLI 748
             V K +      L   F+   + +HS++ E  +W + I   G        +FK+ SL  I
Sbjct: 705  AVLKELGKYASYLPFEFS---INVHSVKREGDEWVLWITVTGGEKQVPVKVFKR-SLRFI 760

Query: 749  QYYLRYLKIMYPCSFHPVQLLTNELRLLGIYGVPGVLRLQSYHTFKKLDMLFSYVNTRGK 808
            Q +L      +P +F PV  L  ELR L    +  + ++ +    K+  +  S V+    
Sbjct: 761  QAFLTLFSDAHPMTFVPVDELLRELRALSQSRILILNKMDTKRFLKRCSVTLSMVSQERL 820

Query: 809  LWLGKDEEELKVLLDVPTPYLSESERFIK-LEPEEINGIQTFLKYNLAEFQKLRNCLIIL 867
                  +  L +             + +K +EPEE+  IQ+ LK+NL+E   L+  ++++
Sbjct: 821  FADAFTDSNLNLSSSRGLGSSESFTQNMKMMEPEEVRSIQSILKFNLSEISALKTAMLLM 880

Query: 868  KKLAIVQQIKHRDVITMRNSFLSLGNQMSQKGVAKSFENTNCAWSYDLSYYE-FTRNLEY 926
            KKLA+ + +K +D+     +F +    ++Q G  +SF++     + +L  +E    N+  
Sbjct: 881  KKLAVFEGLKGKDLSEACMTFGAKCKYVTQ-GKIQSFDHFLNVQAPNLFDFEGIANNIAL 939

Query: 927  LEHSVVTLLNNFESLLA-KTTLWWKHFGELMELKKEWKKNFPNDKAPPSSANRNFIDTYI 985
             E     L  +   +L      WW  +GEL+ L++E+KK+FP+   P  S N     +YI
Sbjct: 940  CELCSSLLCKHIGQVLNDDIPKWWHTYGELLSLRREYKKSFPDANRPHVSENSGLFGSYI 999

Query: 986  EGKRSKFRNKLSNQLKMSSLNLKKIGGEIKTTHESIAVGINLFIEFKEQFYHDHIVKSIV 1045
            E KR+K     + ++  +S+ L +I  +I   +E +AV +N FI FK +F     +KS +
Sbjct: 1000 ETKRTKLEQSYAARINHTSVRLSEISTKINQDNERLAVELNNFINFKNEF-----LKSAI 1054

Query: 1046 DQRIREN-KQIMQQLI 1060
             +    N K++ +QL+
Sbjct: 1055 KEHADTNIKRLREQLV 1070

>Suva_13.160 Chr13 (253437..256709) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  531 bits (1368), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 353/1109 (31%), Positives = 591/1109 (53%), Gaps = 102/1109 (9%)

Query: 3    YHLPVLLNPLLNAIFNCPSPKTSSLKQMFSRLDDERFFILVPSTETLLQFQDLESGLELA 62
            YHLP LLNPL+NAIFNCP P+ S LK++F+ L   RF +L P +  LL + D+++ L L 
Sbjct: 4    YHLPTLLNPLINAIFNCPEPEKSPLKKLFANLQTRRFILLAPPSHLLLNYHDVKTKLPLH 63

Query: 63   ELCYHYDFVASHIVVIKDPTKDVPDQRSIYNTDFTTLNGRKLSIRYRNSTIVTGDGFTER 122
            ELCY+ DF+ SHI++    T++     ++ +  + TL+G+ + ++++N+ I T +GF  R
Sbjct: 64   ELCYNADFINSHILLT---TENSYINTTLRDDHYETLDGKTVVVQWKNNVIHTLNGFPLR 120

Query: 123  RKITIKEINLLPTFNDYLKGSNYTPILHISMPLCGDLVPLDELQVFSKVAGNKYSKQEQA 182
            R++ I +  +LP FNDY KG+ Y  IL+I  PL  + VP D L  F+       + +   
Sbjct: 121  RRLKILDTKILPNFNDYFKGAEYFAILYIDQPLGCEFVPNDYLHCFNSYEETSKTARNAP 180

Query: 183  PLPFDEEQKKVLYFEQ----------RIQSISDVAERVALTFHLTKARIKKAI--SVIGI 230
             L  D  Q +   FE           ++  +     R AL    +K   ++ +  +  G+
Sbjct: 181  NLLMDTSQLERSSFENILHIHPAWLTQLGQLFSNYRRAALNDDPSKKMFEELVEQAFDGM 240

Query: 231  RTEWLNTRDSIRQIISLDKRLNHLEDLDAMIYDYVELKLFTDIQQQLSEIVEDQELEHRF 290
            +++            SL K  ++L DL   I+DY EL L+ DI  +L+   +  E+    
Sbjct: 241  KSD------------SLFKNFSNLYDL---IHDYFELNLYEDIWSRLTIHFKGYEV---- 281

Query: 291  DFKALRSISLNQVPTNFYPKDEKSFSLASVVELEKSVNDALEYLKSIDLKTTHSGKLEVL 350
            + +     S+NQ+ T++Y KD +SF L+ +  +E+ V+ A ++ + + L  +++ K ++L
Sbjct: 282  NTENCEYFSVNQLLTDYYSKDFESFKLSDITFIERRVSVASKHFQKLALSHSYAEKSKIL 341

Query: 351  STTMRLLS-------------REINGISTDADTLLSLFVLLICRSQVTGLVRTLTYLTNF 397
              T++ LS                N ++ DADTL+SLFVL++CRS+   +   L YL NF
Sbjct: 342  VETLQHLSGTTDMGSHKPDLSNGFNNLTMDADTLISLFVLVVCRSEQKHIRSHLYYLQNF 401

Query: 398  EISETSIKFGLQGYVLSTFEAALSFFHQDTVDSLTKK-----CASNKKIWASIQKHSKV- 451
              + +S KFG+ GY +ST EA + +F     ++         C   + +   +   +   
Sbjct: 402  SNNSSSSKFGILGYAISTLEAVVCYFENFNKNNNNVAKANLLCIKTRDLLDKLSCENPTN 461

Query: 452  EAELLSSN---LRIRTDSGESLLSICIQSHNNEVLTTLLANFESEFPLEDILDDRDFALS 508
            E   L++    L  R + G+S+LS+CI ++ N++L  +L+ +E+ FP+EDIL+D     S
Sbjct: 462  EVNDLATYKDILAYRNEQGQSILSLCITNNKNDILLDVLSEYEALFPIEDILEDETIDGS 521

Query: 509  TLLIQALQVQNSQAAAILSEIILKSCTESEVRSYLNSPNLHNRITAHYIMQDISLLESVG 568
            TLLI++++V N +A  IL  I+L +CT+ E+ +Y+N  + + R  AHY+  ++ +L+S+G
Sbjct: 522  TLLIESIKVGNLEATKILIRIMLFNCTDEELVTYVNKTDKYARSVAHYLTHEMDILKSIG 581

Query: 569  RYFNWEHKDINGHTPLFAVFRSYDAVNYDEIVTKVLDQVVKWYANNNKPFNFKIHEDPKG 628
             Y NW+ K+ +G TPLF++FRSYD  NY+E+V    +    WY  +N  F +  H D KG
Sbjct: 582  SYINWKQKNSSGQTPLFSIFRSYDQPNYEEMVKVAFNIASSWYQRHNTSFGYSDHTDNKG 641

Query: 629  NTLLHVMKSGIESLLKLPDVNVNKPDSKGLTPLMIYSRYNRITNIETIMKDERLLCDLVQ 688
            N+LLHV+K+ +  LL+L  +N+N  + KGLTPLM+Y +Y R++NI+ I KD RL+ + VQ
Sbjct: 642  NSLLHVLKTDVSILLQLTKLNINGENYKGLTPLMVYVKYKRLSNIDAITKDHRLILEKVQ 701

Query: 689  QPLVMTSLDFTKNPKVTKTILDATFNREP---VVIHSLRFEERKWKIGIFS----EGIFK 741
                 T  D+ K+  V   I +   N      + +HSLR+      + + S    E  F 
Sbjct: 702  NSTFFTCFDYAKDRLVLSKIGERGANDSIFGLIYLHSLRYHNLNATVNVTSVSKTEEPFV 761

Query: 742  KYSLDL--IQYYLRYLKIMYPCSFHPV--------QLLTNELRLLGIYGVPGVLRLQSYH 791
               +++  IQ  LR +    P +F P+         L  ++L ++G   V  +L      
Sbjct: 762  TAVINMKTIQGLLRSIVKDNPFTFLPIDNYIDGISHLNRSDLTIIGKADVRSLLH----- 816

Query: 792  TFKKLDMLFSYVNTRGKLW--LGKDEEELKVLLDVPTPYLSE----SERFIKLEPEEING 845
               KL   F+ +    K+   L  DE  +   + + T   ++     +    +EPEEIN 
Sbjct: 817  ---KLTNCFNVLLFLKKVPQNLFTDEASVLYWMRINTSRRNQKPPSKDNPKTMEPEEINM 873

Query: 846  IQTFLKYNLAEFQKLRNCLIILKKLAIVQQIKHRDVITMRNSFLSLGNQMSQKGVAKSFE 905
            IQ+FL++N  E    +  L IL+K+ I   +K  D      S L +G +++    A +F 
Sbjct: 874  IQSFLRFNFDEILSFKASLNILRKILIFLSLKSSDFEDAYASLLKMGTKVTNGKAADAFT 933

Query: 906  NT--NCAWSYDLSYYEFTRNLEYLEHSVVTLLNNFESLL-AKTTLWWKHFGELMELKKEW 962
                N     DLS  E   ++++LE   + L N+ +++L  +   WWKH+GE + L K +
Sbjct: 934  TIIKNHKMFSDLSLDELLEHVQFLEECTIQLFNSIQTILFDRIPNWWKHYGEFLTLHKNY 993

Query: 963  KKNFPNDKAPPSSANRNF---IDTYIEGKRSKFRNKLSNQLKMSSLNLKKIGGEIKTTHE 1019
            +K FP+   P S+A  +    +  +IE KR +   +LS Q+K SS  LK++G EI + HE
Sbjct: 994  RKAFPSAVKPKSTAGTSSHIPLGGFIETKREQSEQRLSVQIKASSKILKELGSEIFSAHE 1053

Query: 1020 SIAVGINLFIEFKEQFYHDHIVKSIVDQR 1048
            ++A  ++ ++EF+         K+ +DQR
Sbjct: 1054 NLAEELSNYMEFR---------KACLDQR 1073

>Skud_13.152 Chr13 (249372..252644) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  528 bits (1359), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 357/1105 (32%), Positives = 580/1105 (52%), Gaps = 94/1105 (8%)

Query: 3    YHLPVLLNPLLNAIFNCPSPKTSSLKQMFSRLDDERFFILVPSTETLLQFQDLESGLELA 62
            YHLP LLNPL+NAIFNCP P+ S LK++F+ L   RF +L P    LL + D+++ L L 
Sbjct: 4    YHLPTLLNPLINAIFNCPEPEKSPLKKLFANLKTRRFILLAPPLRFLLNYHDVKTKLPLH 63

Query: 63   ELCYHYDFVASHIVVIKDPTKDVPDQRSIYNTDFTTLNGRKLSIRYRNSTIVTGDGFTER 122
            ELCY+ DF+ SHI++    T++     ++ ++ + TL+G+ + I+++N+ I   +GF  R
Sbjct: 64   ELCYNVDFINSHILLT---TENSYLNTTLRDSHYETLDGKAVVIQWKNNIIHALNGFPIR 120

Query: 123  RKITIKEINLLPTFNDYLKGSNYTPILHISMPLCGDLVPLDELQVFSKVAGNKYSKQEQA 182
            +++ I E  +LP FNDY +G+    IL I  PL  ++ P D L+ F        + Q  +
Sbjct: 121  QRLKILETKVLPNFNDYFEGAADFAILFIDQPLNCEVAPNDYLKCFDSYEEVPKNAQSVS 180

Query: 183  PLPFDEEQKKVLYFEQRIQSISDVAERVALTFHLTKARIKKAISVIGIRTEWLNTRDSIR 242
             LP +        +EQ   S  ++        H+  AR+ +   +           D  +
Sbjct: 181  NLPVNS-------YEQERSSFDNI-------LHIHSARLAQLGQLFSNYRRLAPNDDPSK 226

Query: 243  QII--------------SLDKRLNHLEDLDAMIYDYVELKLFTDIQQQLSEIVEDQELEH 288
            ++               SL K  ++L DL   I+DY EL L+ DI  +L    +  E+  
Sbjct: 227  KMFEDIVQQSFDGMKSDSLFKNFSNLYDL---IHDYFELNLYDDIWSRLVTHFKGYEV-- 281

