Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D01111g6.19ON31431415520.0
SAKL0E01144g6.19ON43024110601e-143
ACR007W6.19ON31329510411e-142
KNAG0M011506.19ON30729210371e-142
YOR006C (TSR3)6.19ON31327910351e-141
Kpol_1037.246.19ON36628310371e-141
Smik_15.1756.19ON31227510321e-141
TPHA0J003206.19ON34228110261e-139
Suva_15.1816.19ON33627610221e-139
TDEL0G045006.19ON30127610181e-139
Skud_15.1676.19ON31227810101e-137
CAGL0E02717g6.19ON32527910101e-137
Ecym_30236.19ON34924310081e-137
ZYRO0C07832g6.19ON2812519951e-136
NCAS0H008106.19ON3232889491e-128
KLTH0C11264g6.19ON3462929441e-127
NDAI0D007906.19ON4013079481e-127
Kwal_56.224216.19ON3372829221e-124
KAFR0L003906.19ON3292678371e-111
TBLA0A072506.19ON3042808341e-111
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D01111g
         (314 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D01111g Chr4 complement(100315..101259) [945 bp, 314 aa] {O...   602   0.0  
SAKL0E01144g Chr5 complement(88424..89716) [1293 bp, 430 aa] {ON...   412   e-143
ACR007W Chr3 (367875..368816) [942 bp, 313 aa] {ON} Syntenic hom...   405   e-142
KNAG0M01150 Chr13 complement(206754..207677) [924 bp, 307 aa] {O...   404   e-142
YOR006C Chr15 complement(337680..338621) [942 bp, 313 aa] {ON}  ...   403   e-141
Kpol_1037.24 s1037 complement(54258..55358) [1101 bp, 366 aa] {O...   404   e-141
Smik_15.175 Chr15 complement(304998..305936) [939 bp, 312 aa] {O...   402   e-141
TPHA0J00320 Chr10 complement(71267..72295) [1029 bp, 342 aa] {ON...   399   e-139
Suva_15.181 Chr15 complement(312147..313157) [1011 bp, 336 aa] {...   398   e-139
TDEL0G04500 Chr7 (818321..819226) [906 bp, 301 aa] {ON} Anc_6.19...   396   e-139
Skud_15.167 Chr15 complement(297699..298637) [939 bp, 312 aa] {O...   393   e-137
CAGL0E02717g Chr5 complement(257708..258685) [978 bp, 325 aa] {O...   393   e-137
Ecym_3023 Chr3 complement(45641..46690) [1050 bp, 349 aa] {ON} s...   392   e-137
ZYRO0C07832g Chr3 (594511..595356) [846 bp, 281 aa] {ON} similar...   387   e-136
NCAS0H00810 Chr8 complement(146860..147831) [972 bp, 323 aa] {ON...   370   e-128
KLTH0C11264g Chr3 (925534..926574) [1041 bp, 346 aa] {ON} simila...   368   e-127
NDAI0D00790 Chr4 complement(175697..176902) [1206 bp, 401 aa] {O...   369   e-127
Kwal_56.22421 s56 complement(120212..121225) [1014 bp, 337 aa] {...   359   e-124
KAFR0L00390 Chr12 complement(71329..72318) [990 bp, 329 aa] {ON}...   327   e-111
TBLA0A07250 Chr1 complement(1806584..1807498) [915 bp, 304 aa] {...   325   e-111

>KLLA0D01111g Chr4 complement(100315..101259) [945 bp, 314 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006C Hypothetical ORF
          Length = 314

 Score =  602 bits (1552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/314 (96%), Positives = 303/314 (96%)

Query: 1   MGKGKNKESSTRPRSQKGSNGHSSRLNHKRMEMKHVDSTTSKFPVKLAMWDFDHCDPKRC 60
           MGKGKNKESSTRPRSQKGSNGHSSRLNHKRMEMKHVDSTTSKFPVKLAMWDFDHCDPKRC
Sbjct: 1   MGKGKNKESSTRPRSQKGSNGHSSRLNHKRMEMKHVDSTTSKFPVKLAMWDFDHCDPKRC 60