Query: 289  RFDFKALRSISLNQVPTNFYPKDEKSFSLASVVELEKSVNDALEYLKSIDLKTTHSGKLE 348
              D +  +  S+NQ+  +F+ KD K F L+ +  +E+ VN A ++ + + L  +++ K +
Sbjct: 282  --DTEKYKYFSVNQLLADFFSKDFKEFKLSDITFIERRVNVASKHFQKLTLTHSYAEKSK 339

Query: 349  VLSTTMRLLS-------------REINGISTDADTLLSLFVLLICRSQVTGLVRTLTYLT 395
            +L  T++ LS               +N ++ DADTLLSLFVL++CRS+   L   L YL 
Sbjct: 340  ILVETLQQLSGPTEISSHQQELPNGLNSLTMDADTLLSLFVLVVCRSEQKHLKSHLYYLQ 399

Query: 396  NFEISETSIKFGLQGYVLSTFEAALSFFHQ--DTVDSLTKKCASNKKIWASIQKHSKV-- 451
            NF  + +S KFG+ GY +ST EA + +F       ++L K   S +K    + K S    
Sbjct: 400  NFSNNPSSTKFGILGYAISTLEAVVCYFEDFDKNNENLAKANVSYQKTRELLDKLSSENP 459

Query: 452  --EAELLSS---NLRIRTDSGESLLSICIQSHNNEVLTTLLANFESEFPLEDILDDRDFA 506
              E E L++   NL+ R + G+S+LSICI +  N +L  +L  +E  FP+EDIL+D    
Sbjct: 460  TNEIENLATYEDNLQYRNEQGQSILSICITNTKNCILLDVLTEYEDLFPMEDILEDETLD 519

Query: 507  LSTLLIQALQVQNSQAAAILSEIILKSCTESEVRSYLNSPNLHNRITAHYIMQDISLLES 566
             STLLI++++  N +AA IL  I+L +C+E E+ SY+N  + + R  AHY+  ++ +L+S
Sbjct: 520  GSTLLIESIKTGNIEAAKILIGIMLLNCSEGELVSYVNKADKYARTVAHYLTHEMDILKS 579

Query: 567  VGRYFNWEHKDINGHTPLFAVFRSYDAVNYDEIVTKVLDQVVKWYANNNKPFNFKIHEDP 626
            +G Y +W+ K+ +G TPLF++FR+YD  NY+E+V    +    WY  +N  F++  H D 
Sbjct: 580  IGSYVDWKRKNSSGQTPLFSIFRTYDQPNYEEMVKIAFNIANSWYQKHNSSFDYLDHTDS 639

Query: 627  KGNTLLHVMKSGIESLLKLPDVNVNKPDSKGLTPLMIYSRYNRITNIETIMKDERLLCDL 686
            KGN+LLH++KS +  LL+L  +++N  + KGLTPLMIY +Y RI+NI+ I KD RL+ + 
Sbjct: 640  KGNSLLHILKSDVSILLQLSKLDINGRNYKGLTPLMIYVKYKRISNIDAITKDSRLILEK 699

Query: 687  VQQPLVMTSLDFTKNPKVTKTI-----LDATFNREPVVIHSLRFEERKWKIGIFSEGIFK 741
            VQ     T  D+ K+  V   I      D+ F    V +HSLR+        I +     
Sbjct: 700  VQNSTFFTCFDYAKDHSVLSKIGERGARDSLFGL--VYLHSLRYHNLNATTNITTASNTD 757

Query: 742  K------YSLDLIQYYLRYLKIMYPCSFHPVQLLTNELRLLGIYGVPGVLRLQSYHTFKK 795
            K       ++  IQ  LR +      +F P+    +E+  L    +  + +        K
Sbjct: 758  KPFLTTVINMKTIQGLLRSILKDNQFTFLPLNSYIDEISHLNRSDLTIIGKADVRSLLHK 817

Query: 796  LDMLFSYVNTRGKLW--LGKDEEELKVLLDVPTPYLSE----SERFIKLEPEEINGIQTF 849
            L   F+ +    K+   L  DE  +   + + T   ++     +    +EPEEIN IQ+F
Sbjct: 818  LTNCFNVLLFLKKVPQNLFTDEASVLYWMRINTSKRNQKPPSKDNPKTMEPEEINMIQSF 877

Query: 850  LKYNLAEFQKLRNCLIILKKLAIVQQIKHRDVITMRNSFLSLGNQMSQKGVAKSFEN--T 907
            L++N  E    +  L IL+K+ I   +K  D     +S   +G ++     A +F    T
Sbjct: 878  LRFNFDEISSFKASLNILRKILIFLSLKSNDFEDTYDSLREMGRKIINGEAADAFARIFT 937

Query: 908  NCAWSYDLSYYEFTRNLEYLEHSVVTLLNNFESLL-AKTTLWWKHFGELMELKKEWKKNF 966
            N     DL+  E   ++ +LE   + L    +++L  K T WWKH+GE + L+K ++K F
Sbjct: 938  NHNMFSDLALAELLEHVSFLEQCTIQLSTFVQTILFDKITKWWKHYGEFLALQKNYRKAF 997

Query: 967  PNDKAPPSSANRNF---IDTYIEGKRSKFRNKLSNQLKMSSLNLKKIGGEIKTTHESIAV 1023
            P+   P S+ +      + ++IE KR +   +L+ Q+K SS  LK++G EI T HE +A 
Sbjct: 998  PSVVKPKSATDTPSHIPLGSFIETKREQSEQRLAVQIKASSKILKELGSEIFTAHEKLAE 1057

Query: 1024 GINLFIEFKEQFYHDHIVKSIVDQR 1048
             ++ ++EF+         K+ +DQR
Sbjct: 1058 ELSNYMEFR---------KACLDQR 1073

>Smik_13.157 Chr13 (254644..257916) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  521 bits (1341), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 350/1097 (31%), Positives = 573/1097 (52%), Gaps = 101/1097 (9%)

Query: 4    HLPVLLNPLLNAIFNCPSPKTSSLKQMFSRLDDERFFILVPSTETLLQFQDLESGLELAE 63
            HLP LLNPL+NAIFNCP P+ S LK++F+ L   RF +L P +E LL + D+++ L L E
Sbjct: 5    HLPTLLNPLINAIFNCPEPEKSPLKKLFATLKTCRFILLAPPSEYLLNYHDVKTKLPLHE 64

Query: 64   LCYHYDFVASHIVVIKDPTKDVPDQRSIYNTDFTTLNGRKLSIRYRNSTIVTGDGFTERR 123
            LCY+ +F+ SHI+++ + +    + R   ++ + TL+G+ + I+++N+ I   +GF  RR
Sbjct: 65   LCYNAEFINSHILLMTENSFINTNSR---DSHYETLDGKTVVIQWKNNVIHALNGFQVRR 121

Query: 124  KITIKEINLLPTFNDYLKGSNYTPILHISMPLCGDLVPLDELQVF---SKVAGNKYSKQE 180
            ++ I    +LP FNDY +G+    I++I  PL  + VP D LQ F    K+  + YS   
Sbjct: 122  RLKILGTKILPNFNDYFEGATDFVIIYIEQPLSCESVPNDYLQCFHSYKKIPKSVYSVHN 181

Query: 181  QAPLPFDEEQKKVLYFEQRIQSISDVAERVALTFHLTKARIKKAISVIGIRTEWLNTRDS 240
               L  D  Q++   FE                 H+   R+ +   +         + D 
Sbjct: 182  ---LSLDSSQQERSSFEN--------------ILHIHPTRLTQLGEMFSNYRTLAPSDDP 224

Query: 241  IRQII--------------SLDKRLNHLEDLDAMIYDYVELKLFTDIQQQLSEIVEDQEL 286
              +I               SL K+  +L DL   I++Y EL L+ DI  +L+   +  E+
Sbjct: 225  SEKIFECIVQQAFEGMKSDSLFKKFPNLYDL---IHEYFELNLYDDIWSRLTSHFKSYEV 281

Query: 287  EHRFDFKALRSISLNQVPTNFYPKDEKSFSLASVVELEKSVNDALEYLKSIDLKTTHSGK 346
                  +  +  S+N +  +FY KD + F L  V  +EK V+ A ++ + + L  +++ K
Sbjct: 282  ----GTEEYKYFSINHLLADFYSKDFREFKLQDVTFIEKRVHLASKHFQKLTLTHSYTEK 337

Query: 347  LEVLSTTMRLLSR-------------EINGISTDADTLLSLFVLLICRSQVTGLVRTLTY 393
             ++L  T++ LS               +N ++ DADTL+SLFVL+ICRS+   L   L Y
Sbjct: 338  SKILVETLQELSGTTDMGSHQLDVPGRLNNLAMDADTLISLFVLVICRSEQKHLKSHLYY 397

Query: 394  LTNFEISETSIKFGLQGYVLSTFEAALSFFHQDTVDSLTKKCASNKKIWASIQKHSKVEA 453
            L NF  + +S KFG+ GY +ST EA + +F     +   K   +  K    +QK  ++  
Sbjct: 398  LQNFSNNSSSSKFGILGYAVSTLEAVVCYF-----EDFKKNSDNMAKANVLLQKTKRLVN 452

Query: 454  ELLSSN--------------LRIRTDSGESLLSICIQSHNNEVLTTLLANFESEFPLEDI 499
             L   N              L  R   G+S+LSICI ++ N +L  +L+ ++S FPLED+
Sbjct: 453  MLSCENVTNKVENLATYKDILPYRNGQGQSILSICISNNKNHILLDILSEYDSIFPLEDL 512

Query: 500  LDDRDFALSTLLIQALQVQNSQAAAILSEIILKSCTESEVRSYLNSPNLHNRITAHYIMQ 559
            L+D     STLLI++++  N +AA IL  I++ +CTE E+ SY+N  + ++R  AHY+  
Sbjct: 513  LEDETIDGSTLLIESIKSGNLEAAKILIRIMMLNCTEEELISYINRTDKYSRTVAHYLTH 572

Query: 560  DISLLESVGRYFNWEHKDINGHTPLFAVFRSYDAVNYDEIVTKVLDQVVKWYANNNKPFN 619
            +I +L+S+G Y +W+ K+  G TPLF++FRSYD  NY+ +V    +    WY   N+ F+
Sbjct: 573  EIDILKSIGNYVDWKRKNSGGQTPLFSIFRSYDQPNYEAMVKIAFNIANTWYRKQNRSFD 632

Query: 620  FKIHEDPKGNTLLHVMKSGIESLLKLPDVNVNKPDSKGLTPLMIYSRYNRITNIETIMKD 679
            ++ H D KGN LLHV+K+    LL+L  +++N  + KGLTPLM+Y +Y R+ NIE I+KD
Sbjct: 633  YRDHTDNKGNDLLHVLKTDASILLQLTKLDINGENYKGLTPLMVYVKYKRLNNIEAIIKD 692

Query: 680  ERLLCDLVQQPLVMTSLDFTKNPKVTKTI-----LDATFNREPVVIHSLRFEERKWKIGI 734
            +RL+ + +Q+    T  D+ K+  V   +      D+ F    +  HSLR+      + I
Sbjct: 693  QRLVLEKIQKSTFFTCFDYAKDHTVLSKVGERGAKDSLFGL--IYFHSLRYHNLNAAVNI 750

Query: 735  -FSEGIFKKYS-----LDLIQYYLRYLKIMYPCSFHPVQLLTNELRLLGIYGVPGVLRLQ 788
             F+    K +S     +  IQ  LR +    P +F P+ +  +E+  L    V  + +  
Sbjct: 751  TFASDTEKPFSNTVINMKTIQGLLRSILKDNPFTFLPLNIYIDEISQLSRSDVTIIGKAD 810

Query: 789  SYHTFKKLDMLFSYVNTRGKL--WLGKDEEELKVLLDVPTPYLSE----SERFIKLEPEE 842
                  KL   F+ +    K+   L  DE  +   + + T   ++     E +  +EPEE
Sbjct: 811  VMSLLHKLSNCFNVLLFLKKVPKSLFTDEASILYWMRINTSKRNQKQPSKENYKTMEPEE 870

Query: 843  INGIQTFLKYNLAEFQKLRNCLIILKKLAIVQQIKHRDVITMRNSFLSLGNQMSQKGVAK 902
            IN IQ+FL++N  E    +  L IL+K+ I   +K  D   + ++   +G  +     A 
Sbjct: 871  INMIQSFLRFNFDEISSFKASLSILRKILIFISLKSNDFKDVNDNLNEMGKSIYNAKAAD 930

Query: 903  SFEN--TNCAWSYDLSYYEFTRNLEYLEHSVVTLLNNFE-SLLAKTTLWWKHFGELMELK 959
            +F    TN     D S  +   ++ +LE   + L N  +  LL K   WWKH+GEL+ L 
Sbjct: 931  AFAGNLTNHNMFNDYSLAKLLEHVRFLEECTIQLSNLVQLILLEKIPNWWKHYGELITLH 990