Query: 61  SGKKLERLGLIKSLRVGQKFQGVVVSPNGKTVVCPDDKALVEENGASVVECSWARLDEVP 120
           SGKKLERLGLIKSLRVGQKFQGVVVSPNGKTVVCPDDKALVEENGASVVECSWARLDEVP
Sbjct: 61  SGKKLERLGLIKSLRVGQKFQGVVVSPNGKTVVCPDDKALVEENGASVVECSWARLDEVP 120

Query: 121 FNKIGGKNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAADLLSNFSWGPA 180
           FNKIGGKNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAADLLSNFSWGPA
Sbjct: 121 FNKIGGKNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAADLLSNFSWGPA 180

Query: 181 FLELNKELLDIYQQCTDHDSVKAAEEKWLQKIEQEAIERKQQAKTEDIWMIGNVNRASRD 240
           FLELNKELLDIYQQCTDHDSVKAAEEKWLQKIEQEAIERKQQAKTEDIWMIGNVNRASRD
Sbjct: 181 FLELNKELLDIYQQCTDHDSVKAAEEKWLQKIEQEAIERKQQAKTEDIWMIGNVNRASRD 240

Query: 241 LPGSSGEEEEEDYLNGDSLIDVRDIKYDSLGNVISYNXXXXXXXXXXXVSEHELANEDIG 300
           LPGSSGEEEEEDYLNGDSLIDVRDIKYDSLGNVISYN           VSEHELANEDIG
Sbjct: 241 LPGSSGEEEEEDYLNGDSLIDVRDIKYDSLGNVISYNDEEEDEEGEGEVSEHELANEDIG 300

Query: 301 ISCELSSLSLQDTV 314
           ISCELSSLSLQDTV
Sbjct: 301 ISCELSSLSLQDTV 314

>SAKL0E01144g Chr5 complement(88424..89716) [1293 bp, 430 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006C Hypothetical ORF
          Length = 430

 Score =  412 bits (1060), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 198/241 (82%), Positives = 218/241 (90%), Gaps = 7/241 (2%)

Query: 1   MGKGKNK---ESSTRPRSQKGSNGHSSRLNHKRMEMKHV--DSTTSKFPVKLAMWDFDHC 55
           MGKGKNK   E S+RP   +G+NGHSSRLNHKRMEMK     S  +KFPVKLAMWDFDHC
Sbjct: 1   MGKGKNKNHEERSSRP--HRGANGHSSRLNHKRMEMKRGGDSSAGNKFPVKLAMWDFDHC 58

Query: 56  DPKRCSGKKLERLGLIKSLRVGQKFQGVVVSPNGKTVVCPDDKALVEENGASVVECSWAR 115
           DPKRCSGKKLERLGLIKSLRVGQKFQG+VVSPNG+ VVCP+D+ +VEE+GASVVECSWAR
Sbjct: 59  DPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGRGVVCPNDRVIVEEHGASVVECSWAR 118

Query: 116 LDEVPFNKIGGKNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAADLLSNF 175
           LDEVPF +IGGK+ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLA++LLSNF
Sbjct: 119 LDEVPFGRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLASELLSNF 178

Query: 176 SWGPAFLELNKELLDIYQQCTDHDSVKAAEEKWLQKIEQEAIERKQQAKTEDIWMIGNVN 235
           SWG  FLELNKELL+IYQQCTD DSVKAAEE WL+KIE+EA +RKQQ+K EDIWM+GNVN
Sbjct: 179 SWGLGFLELNKELLEIYQQCTDADSVKAAEEAWLKKIEEEAQQRKQQSKEEDIWMMGNVN 238

Query: 236 R 236
           R
Sbjct: 239 R 239

>ACR007W Chr3 (367875..368816) [942 bp, 313 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR006C
          Length = 313

 Score =  405 bits (1041), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 193/295 (65%), Positives = 230/295 (77%), Gaps = 25/295 (8%)

Query: 1   MGKGKNKESSTRPRSQKGSNGHSSRLNHKRMEMKHVDSTTSKFPVKLAMWDFDHCDPKRC 60
           M KGKNK++  R +  KGS+ H+ + N +R E+KH  +  ++FP KLAMWDFDHCDPKRC
Sbjct: 1   MAKGKNKKTEERQKPAKGSSKHNGKSNQRRTELKHGHTKETEFPAKLAMWDFDHCDPKRC 60

Query: 61  SGKKLERLGLIKSLRVGQKFQGVVVSPNGKTVVCPDDKALVEENGASVVECSWARLDEVP 120
           SGKKLERLGLIKSLR+GQKFQG+VVSPNGKTVVCP+DK +VE++G SVVECSWARLDE+P
Sbjct: 61  SGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARLDEIP 120

Query: 121 FNKIGGKNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAADLLSNFSWGPA 180
           F+KIGG++ERLLPYLVAANQVNYGRPWRLNCVEA+AACFAIVGRTDLA +LLS+FSWGP 
Sbjct: 121 FSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFSWGPG 180

Query: 181 FLELNKELLDIYQQCTDHDSVKAAEEKWLQKIEQEAIERKQQAKTEDIWMIGNVNRASRD 240
           FLELN+ELL+ YQQCTDH S+KAAEE WLQK+E+EA +R++Q   EDIWM+GNVNR + +
Sbjct: 181 FLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVNRKAPN 240

Query: 241 LPGS---------------------SGEEEEEDYLNGDSLIDVRDIKYDSLGNVI 274
           +  S                     S  EE ED   G      RD+ YDSLGNVI
Sbjct: 241 MRSSMLDSDDNSDSEYASDVDHDLVSDTEEGEDIAIGSK----RDVTYDSLGNVI 291

>KNAG0M01150 Chr13 complement(206754..207677) [924 bp, 307 aa] {ON}
           Anc_6.19 YOR006C
          Length = 307

 Score =  404 bits (1037), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 207/292 (70%), Positives = 236/292 (80%), Gaps = 19/292 (6%)

Query: 2   GKGKNKESS--TRPRSQKGSNGHSSRLNHKRMEMKHVDSTT-SKFPVKLAMWDFDHCDPK 58
           GKGKNK     T   S KGSNGHSSRLNHKRME++  D    +KFPVK+AMWDFDHCDPK
Sbjct: 4   GKGKNKSRGDETSRGSHKGSNGHSSRLNHKRMELRQHDGVKGTKFPVKMAMWDFDHCDPK 63

Query: 59  RCSGKKLERLGLIKSLRVGQKFQGVVVSPNGKTVVCPDDKALVEENGASVVECSWARLDE 118
           RCSGKKLERLGLI SL+VGQKFQG+VVSPNG+ VVCPDD+A+VEE GASVVECSWARLDE
Sbjct: 64  RCSGKKLERLGLITSLKVGQKFQGIVVSPNGQGVVCPDDRAIVEEFGASVVECSWARLDE 123

Query: 119 VPFNKIGGKNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAADLLSNFSWG 178
           VPFN+IGGK+ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR DLA+DLLSNFSWG
Sbjct: 124 VPFNRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLASDLLSNFSWG 183

Query: 179 PAFLELNKELLDIYQQCTDHDSVKAAEEKWLQKIEQEAIERKQQAKTEDIWMIGNVNRAS 238
             FLELNKELL++YQ+CTDH+SVK AEE WL KIE+EA +RK +A+  DIWM+GNVNR  
Sbjct: 184 LGFLELNKELLEVYQKCTDHESVKKAEEDWLNKIEEEAQQRKNEARDGDIWMMGNVNRNM 243

Query: 239 RDLPGSSGEEEEED-------YLN-GDSLIDVRD--------IKYDSLGNVI 274
             +  S  E +EE+       Y N G+++ID  D        I+YD+LGNVI
Sbjct: 244 NKMTLSDEESDEEETEASSIRYDNLGNAIIDESDEEEPEISSIRYDNLGNVI 295

>YOR006C Chr15 complement(337680..338621) [942 bp, 313 aa] {ON}
           TSR3Protein required for correct processing of the 20S
           pre-rRNA at site D to generate mature 18S rRNA; green
           fluorescent protein (GFP)-fusion protein localizes to
           both the cytoplasm and the nucleus
          Length = 313

 Score =  403 bits (1035), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 200/279 (71%), Positives = 228/279 (81%), Gaps = 10/279 (3%)