Query: 960  KEWKKNFPNDKAPPSSANRNF---IDTYIEGKRSKFRNKLSNQLKMSSLNLKKIGGEIKT 1016
            K ++K FP+   P S+ + +    +  +IE KR +   +L+ Q+K+SS +LK++G EI  
Sbjct: 991  KNYRKAFPSVVKPKSTTDTSGHIQLGGFIETKREQSEQRLAVQIKVSSKSLKELGSEIFV 1050

Query: 1017 THESIAVGINLFIEFKE 1033
             HE +A  ++ ++EF++
Sbjct: 1051 AHEKLAEELSNYMEFRK 1067

>Kpol_1037.25 s1037 (56141..59458) [3318 bp, 1105 aa] {ON}
            (56141..59458) [3318 nt, 1106 aa]
          Length = 1105

 Score =  484 bits (1246), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 335/1096 (30%), Positives = 561/1096 (51%), Gaps = 62/1096 (5%)

Query: 1    MPYHLPVLLNPLLNAIFNCPSPKTSSLKQMFSRLDDERFFILVPSTETLLQFQDLESGLE 60
            + YH+PVLLNPL+NA+FNCP P  S L+++F R+  + F ++VP  E LL ++D E GL 
Sbjct: 4    LSYHMPVLLNPLINAVFNCPDPINSPLRKLFERIKYKNFMLIVPPNEILLHYRDPEKGLT 63

Query: 61   LAELCYHYDFVASHIVVIKDPTKD---VPDQRSIYNTD--FTTLNGRKLSIRYRNSTIVT 115
            L ELCY ++FVASHI++  D + +   V  + S    D  + +LN  +L I+  N   + 
Sbjct: 64   LKELCYEFEFVASHIILDTDNSSNNLQVKGKNSNETLDNRYKSLNNNQLLIKNNNIIPLD 123

Query: 116  GDGFTERRKITIKEINLLPTFNDYLKGSNYTPILHISMPLCGDLVPLDELQVF---SKVA 172
             +  T+++K  I +I +LP FN+YL GS    I++   P     +P  E++ F    K +
Sbjct: 124  FNNSTQKKKYKIIDIKILPNFNEYLSGSEKYTIIYTDYPFSNSWLPKIEIESFYISKKES 183

Query: 173  GNKYSKQ---EQAPLPFDEEQKKVLYFEQRI---QSISDVAERVALTFHLTKARIKKAIS 226
             N  + Q    ++PL  D  QK    F   I   +  +++ +   + F        K ++
Sbjct: 184  NNIKAAQITNHKSPLSQDLAQKTKSSFRHIINIHKEWNNIFDSYIIDFK------NKQLN 237

Query: 227  VIGIRTEWLNTRDSIRQIISLDK-RLNHLEDLDAMIYDYVELKLFTDIQQQLSEIVEDQE 285
            +  +   +    D   Q +  ++  L+   DL  +I++Y+E   +  I   +   + D +
Sbjct: 238  LTSLPIYFREIVDKAYQKMKFEEIFLSFHNDLYNLIFEYLESSFYNSIWDHIDRNMIDNQ 297

Query: 286  LEHRFDFKALRSISLNQVPTNFYPKDEKSFSLASVVELEKSVNDALEYLKSIDLKTTHSG 345
              H    + +  +S++Q+    Y ++ + F+L +V+++E+ V DA +  K I    +HS 
Sbjct: 298  FLHT---EMMDFLSIDQLELELYNQNFQKFNLVNVIKVERCVKDATDQFKKIIDSKSHSE 354

Query: 346  KLEVLSTTMRLLSR----EINGISTDADTLLSLFVLLICRSQVTGLVRTLTYLTNFEISE 401
            K ++L   ++ L+         +  DADTL++LF+L+ICRS+V  L   L YL NF   E
Sbjct: 355  KCQILIDALQKLTSYDDVHYEPLMVDADTLMNLFLLVICRSKVPFLRNHLYYLQNFSTDE 414

Query: 402  TSIKFGLQGYVLSTFEAALSFFHQ----DTVDSLTKKCASNKKIWASIQK---HSKVEAE 454
             ++KFGL GY +STFEA L +       +  +     C  NK++ + I     HS  + +
Sbjct: 415  NNVKFGLLGYGISTFEATLCYLKDFQAGEKFNKQVLNCIRNKELISKISSEADHSTFQVK 474

Query: 455  LLSSNLRIRTDSGESLLSICIQSHNNEVLTTLLANFESEFPLEDILDDRDFALSTLLIQA 514
            L     + R + GES+L++CI+   NE L  +L NFE  FPLEDILDD D   +TLL++A
Sbjct: 475  LYKDCFKFRNEMGESILALCIKHKKNETLFEILLNFEDMFPLEDILDDEDIEGTTLLMKA 534

Query: 515  LQVQNSQAAAILSEIILKSCTESEVRSYLNSPNLHNRITAHYIMQDISLLESVGRYFNWE 574
            L+V+N   A ++ +++  SC+E E+  Y N  + + RI AHYI   I +L+ +G +FNW+
Sbjct: 535  LKVENEVGAKLIVDVLQSSCSEDELIKYFNRTDNNQRIAAHYITNQIDVLKRIGLFFNWK 594

Query: 575  HKDINGHTPLFAVFRSYDAVNYDEIVTKVLDQVVKWYANNNKPFNFKIHEDPKGNTLLHV 634
             KD  G+TPL  + R+YD   Y++++     +  KWY N N+  NFK H D K NTLLH+
Sbjct: 595  IKDDKGYTPLTTICRTYDQECYEQMIETAFFEAQKWYENRNQKLNFKDHNDSKENTLLHI 654

Query: 635  MKSGIESLLKLPDVNVNKPDSKGLTPLMIYSRYNRITNIETIMKDERLLCDLVQQPLVMT 694
            +K  I+ LLK  ++N+N  + K +TPLM Y +YNR++NI+ I++DERL+    Q+   + 
Sbjct: 655  LKCDIQVLLKYDNININAHNLKYITPLMTYVKYNRVSNIQEIIRDERLILGKYQKHTFLD 714

Query: 695  SLDFTKNPKV-----TKTILDATFNREPVVIHSLRFEERKWKIGI-FSEG-----IFKKY 743
              DF KN  +      +++ ++ FN      +SLR E   W +   F +      I K  
Sbjct: 715  CYDFVKNTIIFEDLGVRSVRNSMFNL--FSAYSLRVENSNWVLYFTFKDTNQDSYITKSV 772

Query: 744  SLDLIQYYLRYLKIMYPCSFHPVQLLTNELRLLGIYGVPGVLRLQSYHTFKKLDMLFSYV 803
            SL ++   ++    +YP  F P + +   LRL GI        +Q       L+++ +Y 
Sbjct: 773  SLKILFNIIKKYNKLYPLHFIPHKEVL--LRLTGIVKNNPNNGIQKLKNRAFLNLISNYF 830

Query: 804  NT-----RGKLWLGKDEEELKVLLDVPTPYLSESERFIKLEPEEINGIQTFLKYNLAEFQ 858
             T          L K+ E L   +        +   + ++  ++IN I++F+++N+ E  
Sbjct: 831  GTLIETDDFDTELFKNPESLTKWIKAGKRKHKKENYYKRMTLDDINMIKSFVQFNINELG 890

Query: 859  KLRNCLIILKKLAIVQQIKHRDVITMRNSFLSLGNQMSQKGVAKSFENTNCAWS---YDL 915
            KL   L ILKKL     +K  DV      F + G  + QK ++   +  +       +  
Sbjct: 891  KLNRTLAILKKLCTFLALKINDVNESYKLFRNFGALLQQKDISNQMKKIDGLIKPKYFQS 950

Query: 916  SYYEFTRNLEYLEHSVVTLLNNFESLLAKTTLWWK--HFGELMELKKEWKKNFPNDKAPP 973
             +      + +LE   + + +NF  L+      W   HF  L  LKK++K++F  D    
Sbjct: 951  IFLILLDQISFLEICTIHMSDNFNDLIKNDIPEWHSVHFI-LSNLKKQYKRDFS-DFDSR 1008

Query: 974  SSANRNFIDTYIEGKRSKFRNKLSNQLKMSSLNLKKIGGEIKTTHESIAVGINLFIEFKE 1033
            +  N N +  Y + KR     ++S ++  ++    K+   I   HE++A   N F+ FK 
Sbjct: 1009 NGLNENILSRYTKNKREAAEKRISEEIIENTTLFDKVTAHIWYAHENLAEEFNKFLTFKS 1068

Query: 1034 QFYHDHIVKSIVDQRI 1049
            +F+ D I+  I+   I
Sbjct: 1069 RFFKDVILNMIIPSAI 1084

>TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.20
            YML002W
          Length = 1107

 Score =  473 bits (1217), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 343/1136 (30%), Positives = 572/1136 (50%), Gaps = 113/1136 (9%)

Query: 1    MPYHLPVLLNPLLNAIFNCPSPKTSSLKQMFSRLDDERFFILVPSTETLLQFQDLESGLE 60
            M Y +PVL NPL+NA+FNCP P  S  K++++ L D+ F +LVP+   LL ++D  S + 
Sbjct: 1    MAYFMPVLKNPLINAVFNCPDPHASPFKKLYNELRDKDFLLLVPNDFILLYYKDSTSNIS 60

Query: 61   LAELCYHYDFVASHIVVI-KDPTKDVPDQRSIYNTD--FTTLNGRKLSIRYRNSTIVTGD 117
              ELCY YDFVA+HI+++ K+ + D     +  N D    +LNG+++ +R   S  +   
Sbjct: 61   FRELCYTYDFVAAHILILDKNSSTDKISSSNQKNGDVYLKSLNGKEVLLR--QSLCIPIK 118

Query: 118  GFTERRKITIKEINLLPTFNDYLKGSNYTPILHISMPL-CGDLVPLDELQVFSKVAGNKY 176
            G+  +RK  +++  LL  FNDYL GS +  I+HI  PL   D   +DEL+ F        
Sbjct: 119  GYFSKRKSQMRDATLLTNFNDYLHGSGHFGIMHIDYPLGVSDWTLIDELKGF-------- 170

Query: 177  SKQEQAPLPFDEEQKKVLYFEQR--------IQSISDVAER----VALTFHLTKARIKKA 224
              +E   LPF  + K      QR        ++ I    ER    + L  +L K +  + 
Sbjct: 171  --EESRELPFHSQDKDKPGLLQRTEENKADRVKFIQLFQERKDWTIELEKYLKKYQAMEP 228

Query: 225  ISVIGIRTEWLNTRDSIRQIISLDKRLNHLEDLDAMIYDYVELKLFTDIQQQLSEIVEDQ 284
            +  IG    + +  + I   +  ++R     +L  + Y+Y+E  L+ DI  +L E   D+
Sbjct: 229  LQNIGSEL-FHDIVNMIYNTLKEEQRFQRFTNLYDIAYEYIESLLYQDIWNKLQEHYRDK 287

Query: 285  ELEHRFDFKALRSISLNQVPTNFYPKDEKSFSLASVVELEKSVNDALEYLKSIDLKTTHS 344
             L    DF+ +  +SL+ + T FY +  K+F L  +V +E  +  A+   K I    ++S
Sbjct: 288  IL----DFRLVSQLSLDMLDTTFYNRTFKNFQLIDIVNMEACMVQAVSVFKGIKSANSYS 343

Query: 345  GKLEVLSTTMRLLSREINGIST------------DADTLLSLFVLLICRSQVTGLVRTLT 392
             K++V+  T+ +++ + N   T            DADTL+SLF LL+CR+ V  +   + 
Sbjct: 344  KKVDVIFKTLNIITGK-NSDDTIRDNTLPKLPLIDADTLVSLFALLLCRAGVEDVFLHVQ 402

Query: 393  YLTNFEISETSIKFGLQGYVLSTFEAALSFFHQDTVDSLTKKCASNKKIWASIQKHSKVE 452
            YL +F   E ++KFG  GY LST EA LS+F++          +++ +    +QK S +E
Sbjct: 403  YLQSFYKDENTVKFGALGYTLSTIEATLSYFYE---------LSNSDESRIQLQKLSLLE 453

Query: 453  AELLS---------------SNLRIRTDSGESLLSICIQSHNNEVLTTLLANFESEFPLE 497
              L+                   R RT  GES+LS+ I +  NE L   L NFE  FPL+
Sbjct: 454  DFLIKIRSQHDDLIPINQFKDYFRYRTQYGESILSLLIANKKNEALCEALLNFEDIFPLD 513

Query: 498  DILDDRDFALSTLLIQALQVQNSQAAAILSEIILKSCTESEVRSYLNSPNLHNRITAHYI 557
            D+L D D + STLLI+ L+ +N +AA IL EI   SCT SE+ +Y N  +   R  AHYI
Sbjct: 514  DLLYDTDVSGSTLLIKCLKERNLEAAEILIEIFQNSCTNSELLNYYNKTDKTKRTLAHYI 573

Query: 558  MQDISLLESVGRYFNWEHKDINGHTPLFAVFRSYDAVNYDEIVTKVLDQVVKWYANNNKP 617
              +I +LE +G+Y NW  KD+ G T LF +FRSYD   Y   +   LDQ + WY NN+  
Sbjct: 574  TDEIEILEKIGKYINWTLKDLKGRTALFTIFRSYDQTTYSSTIKIALDQALLWYKNNDII 633

Query: 618  FNFKIHEDPKGNTLLHVMKSGIESLLKLPDVNVNKPDSKGLTPLMIYSRYNRITNIETIM 677
            F    H D  G++LLH++KS +  LLK  D+++N P+ KG+TPLM Y +YNRI NI+TI+
Sbjct: 634  FKVSDHTDLFGDSLLHILKSQVSLLLKFEDLDINIPNLKGMTPLMTYVKYNRIDNIKTIL 693

Query: 678  KDERLLCDLVQQPLVMTSLDFTKNPKVTKTILDATFNR----EPVVIHSLRFEERKWKIG 733
            +D RL+   +Q+   +  LD+ KN  V   +L A  ++    E   I   R+E+  W + 
Sbjct: 694  EDGRLIIKKLQKDKYLNCLDYGKNFTVF-NLLAAKLSKDVIFENAYISYARYEKSHWYLC 752

Query: 734  IFSEGIFKKYSLDLI---QYY--LRYLKIMYPCSFHPVQLLTNEL-RLLGIYGVPGVLRL 787
            I  +    +Y+ ++I   +YY  +  ++ +Y   F P   + + L +++  + +  + RL
Sbjct: 753  ISVQKDDLEYTTNIIKLKKYYNLINAMQKIYKSDFIPYSDMLDCLKKIIEGHNILPIRRL 812

Query: 788  Q-------------SYHTFKKLDMLFSYVNTRGKLWLGKDEEELKVLLDVPTPYLSESER 834
            +             +   F+K+D L          W+    ++ +  +D       +   
Sbjct: 813  KIKNYLNFLSHGLSALLYFEKIDPLTLLDENLIIKWISSKLQQQEKSID-------DHSS 865

Query: 835  FIKLEPEEINGIQTFLKYNLAEFQKLRNCLIILKKLAIVQQIKHRDVITMRNSFLSLGNQ 894
            F  L  E+IN I+ F  ++  E  K  N +    KL+I  +IK+ D+ T  +    LG+ 
Sbjct: 866  FKPLSAEDINNIKAFCDFSFQEIGKTNNVIQSFLKLSIFGEIKNTDLNTSYDILERLGSY 925

Query: 895  MSQKGVAKSFENTNCAWSY---DLSYYEFTRNLEYLEHSVVTLLNNFESLLA-KTTLWWK 950
             S   ++++  +      +    + YYE ++++ +++   + L +   S +  K ++W K
Sbjct: 926  FSNNEISRTLGDLQSISPHVHSSMVYYELSQDILFMKKCTLILTSKLASFIKDKLSIWLK 985

Query: 951  HFGELMELKKEWKKNFPNDKAPPSSANRNFIDTYIEGKRSKFRNKLSNQLKMSSL----N 1006
               +L+E +KE+   F        + + N    +       +R +   +LK + L    +
Sbjct: 986  KNTKLLEHRKEYSIKFLQSNEETGNLSEN-TSVFRYAWNVTYRKEEERRLKFAMLELERD 1044

Query: 1007 LKKIGGEIKTTHESIAVGINLFIEFKEQFYHDHIVKSIVD---QRIRENKQIMQQL 1059
            LKK+G EI+  HE +A   + ++  K +F  + +V+  V      ++E   ++Q++
Sbjct: 1045 LKKLGTEIRVKHEELAEEFSDYVRMKSKFNSNLLVRKFVSLNLAHLKEQSNLVQRI 1100

>KNAG0M01160 Chr13 (207940..211335) [3396 bp, 1131 aa] {ON} Anc_6.20
            YML002W
          Length = 1131

 Score =  419 bits (1077), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 328/1126 (29%), Positives = 547/1126 (48%), Gaps = 112/1126 (9%)

Query: 5    LPVLLNPLLNAIFNCPSPKTSSLKQMFSRLDDERFFILVPSTETLLQFQDLESGLELAEL 64
            +P LLNPL++A+FNC   + S L++++S L D  F +LVP T  L  + D  +   L EL
Sbjct: 1    MPELLNPLVDAVFNCQDVEASPLRKVYSSLHDIPFILLVPPTFALWYYDDRNTKFPLHEL 60

Query: 65   CYHYDFVASHIVVI------KDPTKDVPDQRSIYNTDFTTLNGRKLSIRYRNSTIVTGDG 118
            C+  +FV+SHI+        K    D+   R++    F T NG+ ++  +   ++ T DG
Sbjct: 61   CHSPEFVSSHILTRYSGKDNKPIDTDLSRLRAVREAKFCTFNGKIINGLFSKQSLYTTDG 120

Query: 119  FTERRKITIKEINLLPTFNDYLKGSNYTPILHISMPL--------CGDLVPLDELQVFSK 170
            F+ R    I +   L  F +YL+GS+   +++I  PL        C DL     L + + 
Sbjct: 121  FSFRSTRRILKYETLDHFQNYLQGSSTFILIYIDQPLIDTNRLLKCEDLDCFPNLTINTT 180

Query: 171  VAGNKYSKQEQAPLPFDEEQKKVLYFEQRIQSISDVAERVALTFHLTKARIKKAISVIGI 230
             +    +    A +P    Q+  L     I +  +   R     +  +    +++ + G 
Sbjct: 181  PSTRSLANLSSAEVP---PQRNPL-LNSMIHAQYNWKFRAVFQNYRKEITQSESMLIPGF 236

Query: 231  RTEWLNTRDSIRQIISLDKRLNHLEDLDAMIYDYVELKLFTDIQQQL--SEIVEDQELEH 288
            R     T D I     LD   + +  +  +I +YVE  ++ D+ Q L      E ++ + 
Sbjct: 237  R----KTIDKIYD--GLDNSFHTIPTIRQLIQEYVEQNVYDDVWQVLINRNNAEGEKEKQ 290

Query: 289  RFDFKALRSISLNQVPTNFYPKDEKSFSLASVVELEKSVNDALEYLKSIDLKTTHSGKLE 348
                   R ISL+Q+ T+FY      F L  +V+LEK+++ A +  +++ +  T+  K  
Sbjct: 291  SESSDIFRFISLDQLDTDFYKAKFSKFYLKDIVQLEKNISKATKSFENLSVTHTYVEKCR 350

Query: 349  VLSTTMRLLSREINGIS-----TDADTLLSLFVLLICRSQVTGLVRTLTYLTNFEISETS 403
            VL  T+++LS+ +  +        ADTL+SLF+LLI R+++  +   L YL NF   E S
Sbjct: 351  VLVETLQILSKPVKRVGGYQVPITADTLVSLFILLIKRTKMKNIRCHLYYLQNFHQDENS 410

Query: 404  IKFGLQGYVLSTFEAALSFFH-----QDTVDSLTKKCASNKKIWASIQKHSKVEAELL-- 456
            IKFGL GY +ST EA + +       ++ +D + K  A+ ++    + +   V  E L  
Sbjct: 411  IKFGLLGYAISTLEAVICYLETIETDKERLDCIEKNDANLEEFLTLLTRSKCVSNEGLDL 470

Query: 457  ---SSNLRIRTDSGESLLSICIQSHNNEVLTTLLA-NFESEFPLEDILDDRDFALSTLLI 512
               S N R R   G S LS+CI +  N++   LL+ N+ES F  ED+L+D+    +TLL+
Sbjct: 471  SKYSHNFRYRNGDGNSTLSLCIINFKNDIFFELLSENYESYFAFEDLLEDQTTEGTTLLM 530

Query: 513  QALQVQNSQAAAILSEIILKSCTESEVRSYLNSPNLHNRITAHYIMQDISLLESVGRYFN 572
            Q+LQ  N +    L++I+LK+ TE E+  Y    + + R   HYI    +LL+ +G+Y  
Sbjct: 531  QSLQHSNHEITEYLTDIMLKNSTEEELYYYCGKRDKYKRNIGHYICGQQTLLQKIGKYIK 590

Query: 573  WEHKDINGHTPLFAVFRSYDAVNYDEIVTKVLDQVVKWYAN-NNKPFNFKIHEDPKGNTL 631
            W+ KD  G TPL  +FRSYD   YD +V       V+WY+   N  F F+ H D KGNTL
Sbjct: 591  WDSKDCTGQTPLCVIFRSYDQAFYDVMVETSFAIAVEWYSTVKNSKFCFRDHTDSKGNTL 650

Query: 632  LHVMKSGIESLLKLPDVNVNKPDSKGLTPLMIYSRYNRITNIETIMKDERLLCDLVQQPL 691
            LH++K  I  LL+ PDV++NK +S+GL+PL   + Y+R  N+E ++KD RL         
Sbjct: 651  LHIIKCNISFLLQSPDVDINKVNSQGLSPLTNNAMYDRGENVEALLKDPRL--------- 701

Query: 692  VMTSLDFTKNPKVTKT-----------------ILDATF-----NREPVVIHSLRFEERK 729
            + +S DF K    TK+                 I+ + F     N+  VV+ S   E+ +
Sbjct: 702  IFSSFDFLKQYPNTKSAPILSHYCLDNEAPFRNIIASHFDFRISNKRSVVLTSRSKEDAQ 761

Query: 730  WKIGIFSEGIFKKYSLDLIQYYLRYLKIMYPCSFHPVQLLTNELR----------LLGIY 779
              IG  SE     + L  ++   R L   +P +F P++ L +EL           L+   
Sbjct: 762  ELIG--SEA----FELKNLKALFRLLLKQHPFTFFPLEELLDELSVVEKTASSRSLMKSS 815

Query: 780  GVPGVLRLQSYHTFKKLDM-LFSYVNTRGKLWLGKDEEELKVLLDVPTPYLSESERFIKL 838
                VL+  +Y     ++M L      +    L +   + KV +D     L    +  K+
Sbjct: 816  FCSKVLKKLTYCLDSMVEMELLPTAALQSVALLERHIAKEKVTVD--EEKLKRRSKDKKM 873

Query: 839  EPEEINGIQTFLKYNLAEFQKLRNCLIILKKLAIVQQIKHRDVITMRNSFLSLGNQMSQK 898
            +PE I  I TFLKY L    KL+  +I L+K +I+ ++K +D+   +N   +LG ++S K
Sbjct: 874  QPESIGTITTFLKYILESLLKLKGTIIELRKFSILSKLKSKDISESKNIVCTLGAEVSSK 933

Query: 899  GVAKS---FENTNCAWSYDLSYYEFTRNLEYLEHSVVTLLNNFESLLA-KTTLWWKHFGE 954
             + ++   +   +  +  + S+      + + E  + +++N+ + LL  K   WWK +G+
Sbjct: 934  KIGRAMVRYSTIDNKFLGEQSFDLLVFQIHFFESCLSSIINSIDHLLHLKIPEWWKCYGQ 993

Query: 955  LMELKKEWKKNFPND---KAPPSSANR------------NFIDTYIEGKRSKFRNKLSNQ 999
            L+EL KE       +   K  P+++N               + T+IEGKR K + +    
Sbjct: 994  LLELSKEDPSVLARESDHKQTPNASNNVGTSTTDHTSGMGVLGTFIEGKRIKNQERTRAA 1053

Query: 1000 LKMSSLNLKKIGGEIKTTHESIAVGINLFIEFKEQFYHDHIVKSIV 1045
            +      LK +  EI T +  + +   +FI F+ +F H  +++  V
Sbjct: 1054 ISDLQRRLKLLDNEIDTNNTLVVIEYCIFINFQSKFIHSAMLEKWV 1099

>CAGL0L07634g Chr12 complement(840409..843801) [3393 bp, 1130 aa] {ON}
            some similarities with uniprot|Q04257 Saccharomyces
            cerevisiae YML002w and some similarities with
            uniprot|Q04257 Saccharomyces cerevisiae YML003w
          Length = 1130

 Score =  404 bits (1038), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 320/1129 (28%), Positives = 550/1129 (48%), Gaps = 102/1129 (9%)

Query: 15   AIFNCPSPKTSSLKQMFSRLDD-ERFFILVPSTETLLQFQDLESGLELAELCYHYDFVAS 73
            AI NC  P +S LK+++++L   +++ ILVP TE LL + D ES  EL +LCY  +F ++
Sbjct: 19   AICNCGEPNSSPLKKLYTQLGKKDKYLILVPPTELLLYYSDKESNSELHDLCYTPNFASA 78

Query: 74   HIVVIKDPTKDVPDQRSI---------YNTDFTTLNGRKLS-IRYRNSTIVT----GDGF 119
            HI+++     +V +             Y+  F     +    I ++N  I      GD  
Sbjct: 79   HILLLDATDTEVNNGDEAVLIKNIEKRYDVHFIKAMDQSWKFINWKNRVIYEFNKLGDQI 138

Query: 120  TERRKITIKEINLLPTFNDYLKGSNYT-PILHIS---------MPLCGDLVPLDELQVFS 169
              R KI   +I  +P FN+Y+K ++ T  I++I            L  D+  L    + S
Sbjct: 139  KNRAKIL--DIESIPIFNNYMKTTDNTITIMYIDDVFLNGTLECNLRSDIDLLRSPSMRS 196

Query: 170  KVAGNKYSKQEQAPLPFDEEQKKVLYFEQRIQSISDVAERVALTF--HLTKARIKKAISV 227
                 + S   +    ++  + K  +      SI  V +  +  F  H  K R+      
Sbjct: 197  IPTAKRPSLINKKSTDYENSKSKATF-----DSILRVNKHWSSKFEQHFQKFRLLANQDD 251

Query: 228  IGIRTEWLNTRDSIRQIISLDKRLNHLEDLDAMIYDYVELKLFTDIQQQLSEIVEDQELE 287
            + I   + N  + + + +  D    ++ DL  +IY+YVEL LF DI + +  + ++ E+ 
Sbjct: 252  LPIDV-FHNIIEEMHEEMVSDNLFKNIVDLRNIIYEYVELNLFDDIWKMILRMNKEVEI- 309

Query: 288  HRFDFKALRSISLNQVPTNFYPKDEKSFSLASVVELEKSVNDALEYLKSIDLKTTHSGKL 347
               D     +IS+ QV + F   +   F L +V+  E+++ +A + L+ I+  + +  K 
Sbjct: 310  ---DLNPFGNISIYQVDSEFLSTEYSKFFLENVITAERNIKEASKSLQKIESASNYKSKA 366

Query: 348  EVLSTTMRLLS--REINGIST--------------DADTLLSLFVLLICRSQVTGLVRTL 391
             +L  T+R L+  +E +G S+              DAD L++LFVL+ CR+Q+  L   L
Sbjct: 367  NILILTLRTLTGNKENDGYSSKNDDGNLSFFPLAIDADRLMNLFVLVTCRAQIKNLKCHL 426

Query: 392  TYLTNFEISETSIKFGLQGYVLSTFEAALSFFHQ----DTVDSLTKKCASNKKIWASIQK 447
            +YL NF  +++  KFG+ GY LST EA + +F Q    +    L   C SN+++   +  
Sbjct: 427  SYLQNFYNNDSDTKFGILGYALSTLEAVVCYFEQLKEKENYRKLIDFCNSNERLVKVLSS 486

Query: 448  HSKVEAELL-------SSNLRIRTDSGESLLSICIQSHNNEVLTTLLANFESEFPLEDIL 500
              K E             +LR R   G+SLL++CI    N+ L  +L  +E+ FP+ED+L
Sbjct: 487  TKKYETNAALYFLRKYEGSLRYRDSLGQSLLALCIIHGRNDFLYHILNEYETLFPIEDLL 546

Query: 501  DDRDFALSTLLIQALQVQNSQAAAILSEIILKSCTESEVRSYLNSPNLHNRITAHYIMQD 560
             D     STLLIQA++  N  +A++L  I+  +CTE E+ +Y+N  +++ R   H++  +
Sbjct: 547  ADESIDGSTLLIQAVKHDNQYSASLLLNILKDNCTEIELIAYINRHDINKRTAGHFLTNE 606

Query: 561  ISLLESVGRYFNWEHKDINGHTPLFAVFRSYDAVNYDEIVTKVLDQVVKWYANNNKPFNF 620
            + +L+ +G+Y NW  KD  G TPLF +FRSYD  NYDE+V++ ++    WY  N K FN+
Sbjct: 607  LEVLKLMGKYINWVQKDNAGQTPLFTIFRSYDQDNYDEMVSQSMEYATNWYGLNGKNFNY 666

Query: 621  KIHEDPKGNTLLHVMKSGIESLLKLPDVNVNKPDSKGLTPLMIYSRYNRITNIETIMKDE 680
              H D KGNTLLH++K  +  LL    +NVN  +  G TPLM   RY R  NI  ++ D 
Sbjct: 667  LDHVDKKGNTLLHILKCNLPILLADKHINVNATNRSGQTPLMTSIRYKRTENIRDLLCDP 726

Query: 681  RLLCDLVQQPLVMTSLDFTKNPKVTKTILDATFNREP---VVIHSLRFEERKWKIGIF-- 735
            RL  D+ Q+   +T+ DF+K+ ++T  + +      P   V  H+L++   +W + +   
Sbjct: 727  RLRVDITQKNNALTAFDFSKDDEITHLLGEHELLNSPWLAVYAHTLKYTNSRWNLSLTVK 786

Query: 736  --SEGIFKKYSLDLIQYYLRYLKIMYPCSFHPVQLLTNELRLLGIYGVPGVLRLQSYHTF 793
                     ++L  ++  LR +       F PVQ L  +L          ++R++     
Sbjct: 787  LKDAPKTTNFTLKTLRGILRVVIKNNMTVFLPVQELVEDLISFNRIRFSELMRIKVLEML 846

Query: 794  KKLDMLFSYVNTRGKLWLG--KDEEELKVLLDVPTPYLSESERFIKLEPEEINGIQTFLK 851
              +    S +     L L   + EE     + +      ++ +   + PE+I+ IQ FLK
Sbjct: 847  PFISFCLSALVHIKVLDLNVFQTEENAIKWVKMNGSVDKKTNQTSDITPEDISMIQNFLK 906

Query: 852  YNLAEFQKLRNCLIILKKLAIVQQIKHRDVITMRNSFLSLGNQMSQK----GVAKSFENT 907
            +N+ E ++ +N L I +KL++  ++K +D++    +++++ +Q+S K     +  S E+T
Sbjct: 907  FNITEIERTKNKLEIAEKLSLFSRLKSKDLLNSNENYVTIVSQLSSKRFRSTLKYSAEDT 966

Query: 908  NCAWSYDLSYYEFTRNLEYLEHSVVTLLNNFESLLAKTTL---WWKHFGELMELKKEWKK 964
                    +       + YL+     L N+  S+   TT+   WW  +GEL+   K + +
Sbjct: 967  KLLSVR--AEKALLSKITYLKICAQKLHNHILSI--TTTMISNWWHIYGELLNAHKHYTR 1022

Query: 965  NFPNDKAPPSSANRNF-IDTYIEG-KRSKFRNKLSNQLKMSSLNLKKIGGEIKTTHESIA 1022
             FP + A  ++ NR+  +   I   KR K   +LS ++K  +  L  +G +IK  HE  A
Sbjct: 1023 AFP-ELANVTTENRDLALHRMISNPKRIKLEERLSEKIKDITEQLNSVGHDIKQMHELAA 1081

Query: 1023 VGINLFIEFKEQFY-------------HDHIVKSIVDQRIRENKQIMQQ 1058
              ++ FI+ K +F               +HI K  +    +ENK + +Q
Sbjct: 1082 EEVSRFIDLKTKFTLEYALQSYLTISKQEHIEKDRLHWEFQENKTVFKQ 1130

>YML002W Chr13 (264541..266754) [2214 bp, 737 aa] {ON} Putative
            protein of unknown function; expression induced by heat
            and by calcium shortage
          Length = 737

 Score =  370 bits (951), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 239/720 (33%), Positives = 386/720 (53%), Gaps = 43/720 (5%)

Query: 361  INGISTDADTLLSLFVLLICRSQVTGLVRTLTYLTNFEISETSIKFGLQGYVLSTFEAAL 420
            +N ++ DADTL+SLFVL++CRS+   L   L YL NF  + +S KFG+ GY +ST EA +
Sbjct: 12   LNNMTMDADTLISLFVLVVCRSEQKHLKSHLYYLQNFSNNSSSTKFGILGYAVSTLEAVV 71

Query: 421  SFF-----HQDTVDSLTKKCASNKKIWASIQKHSKV-EAELLSSN---LRIRTDSGESLL 471
             +F     +   V      C   K +   +   +   E E L++    L  R + G+S+L
Sbjct: 72   CYFEDFNKNTGNVAKANTLCEKTKNLLDKLSCENPTNEVEDLATYKDILTYRNEQGQSIL 131

Query: 472  SICIQSHNNEVLTTLLANFESEFPLEDILDDRDFALSTLLIQALQVQNSQAAAILSEIIL 531
            SICI +H N +L  +L+ +E++FP+ED+L+D     STLLI++++  N +AA +L +I+L
Sbjct: 132  SICITNHKNYILLDILSEYENDFPVEDLLEDETIDGSTLLIESIKAGNLEAAKVLIKIML 191

Query: 532  KSCTESEVRSYLNSPNLHNRITAHYIMQDISLLESVGRYFNWEHKDINGHTPLFAVFRSY 591
             +CTE E+ SY+N  + + R  AHY+  ++ +L+S+G Y +W+ K+ +G TPLF++FRSY
Sbjct: 192  FNCTEEELVSYINKTDKYARTVAHYLTHEMDILKSIGNYIDWKRKNSSGQTPLFSIFRSY 251

Query: 592  DAVNYDEIVTKVLDQVVKWYANNNKPFNFKIHEDPKGNTLLHVMKSGIESLLKLPDVNVN 651
            D  NY+E+V    D    WY  +N  F++  H D KGN+LLHV+K+ I  LL+L  +++N
Sbjct: 252  DQPNYEEMVKTAFDIANTWYRKHNSLFDYLDHTDNKGNSLLHVLKTNIPILLQLTKLDIN 311

Query: 652  KPDSKGLTPLMIYSRYNRITNIETIMKDERLLCDLVQQPLVMTSLDFTKNPKV-----TK 706
            + + KGLTPLM+Y +Y R++NI+ I KD RL+ + VQ     T  D+ K+  V      +
Sbjct: 312  EENYKGLTPLMVYVKYKRLSNIDAITKDRRLILEKVQNSTFFTCFDYAKDHSVLSKIGER 371

Query: 707  TILDATFNREPVVIHSLRFEERKWKIGIFS----EGIFKKYSLDL--IQYYLRYLKIMYP 760
             + D+ F    +  HSLR+        I S    E  F    +++  IQ  LR +    P
Sbjct: 372  GVKDSLFGL--IYFHSLRYHNLNATTNITSVSNAEKPFATTVINMKTIQGLLRSILKDNP 429

Query: 761  CSFHPVQLLTNELRLLGIYGVPGVLRLQSYHTFKKLDMLFSYVNTRGKL--WLGKDEEEL 818
             +F P+    +E+  L    +  + +        +L   F+ +    K+   L  DE  +
Sbjct: 430  FTFLPLNTYIDEISHLNRSDLTIIGKTDVTSLLHQLTNCFNVLLFLKKIPENLFTDEASI 489

Query: 819  KVLLDVPTPYL----SESERFIKLEPEEINGIQTFLKYNLAEFQKLRNCLIILKKLAIVQ 874
               + + T       S  E    +EPEEIN IQ+FL++N  E    +  L IL+K+ I  
Sbjct: 490  LYWMRINTSKRNQKPSGKENPKTMEPEEINMIQSFLRFNFDEISSFKASLNILRKVLIFI 549

Query: 875  QIKHRDVITMRNSFLSLGNQMSQKGVAKSFEN--TNCAWSYDLSYYEFTRNLEYLEHSVV 932
             +K  D          +G ++     + +F+   TN     +LS      N+ +LE   +
Sbjct: 550  NLKSDDFEDAYKGLNEMGRKLINSEASSAFKGIITNHNMFSELSLAALLENVRFLEQCTI 609

Query: 933  TLLNNFESLL-AKTTLWWKHFGELMELKKEWKKNFPNDKAPPSSAN---RNFIDTYIEGK 988
             L +  + +L  K   WWKH+GE + L K ++K FPN   P S+++   R  +  +IE K
Sbjct: 610  QLSSFVQIILFEKIPNWWKHYGEFLALHKSYRKAFPNMVKPKSASDTSSRAPLGGFIETK 669

Query: 989  RSKFRNKLSNQLKMSSLNLKKIGGEIKTTHESIAVGINLFIEFKEQFYHDHIVKSIVDQR 1048
            R +   +L+ Q+K SS  LK++G EI   HE +A  ++ ++EF+         K+ +DQR
Sbjct: 670  REQSEQRLAVQIKASSKMLKELGSEIFVAHERLAEELSNYMEFR---------KACLDQR 720

>NCAS0H00820 Chr8 (148184..151624) [3441 bp, 1146 aa] {ON} Anc_6.20
           YML002W
          Length = 1146

 Score =  345 bits (885), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 248/791 (31%), Positives = 414/791 (52%), Gaps = 111/791 (14%)

Query: 3   YHLPVLLNPLLNAIFNCPSPKTSSLKQMFSRLDDERFFILVPSTETLLQFQDLESGLELA 62
           YHLP LLNPLLN+IFNCP+P  S LK++++ L D+ F +LVP TETLL + D ++ ++L 
Sbjct: 4   YHLPTLLNPLLNSIFNCPNPSNSPLKKLYASLKDKSFILLVPPTETLLNYTDTKTKIQLE 63

Query: 63  ELCYH-YDFVASHIVVIKDPTKDVPDQ----------RSIYNTDFTTLNGRKLSIRYRNS 111
           +LCYH  DF+ +HI++   P KD              R      F TLNG  + +++RN+
Sbjct: 64  DLCYHNVDFIGAHILL---PPKDSISSSSSTIDDGYTRLASIEQFDTLNGDNILVKWRNN 120

Query: 112 TIVTGDGFTERRKITIKEINLLPTFNDYLKGSNYTPILHISMPLCGDLVPL-DELQVFSK 170
            +V   G   R+KI I+ I +LP FNDYL+GS Y  ++HI  PL  D++ L DEL+ F  
Sbjct: 121 FLVLLSGSPNRQKIKIERIQVLPNFNDYLQGSTYFILVHIDKPLMKDVIRLNDELECFDT 180

Query: 171 VA---GNKYSKQEQAPLPFDEEQKKVLYFEQRIQSISDVAERVALTFHLTKARIKKAISV 227
           +     +  S  +  PL  D  Q +   FE  I +     +R                  
Sbjct: 181 LTLHDNDGDSSPDARPLIQDMSQHERSQFENIINTNDTWNKRFK---------------- 224

Query: 228 IGIRTEWLNT-RDS----------IRQIISL-------DKRLNHLEDLDAMIYDYVELKL 269
                +W+N  +DS           +QI+++       +K       L  +I++Y+E+ L
Sbjct: 225 -----DWMNEYKDSTTAEEPNETLFKQIVAVAYNELKSNKIFKGFGHLRRLIHEYLEINL 279

Query: 270 FTDIQQQLSEIVEDQELEHRFDFKALRSISLNQVPTNFYPKDEKSFSLASVVELEKSVND 329
           +  +  Q++ +     L+       +++IS+ ++   FY    + F L  + +LEK++  
Sbjct: 280 YDHLWLQITTLCA---LDDETKGTRIKNISIEEIDDKFY----EMFPLDFITKLEKNMVR 332

Query: 330 ALEYLKSIDLKTTHSGKLEVLSTTMRLLSREINGIS-------------TDADTLLSLFV 376
           +   +  ++ K + + K E L  T+++L+   N I               DADTL++L +
Sbjct: 333 STNSINKLNGKNSFNEKSENLIATLQILTNMDNPIGELNQENEKGANNLIDADTLINLLI 392

Query: 377 LLICRSQV--TGLVRTLTYLTNFEISETSIKFGLQGYVLSTFEAALSFFHQ----DTVDS 430
           L+ICRS++    L R + YL  F   E  I FG+  Y +STFE  +  F      D + S
Sbjct: 393 LIICRSEINIVDLKRNIFYLKKFNYDENLINFGILSYTISTFEIVIYSFENIVEYDKLKS 452

Query: 431 LTK------KCASNKKIWASIQKHSKVEAELLSSNLRIRTDSGESLLSICIQSHNNEVLT 484
            ++      K    KK+  +I+             L  R+D+GES+L  CI ++  E   
Sbjct: 453 YSEIIEKLIKVDDLKKVPKTIK---------WEQFLTFRSDTGESILFSCITNNQTEKFL 503

Query: 485 TLLANFESEFPLEDILDDRDFALSTLLIQALQVQNSQAAAILSEIILKSCTESEVRSYLN 544
            LL ++E  F +++ILDD +   +TLL+QAL  +N + + +L  ++L++C+  ++  Y+N
Sbjct: 504 DLLVDYEEIFSMDNILDDANVEGTTLLMQALIYRNFKISMVLINLLLRNCSNKQIMEYIN 563

Query: 545 SPNLHNRITAHYIMQDISLLESVGRYFNWEHKDINGHTPLFAVFRSYDAVNYDEIVTKVL 604
             +  NR   HY++ ++ +L+ +G+Y NW+ +D+ G TPLF +FR YD  NYDE+++ V 
Sbjct: 564 KIDKFNRNVGHYLINELEILKIIGKYVNWKQRDLVGRTPLFTIFRGYDQPNYDEVISTVF 623

Query: 605 DQVVKWYANNNKPFNFKIHEDPKGNTLLHVMKSGIESLLKLP-----DVNVNKPDSKGLT 659
           D  + WYA N   F    H D K N++LH+++S I+ L         ++++NK + KG T
Sbjct: 624 DITLNWYAENGLKFQMSDHYDLKDNSILHILRSNIDILFTYSKRNHFEIDINKRNYKGFT 683

Query: 660 PLMIYSRYNRITNIETIMKDERLLCDLVQQPLVMTSLDFTKNPKVTKTIL------DATF 713
           PLMIY +Y+R++N++ I+ D+RLL +  Q+ L  T  D+  +  ++  +       +  F
Sbjct: 684 PLMIYVKYHRLSNVKLILGDDRLLFNRYQRELYTTCFDYATDSTISNELGKHALQNNTVF 743

Query: 714 NREPVVIHSLR 724
            R  + IHSL+
Sbjct: 744 GR--IYIHSLK 752

 Score = 79.7 bits (195), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 67/228 (29%), Positives = 107/228 (46%), Gaps = 22/228 (9%)

Query: 838  LEPEEINGIQTFLKYNLAEFQKLRNCLIILKKLAIVQQIKHRDVITMRNSFL----SLGN 893
            L+PE+IN IQ+FLK+N+ E   +   +  L+KL     +K  DV   R +F+    S+ N
Sbjct: 888  LKPEDINIIQSFLKFNVKELYNVLLNVKTLEKLLNFIHLKSIDVKESRLAFVHLVKSIKN 947

Query: 894  QMSQKGVAKSFENTNCAWSYDLSYYEFT---RNLEYLEHSVVTLLNNFESLL-AKTTLWW 949
                +   +S E      S +  YY  T     L++L+   + L  N E +L  +   WW
Sbjct: 948  DQIAQATNRSLEPIIEMQSLENQYYNNTLIRDELDFLKACTLILTGNIEDILRTQIPNWW 1007

Query: 950  KHFGELMELKKEWKKNFPNDKAPPSSA--------------NRNFIDTYIEGKRSKFRNK 995
            K +GEL+EL K + K FP +    + A              N       IE +R+K   K
Sbjct: 1008 KLYGELLELNKHYNKLFPPNHYNNTLATDNQHSAEVSNDVNNGGVFGGLIENQRNKAVKK 1067

Query: 996  LSNQLKMSSLNLKKIGGEIKTTHESIAVGINLFIEFKEQFYHDHIVKS 1043
            L   +     +L+ +G EI   HE +A  +N ++EFK  F+   I+++
Sbjct: 1068 LKTDIDQLKYSLEILGNEIFRKHEMLAEELNKYMEFKGVFFKKAIIRN 1115

>NDAI0D00800 Chr4 (177862..181443) [3582 bp, 1193 aa] {ON} Anc_6.20
            YML002W
          Length = 1193

 Score =  343 bits (879), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 325/1196 (27%), Positives = 571/1196 (47%), Gaps = 177/1196 (14%)

Query: 3    YHLPVLLNPLLNAIFNCPSPKTSSLKQMFSRLDDERFFILVPSTETLLQFQDLESGLELA 62
            YHLP LLNPLLNA+FNCP P  S  K++F+ L +++F +LVP T TLL + D    L L 
Sbjct: 4    YHLPTLLNPLLNAVFNCPDPSHSPFKKLFTTLKNQQFILLVPPTSTLLNYTDSYYKLSLN 63

Query: 63   ELCYH-YDFVASHIVVIKDPTKDVPDQRSIYNTD-FTTLNGRKLSIRYRNSTIVTGDGFT 120
            ELCYH  DF+ SHI+   +      D  +  + + F  LNG K  I+++++ I T   F+
Sbjct: 64   ELCYHNSDFLGSHILTWSNAIDSNKDSTTTNDDEEFDNLNGNKFIIKWKHNIIFTRGNFS 123

Query: 121  ERRKITIKEINLLPTFNDYLKGSNYTPILHISMPL-CGDLVPLDELQVFSKVAGNKYSKQ 179
              ++  I +I+ L  FNDY  GS    ++ I  P+    L+  D L+       +  S++
Sbjct: 124  NDQRFKILKIHPLTNFNDYFHGSKEFFLIFIDKPITVSSLIANDSLKCLLPNTRDLKSQE 183

Query: 180  EQAPLPFDEEQKKVLYFEQRIQSISDVAERVALTFHLTKARIKKAISVIGIRTEWLNTRD 239
            ++ PL  D  Q+    FE  +       E   L F +     K   S +    +    R+
Sbjct: 184  KETPLVQDLSQQSKSSFENDLNK----NEAWNLKFGILSNNYKIESSELEPNHKLF--RE 237

Query: 240  SIRQ-IISLDKRLNHL-------EDLDAMIYDYVELKLFTDIQQQLSEIVEDQELEHRFD 291
             + +  I +D +           + L  + +DY+E  L+ +I  ++ +++ +    +  D
Sbjct: 238  LVNEAFIEIDSKKFFQKKKNFTSDQLFQLTHDYMERHLYDEIWSRIWKMMMNSVKNYADD 297

Query: 292  FKA---LRSISLNQVPTNFYPKDEKSFSLASVVELEKSVNDALEYLKSIDLKTTHSGKLE 348
             KA   ++  S+ ++  NFY      F L  V  LEK++  ++  +  +    +++ K  
Sbjct: 298  QKAQHLIKHFSIVEIDPNFYD----IFPLKFVPMLEKNLKHSVTCINKLKSTKSYTEKST 353

Query: 349  VLSTTMRLLS-----------REINGISTDADTLLSLFVLLICRSQVT--GLVRTLTYLT 395
            +L  ++++++           +  +G   DAD LL+L  L+I +S +T   L   L YL 
Sbjct: 354  ILIESLQIITDSNTGGEESKDKNKSGYLIDADNLLNLLTLVILQSNITLHDLKANLYYLK 413

Query: 396  NFEISETSIKFGLQGYVLSTFEAALSFFHQDTVDSLTKKCASNKKIWASIQKHSKVEAEL 455
             F   E+S  FG+  Y ++TF   +S   ++ +D            W  +++ S +  EL
Sbjct: 414  YFSTDESSSSFGILNYTIATFHM-VSHVLENVID------------WDRLKEKSDLIEEL 460

Query: 456  LSSN----------------LRIRTDSGESLLSICIQSHNNEVLTTLLANFESEFPLEDI 499
            + ++                L  R  +GESLL++ I +  N+  T  L  +E    ++ I
Sbjct: 461  IMTDDLSTLSSTFENDKKTLLMYRNSNGESLLALSIINKQNKKFTQYLIEYEDILNMDII 520

Query: 500  LDDRDFALSTLLIQALQVQNSQAAAILSEIILKSC-TESEVRSYLNSPNLHNRITAHYIM 558
             +D+    STLL+QA++  N +AA IL +++ ++C  + E+ SY+N  ++HNR   HY++
Sbjct: 521  SNDQSMDSSTLLLQAIRSNNFEAAIILVKLLFQNCRNQKELISYINQVDIHNRNIGHYLV 580

Query: 559  QDISLLESVGRYFNWEHKDINGHTPLFAVFRSYDAVNYDEIVTKVLDQVVKWYANNNKPF 618
             ++++L+ +G++ NW+ KD+NG TPLF +FRSYD  NYDE+V +V    +KWYA NN  F
Sbjct: 581  INLTILKIIGQFINWKQKDVNGRTPLFTIFRSYDQSNYDELVCQVFQIAIKWYAANNLKF 640

Query: 619  NFKIHEDPKGNTLLHVMKSGIESLL------KLPDVNVNKPDSKGLTPLMIYSRYNRITN 672
                H+D  GN+LLH++++ I  LL       +P +N+NK + KG TPLM+Y +Y R  N
Sbjct: 641  QMNDHDDSNGNSLLHILQNNISILLDYAKDQNIP-INLNKMNCKGFTPLMMYFKYKRYDN 699

Query: 673  IETIMKDERLLCDLVQQPLVMTSLDFTKNPKVTKTILDATFNREPVV--IHSLRFEERKW 730
            I  I+K+E+L+ +  Q P  +   D++ +  +   I +   +   +   I  L  +++  
Sbjct: 700  IRMIIKEEKLIFNKFQSPNFIDCFDYSVDSSIMNDIGEFLLSNGQLFGKIIVLSLKKQMS 759

Query: 731  KIGIFSEGIFKKYSLDL-------------IQYYLRYLKIM---YPCSFHPVQLLTNE-- 772
             +     G++  Y++ +                 +++LKIM   Y  SF P+  L NE  
Sbjct: 760  TVPSLPRGLYINYTILIDEADKSTLTKTMKFTSLVKFLKIMKRKYAISFLPLDTLLNESQ 819

Query: 773  ------------LRLLGIYGVPGVLRLQSYHTFKK----LDMLFSYVNT----------- 805
                        LR + +  +   LR++ +   K+    LD+L  + ++           
Sbjct: 820  SFLDKKSKNNNNLRTIPLRYIEK-LRIRRF--LKRLNTCLDVLLHFDDSTIATPLLLSET 876

Query: 806  RGKLWLGKDEEELKVLLDVPTPYLSESERFI------KLEPEEINGIQTFLKYNLAEFQK 859
                W+  +E +L+     P+   S+ E  +      +L+PE IN IQ FLK+NL E   
Sbjct: 877  ELLEWISIEESKLRRSSTTPSAK-SKLENAMGEKKKKELKPENINIIQNFLKFNLNELNT 935

Query: 860  LRNCLIILKKLAIVQQIKHRDVITMRNSFLSLGNQMSQKGVA----KSFENTNCAWSYD- 914
            +   L +L KL I   +K  D+   +  F  L   ++ K V     KSF   + +  YD 
Sbjct: 936  ISMNLKVLSKLVIFMNLKTLDIHDAQIRFNGLVKGLNNKEVPSIIEKSFNVIDSS-RYDD 994

Query: 915  ---LSYYEFTRNLEYLEHSVVTLLNNFESLLA-KTTLWWKHFGELMELKKEWKKNFPN-- 968
               +       ++ +     + L+++ E+++  K   WWK +GEL+EL K + KNFPN  
Sbjct: 995  DKGVLLESLHEDISFFNECTLKLIHDVENIIKIKIPNWWKLYGELLELNKYYHKNFPNCV 1054

Query: 969  -------------------------DKAP---------PSSANRNFIDTYIEGKRSKFRN 994
                                       +P          +++N       IE +++K   
Sbjct: 1055 VHARRTDLLSGNNANTNTNTNTNTNTNSPQRLHHHSEHQNNSNNGVFANLIENQKNKLER 1114

Query: 995  KLSNQLKMSSLNLKKIGGEIKTTHESIAVGINLFIEFKEQFYHDHIVKSIVDQRIR 1050
            K S+ +  +   L+ +G  +   HE +A  +N ++EFK +F+  +I+K+ V + I+
Sbjct: 1115 KTSHHIDETISLLESLGSGLLNKHEHLAEELNRYMEFKNRFFGRNIMKNFVGEDIK 1170

>TBLA0A07260 Chr1 (1807831..1811445) [3615 bp, 1204 aa] {ON}
           Anc_6.20 YML002W
          Length = 1204

 Score =  298 bits (762), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 244/764 (31%), Positives = 386/764 (50%), Gaps = 107/764 (14%)

Query: 43  VPSTETLLQFQDLES-----------GLELAELCYH-YDFVASHIVVIKDPTKDVPDQRS 90
            P T+ LL + D  +              L +LC + YDF+ASHI++    +K + + + 
Sbjct: 42  APPTDILLNYLDSSNITPRNPYNGSNAKPLEDLCMNSYDFIASHILLYD--SKVIKNDQC 99

Query: 91  IYNTDFTTLNGRKLSIRYRNSTIVTGDGF----------------TERRKITIKEINLLP 134
           +      ++NG+ ++I+      VTG+G                 T ++ + I +++L  
Sbjct: 100 V----MESINGKTITIKR-----VTGNGALNNGEMLVITPSKNYNTPKKMLKIIKMDLWH 150

Query: 135 TFNDYLKGSNYTPILHISMPLCGDLVPLDELQVFSK--VAGNKYSKQEQAPLPFDEEQKK 192
            FN YL+G    PI +I  PL  +++  + L  F +  +   +YS   Q   P ++ +  
Sbjct: 151 NFNSYLQGMENYPIWYIDYPLYPNIIKNEFLTAFDRKLIETEQYSDIAQ---PVNDLENT 207

Query: 193 VLYFEQRIQSIS----DVAE-------------RV----------ALTFHLTKAR-IKKA 224
                 +I++IS    D+++             RV          A T H+ +A  + +A
Sbjct: 208 TKDQNHKIRNISKLEPDISQSDRGGFTKLIKDDRVIWQPLINSYRATTKHIEQAEGLPQA 267

Query: 225 ISVIGIRTEWLNTRD---SIRQIISLDKRLNHL--EDLDAMIYDYVELKLFTDIQQQLSE 279
           I            RD    + + +  +KR N L  ++L  +IY+++E+KL  DI  ++S 
Sbjct: 268 IDENQTDVNIEMVRDINCDLFEQLKDEKRYNFLSHDNLMELIYEFIEIKLHDDIWGRISF 327

Query: 280 IVEDQELEHRFDFKALRSISLNQVPTNFYPKDE-KSFSLASVVELEKSVNDALEYLKSID 338
               +  E  FDF  L +IS+N++  NFY  +  K+F L  +V +EK ++ A+ Y +   
Sbjct: 328 ----KFTESDFDFSKLSNISVNKLLLNFYSTNNFKNFKLHDIVMMEKKISRAVTYFQKFI 383

Query: 339 LKTTHSGKLEVLSTTMRLLSREINGISTDADTLLSLFVLLICRSQVTGLVRTLTYLTNFE 398
              T   K   L  T+++L+  IN + TDADTL+ L  ++ICR +V  L   L YL NF 
Sbjct: 384 NGITFQEKSTALIKTLQILT--INKL-TDADTLIGLLSIVICRLKVRNLKSHLFYLQNFA 440

Query: 399 ISETSIKFGLQGYVLSTFEAALSFF----HQDTVDSLTKKCASNKKIWASIQKHSK-VEA 453
               +IKFG+ GY +ST EA   +F    H    D L   C     ++ +I  + K ++ 
Sbjct: 441 ADPNTIKFGILGYSISTLEAITYYFDHISHSHKAD-LIAFCDKLHNLYDTILNNIKSLDN 499

Query: 454 ELLSSNLRIRTDSGESLLSICIQSHNNEVLTTLLANFESEFPLEDILDDRDFALSTLLIQ 513
           ++LS     R+ +GESLLS+CI ++  ++   LL  +E  FP+EDILDD D   S+LL+Q
Sbjct: 500 DILS----YRSQNGESLLSLCIINNKMDIFLELLTTYEHSFPIEDILDDSDLNGSSLLMQ 555

Query: 514 ALQVQNSQAAAILSEIILKSCTESEVRSYLNSPNLHNRITAHY--IMQDISLLESVGRYF 571
           A +  N  A+ IL  I+  SC E E+R +LN  +  NR  AHY  +   I +L   G   
Sbjct: 556 ACKYNNYVASEILVTILKNSCNEEELRIFLNKTDKFNRSVAHYFNMKNSILILTEFGNLI 615

Query: 572 NWEHKDINGHTPLFAVFRSYDAVNYDEIVTKVLDQVV-KWYANNNKPFNFKIHEDPKGNT 630
           +WE KDI   TPL  +F+ +  VNY+E   K+L +VV  WY  +NKPFN K H D  GN 
Sbjct: 616 DWELKDIKKLTPLLTIFKVH-KVNYNESFIKILFRVVLTWYKIHNKPFNLKAHVDQNGNN 674

Query: 631 LLHVMKSGIESLLKLPD----VNVNKPDSKGLTPLMIYSRYNRITNIETIMKDERLLCDL 686
           LLHVMK  I  L++ P+    +N+N  ++KGL+P M+Y + NR  NI  I+K+  L+   
Sbjct: 675 LLHVMKDYINCLIENPELCETININANNNKGLSPFMVYFKTNRYDNIRIILKNPTLITSE 734

Query: 687 VQQPLVMTSLDFTKNPKVT---KTILDATFNREPVVIHSLRFEE 727
            Q P ++TS +   N KV     T    T +   + +HSLRF +
Sbjct: 735 GQLPFLITSTNLY-NSKVNHLLATHFLRTLDFAYICLHSLRFND 777

 Score = 86.3 bits (212), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 83/290 (28%), Positives = 138/290 (47%), Gaps = 54/290 (18%)

Query: 800  FSYVNTRGKLWLGKDEEELKVLLDVPTPYLSESERFIKL----------------EPEEI 843
            F ++ T     L  DE +L+  L +    L ES    K                 +PE+I
Sbjct: 888  FLFITTDFDFTLLFDELKLQAFLKINNKKLKESNSSNKFSHKNNSDQTTELSKAYQPEDI 947

Query: 844  NGIQTFLKYNLAEFQKLRNCLIILKKLAIVQQIKHRDVITMRNSF----LSLG-NQMSQK 898
            N IQTF+K+NL E +  +N +  +K ++I+ + K  D+ + +  F    L +G N +S+ 
Sbjct: 948  NAIQTFIKFNLGELENFKNTITTIKDVSILIKYKIMDLNSSQFFFQKNTLKIGINNLSE- 1006

Query: 899  GVAKSFEN-----TNCAWS---YDLSYYEFT--------RNLEYLEHSVVTLLNNFESLL 942
             + K +       TN   S   YD + Y++          NL + E  V  L  +FE L 
Sbjct: 1007 -ILKYYSTQKPLITNAYTSRKFYDYNSYDYKVEFLNKLLENLIFFEKLVCKLYYDFEDLS 1065

Query: 943  AKTT-LWWKHFGELMELKKEWKKNFPNDKAPPSSANRNF--IDTYIEGKRSKF------- 992
              T   WW H+G L++ + ++ K++PN K      N NF   +T  + KR  F       
Sbjct: 1066 NGTIKTWWYHYGRLLDYEAQYNKHYPNRKI---DINNNFESFNTMFD-KRVNFDSITHFE 1121

Query: 993  RNKLSNQLKMSSLNLKKIGGEIKTTHESIAVGINLFIEFKEQFYHDHIVK 1042
            RN + N +K +S  L++   +IK  HE++A+ +N F+ FK +F  ++I+K
Sbjct: 1122 RNIILN-IKNTSTLLRRFNNKIKFLHENLAIELNNFMNFKNKFIREYIIK 1170

>KAFR0L00400 Chr12 (72520..75348) [2829 bp, 942 aa] {ON} Anc_6.20
            YML002W
          Length = 942

 Score =  199 bits (506), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 219/791 (27%), Positives = 376/791 (47%), Gaps = 123/791 (15%)

Query: 298  ISLNQVPTN-FYPKDEKSFSLASVVELEKSVNDALEYLKSIDLKTTHSGKLEVLSTTMRL 356
            IS +++  N +Y      FSL  VV +E  V+ A +    +    +   K+++L +T  +
Sbjct: 208  ISFHELNINDYYSLPFNKFSLRDVVFIENVVDLACKEFVKLRESLSFDEKIDILLSTFNI 267

Query: 357  LSREINGISTDADTLLSLFVLLICRSQVTGLVRTLTYLTNFEISETSIKFGLQGYVLSTF 416
            L+ ++  +  DAD LL+  +++I R ++  L     YL NF   +    FG+  Y +ST 
Sbjct: 268  LTSKLPQLEIDADNLLNFMLIIINRVKLNNLNEHFHYLQNFNFKQNK-DFGILNYAISTL 326

Query: 417  EAALSFFHQDTVDSLTKKCASNKKIWASIQKHSKVEAELLSSNLRIRTDSGESLLSICIQ 476
             A L ++  + +D         K+   +IQ  SK+  E     L+ R ++GES L  CI 
Sbjct: 327  GAVL-YYIDNNLDKF-------KRYTDAIQD-SKISEE----KLKYRNENGESYLCHCII 373

Query: 477  SHNNEVLTTLLANFESE----FPLEDILDDRDFALSTLLIQALQVQNSQAAAILSEIILK 532
            + +N+ L  LL  F SE    FP+EDILDD+    STLL+ A++  N+ AA+IL  II+ 
Sbjct: 374  TKDNDTLRELL--FSSEYIKNFPMEDILDDQTIDGSTLLMVAVKCLNTTAASILINIIIN 431

Query: 533  SCTESEVRSYLNSPNLHNRITAHYIMQDISLLESVGRYFNWEHKDI-NGHTPLFAVFRSY 591
            + T  E+R+Y+NS + +NR   H+I     LL  +G Y NW  KD   G TPLF +FRSY
Sbjct: 432  NGTPDEIRTYVNSVDENNRNVGHFITNQYYLLCKIGPYLNWNCKDKRTGQTPLFNIFRSY 491

Query: 592  DAV--NYDEIVTKVLDQVVKWYANNNKPFNFKIHEDPKGNTLLHVMKSGIESLLKLPDVN 649
            D    +Y ++  +        +A ++  F  K H D   NTLLH++K+ I+ +L    + 
Sbjct: 492  DQSIKSYKKMSRRSFR-----FAMDSGDFQLKKHIDNSNNTLLHILKTNIQMILPHASLF 546

Query: 650  VNKPDSKGLTPLMIYSRYNRITNIETIM----KDERLLCDLVQQPLVMTS-LDFTKNPKV 704
            +N P+S G+TPLM++ +Y R+ NI+ ++    KD   + +  Q     ++    T + ++
Sbjct: 547  INSPNSLGMTPLMVFCKYRRLYNIQILLSSKFKDRVSIFETQQVHNAWSNCFSLTNDDQI 606

Query: 705  TKTILDATFNREPV----VIHSLRFEERKWKIGIFSEGIFKKYSLDL-IQYYLRYLKIMY 759
               +         +      HSL+    K K      G   +YS+ + +++  +Y  I +
Sbjct: 607  LNLLGKFAIKNYSIFGNCFTHSLKQFLHKSK-----HGNKNQYSVKITLKFEKKYKTIRF 661

Query: 760  PCSFHPVQLLTNELRLLGIYGVPGVLRLQSYHTFKKLDMLFSYVNTRGKLWLGKDEEELK 819
              +   ++ L N + L     V   L L  Y  F +L+ + S ++T+ K+    +   L 
Sbjct: 662  --NIKTIKALIN-MVLTSNSHVSSFLPL--YKVFNELNGIASMISTKSKILFINN---LN 713

Query: 820  VLLD-------VP----------TPYLSESERFIK--------LEPEEINGIQTFLKYNL 854
            V+LD       VP            YL  ++R IK        L+ E+IN I  FLK+NL
Sbjct: 714  VILDTILFLELVPREGFILEARLKDYL-RNQRKIKTVATKSKKLQIEDINMISNFLKFNL 772

Query: 855  AEFQKLRNCL-IILKKLAIV------QQIKHRDVITMRNSFLSLGNQMSQKGVAKSFENT 907
             E    +N +  IL+++  +      Q+I + D++   +  + L N +            
Sbjct: 773  NELNAFKNGVKKILRQMNSINLKLFDQRISYMDLLHCPDVVVHLNNPL------------ 820

Query: 908  NCAWSYDLSYYEFTRNLEYLEHSV---VTLLNNFESLLAKTTLWWKHFGELMELKKEWKK 964
                 ++L+Y     N + LE+S+   +  L  F++   K   WWK   EL+ L K    
Sbjct: 821  -----WNLNYNILISNFQILENSIDNTLHFLKVFQN--EKIRKWWKLNNELINLTK---- 869

Query: 965  NFPNDKAPPSSANRNFIDTYIEGKRSKFRNKLSNQLKMSSLNLKKIGGEIKTTHESIAVG 1024
                     S+++ + + ++   K      KLS ++     ++ ++  +I  +HE +AV 
Sbjct: 870  -------LASNSDDDLLRSFFNRKE-----KLSIEIDDKIRSINELNCDIFVSHELLAVE 917

Query: 1025 INLFIEFKEQF 1035
            IN F++FK  F
Sbjct: 918  INNFMKFKPLF 928

>YML003W Chr13 (263483..264355) [873 bp, 290 aa] {OFF} Putative
           protein of unknown function
          Length = 290

 Score =  149 bits (375), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 97/299 (32%), Positives = 151/299 (50%), Gaps = 34/299 (11%)

Query: 3   YHLPVLLNPLLNAIFNCPSPKTSSLKQMFSRLDDERFFILVPSTETLLQFQDLESGLELA 62
           YHLP LLNPL+NAIFNCP P+ S LK++F+ L   RF +L P +E LL + D++S L L 
Sbjct: 4   YHLPTLLNPLVNAIFNCPEPERSPLKKLFANLKTRRFILLAPPSEYLLNYHDVKSKLPLH 63

Query: 63  ELCYHYDFVASHIVVIKDPTKDVPDQRSIYNTDFTTLNGRKLSIRYRNSTIVTGDGFTER 122
           +LCY+ +F+ S+I+++ + +    + R   ++ + TL+G+ + I+++N+ I   +GF  R
Sbjct: 64  DLCYNAEFINSYILLMTENSYINTNSR---DSHYETLDGKTVVIQWKNNVIHALNGFHIR 120

Query: 123 RKITIKEINLLPTFNDYLKGSNYTPILHISMPLCGDLVPLDELQVFSKVAGNKYSKQEQA 182
           R++ I E  +LP FNDY +G+    IL I  PL  + VP D LQ F        +     
Sbjct: 121 RRLKILETKILPNFNDYFEGAADFIILFIDQPLNCEFVPNDYLQCFHNYEKIPKNAHAMP 180

Query: 183 PLPFDEEQKKVLYFEQRIQSISDVAERVALTFHLTKARIKKAISVIGIRTEWLNTRDSIR 242
            L  D  Q++   FE                 H+  AR+ +   +           D  R
Sbjct: 181 NLSIDSFQQERSSFEN--------------ILHIHPARLTQLGQLFSSYRTLAPGDDPSR 226

Query: 243 QII--------------SLDKRLNHLEDLDAMIYDYVELKLFTDIQQQLSEIVEDQELE 287
            I               SL K  ++L DL   I+DY EL L+ DI  +L+   +  E++
Sbjct: 227 SIFESIVQQAFDGMKSDSLFKNFSNLYDL---IHDYFELNLYDDIWSRLTTHFKGHEVD 282

>KLLA0D10263g Chr4 complement(868131..869444) [1314 bp, 437 aa] {ON}
           similar to uniprot|P54787 Saccharomyces cerevisiae
           YML097C
          Length = 437

 Score = 35.8 bits (81), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 34/71 (47%), Gaps = 2/71 (2%)

Query: 362 NGISTDADTLLSLFVLLICRSQVTGLVRTLTYLTNFEISETSIKFGLQGYVLSTFEAALS 421
           N ++  AD  + L +  + +S V  L+  + Y+  F     S   G   Y LST + A++
Sbjct: 217 NKLNGGADHFVPLLIFTLLKSDVPHLISNVRYIERFRFP--SFLMGENAYYLSTLQGAVN 274

Query: 422 FFHQDTVDSLT 432
           F     +DS++
Sbjct: 275 FILDMDIDSIS 285

>YML097C Chr13 complement(78335..79690) [1356 bp, 451 aa] {ON}
           VPS9A guanine nucleotide exchange factor involved in
           vesicle-mediated vacuolar protein transport;
           specifically stimulates the intrinsic guanine nucleotide
           exchange activity of Vps21p/Rab5: similar to mammalian
           ras inhibitors; binds ubiquitin
          Length = 451

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 38/73 (52%), Gaps = 6/73 (8%)

Query: 360 EINGISTDADTLLSLFVLLICRSQVTGLVRTLTYLTNFEISETSIKFGLQGYVLSTFEAA 419
           E NG    AD+ + + +  I + QV  LV  + Y+  F  S   I+ G + Y LS+ +AA
Sbjct: 246 EQNG----ADSFIPVLIYCILKGQVRYLVSNVNYIERFR-SPDFIR-GEEEYYLSSLQAA 299

Query: 420 LSFFHQDTVDSLT 432
           L+F    T  SLT
Sbjct: 300 LNFIMNLTERSLT 312

>NDAI0K00540 Chr11 complement(118248..121085) [2838 bp, 945 aa] {ON}
           Anc_8.819
          Length = 945

 Score = 34.3 bits (77), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 4/50 (8%)

Query: 279 EIVEDQELEHRFDFKALRSISLNQVPTNFYPKDEKSFSLASVVELEKSVN 328
           E+ +D  + H +D+ A+ +    Q P+ + PKDE  FS A + + E  +N
Sbjct: 846 EVTDDNIIAHAYDYPAVSA----QCPSLWIPKDEFGFSQAIIRDFEGIIN 891

>TPHA0I01430 Chr9 (319975..322929) [2955 bp, 984 aa] {ON} Anc_2.143
            YNL127W
          Length = 984

 Score = 34.3 bits (77), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 24/41 (58%)

Query: 967  PNDKAPPSSANRNFIDTYIEGKRSKFRNKLSNQLKMSSLNL 1007
            PNDK P S  N N +  +IE  RSK RN ++  L M + +L
Sbjct: 511  PNDKLPNSIDNSNSLSQFIEIPRSKIRNSMNQLLSMPNQHL 551

>Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON}
           similar to Ashbya gossypii AFR284W
          Length = 1125

 Score = 33.1 bits (74), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 32/52 (61%), Gaps = 2/52 (3%)

Query: 194 LYFEQRIQSISDVAERVALTFHLTKARIKKAISVIGIRTEWLNTRDSIRQII 245
           +YF    +S+   A+R+ +   LT A+I + +++I  +  WL++RDSI+  +
Sbjct: 56  VYFTTNYKSLR--ADRLTVAAQLTSAQINQTLNIIYYQCYWLSSRDSIQNAL 105

>CAGL0M06127g Chr13 (640057..640749) [693 bp, 230 aa] {ON} similar
           to uniprot|P33754 Saccharomyces cerevisiae YBR171w SEC66
           ER protein-translocation complex subunit
          Length = 230

 Score = 31.6 bits (70), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 48/115 (41%), Gaps = 24/115 (20%)

Query: 87  DQRSIYNTDFTTLNGRKL---SIRYRNSTIVTGDGFTERRKITIKEINLLPTFNDYLKGS 143
           DQ     TDF   NG +      R+ N T   G  F E  ++ +K ++            
Sbjct: 2   DQEFFNATDFNGTNGTQFENNGTRFDNGTHGNGT-FFEEPQVEMKAVSF----------- 49

Query: 144 NYTPILHISMPLCGDLVPLDELQVF-SKVAGNKYSKQEQAPLPFDEEQKKVLYFE 197
            YTP+L++S+ +         L +F S+   NK  K  + P  FDE   K LY +
Sbjct: 50  -YTPLLYVSLLVIS-------LFIFASQYRKNKIKKISELPSIFDESDAKDLYMD 96

>KNAG0G02250 Chr7 complement(507525..522311) [14787 bp, 4928 aa] {ON}
            Anc_8.295 YLR106C
          Length = 4928

 Score = 32.3 bits (72), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 87/192 (45%), Gaps = 26/192 (13%)

Query: 438  NKKIWASIQKHSKVEAELLSSNLRIRTDSGESLLS-------ICIQSHNNEVLTTL---L 487
            N+KIW  I+   +   +LLS NL +  D+  +LL+       IC  S      TTL    
Sbjct: 2106 NRKIWNVIKPLKRTVRKLLSINLGLTDDNSSALLAGFDLLHFICDGSTGKAEFTTLWKKF 2165

Query: 488  ANFESEFP----LEDILDDRDFALSTLLIQALQVQNSQAAAILSEIILKSCTESEV---- 539
             NF+S  P    L  I DD + +L  +L +  +V    A      I+LK+    +     
Sbjct: 2166 KNFQSYLPDNADLLKIADDFE-SLDVVLRKPERV----AFEWFDGILLKAIENGDWLVLD 2220

Query: 540  RSYLNSPNLHNRITAHYIMQDISLLESVGRYFNWEHKDINGHTPLFAVFRSYDAVNYDEI 599
             + L SP++ +R+ +  +  D SLL +     N E + +  H P F +F + D   Y E+
Sbjct: 2221 NANLCSPSVLDRLNS-LLETDGSLLINECSMENGEPRILKPH-PNFRLFLTVDP-KYGEL 2277

Query: 600  VTKVLDQVVKWY 611
               + ++ ++ Y
Sbjct: 2278 SRAMRNRGIELY 2289

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 114,919,130
Number of extensions: 5267937
Number of successful extensions: 17928
Number of sequences better than 10.0: 69
Number of HSP's gapped: 18371
Number of HSP's successfully gapped: 77
Length of query: 1067
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 947
Effective length of database: 39,721,479
Effective search space: 37616240613
Effective search space used: 37616240613
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)