Query: 1   MGKGKNKESSTR-PRSQKGSNGHSSRLNHKRMEMKHVDSTTSKFPVKLAMWDFDHCDPKR 59
           MGKGKNK    +  R Q+G+NGHSSR NH+RMEMK+ +S   KFPVKLAMWDFDHCDPKR
Sbjct: 1   MGKGKNKMHEPKNGRPQRGANGHSSRQNHRRMEMKYDNSEKMKFPVKLAMWDFDHCDPKR 60

Query: 60  CSGKKLERLGLIKSLRVGQKFQGVVVSPNGKTVVCPDDKALVEENGASVVECSWARLDEV 119
           CSGKKLERLGLIKSLRVGQKFQG+VVSPNGK VVCPDD  +VE++GASVVECSWARL+EV
Sbjct: 61  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEIVEQHGASVVECSWARLEEV 120

Query: 120 PFNKIGGKNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAADLLSNFSWGP 179
           PFNKIGGK+ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR D A++LLS+FSWG 
Sbjct: 121 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGM 180

Query: 180 AFLELNKELLDIYQQCTDHDSVKAAEEKWLQKIEQEAIERKQQAKTEDIWMIGNVNRASR 239
            FLELNKELL+IYQQCTD DSVK AEE+WLQK+E+E  ERK +AK EDIWM+GN+NR   
Sbjct: 181 GFLELNKELLEIYQQCTDCDSVKRAEEEWLQKLEKETQERKSRAKEEDIWMMGNINRR-- 238

Query: 240 DLPGSSGEEEEEDYLNGDSLIDVRD----IKYDSLGNVI 274
              G+  + +  +        D+      I+YDSLGN I
Sbjct: 239 ---GNGSQSDTSESEENSEQSDLEGNNQCIEYDSLGNAI 274

>Kpol_1037.24 s1037 complement(54258..55358) [1101 bp, 366 aa] {ON}
           complement(54258..55358) [1101 nt, 367 aa]
          Length = 366

 Score =  404 bits (1037), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 202/283 (71%), Positives = 227/283 (80%), Gaps = 12/283 (4%)

Query: 1   MGKGKNKESSTRP-RSQKGSNGHSSRLNHKRMEMKHVDSTTS---KFPVKLAMWDFDHCD 56
           M KGKNK+   R  +  +GSNGHSS+LNHK MEMK      S   KFPVKLAMWDFDHCD
Sbjct: 1   MAKGKNKQHEARTGKPSRGSNGHSSKLNHKHMEMKKYGKNISQDDKFPVKLAMWDFDHCD 60

Query: 57  PKRCSGKKLERLGLIKSLRVGQKFQGVVVSPNGKTVVCPDDKALVEENGASVVECSWARL 116
           PKRCSGK+LERLGLIKSLRVGQKFQGVVVSPNGK V+CP+D+ +VEE GASVVECSWARL
Sbjct: 61  PKRCSGKRLERLGLIKSLRVGQKFQGVVVSPNGKGVLCPNDREIVEEFGASVVECSWARL 120

Query: 117 DEVPFNKIGGKNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAADLLSNFS 176
           DEVPFNKIGGK+ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR D AA+LLSNFS
Sbjct: 121 DEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWAAELLSNFS 180

Query: 177 WGPAFLELNKELLDIYQQCTDHDSVKAAEEKWLQKIEQEAIERKQQAKTEDIWMIGNVNR 236
           WG  FLE+N+ELL IYQQCTD +SVK AEE+WL KIEQE  ERK QA+  DIWM+GN N 
Sbjct: 181 WGLGFLEINEELLKIYQQCTDSESVKKAEEEWLAKIEQEIQERKTQARESDIWMMGNTN- 239

Query: 237 ASRDLPGSSGEEEEEDY--LNGDSLIDV---RDIKYDSLGNVI 274
             R++ G   EEE   Y  L+GD   +    +  +YD+LGN+I
Sbjct: 240 --RNMNGDDDEEEGNSYEALSGDDYEEENNNKSARYDNLGNII 280

>Smik_15.175 Chr15 complement(304998..305936) [939 bp, 312 aa] {ON}
           YOR006C (REAL)
          Length = 312

 Score =  402 bits (1032), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 199/275 (72%), Positives = 224/275 (81%), Gaps = 2/275 (0%)

Query: 1   MGKGKNKESSTR-PRSQKGSNGHSSRLNHKRMEMKHVDSTTSKFPVKLAMWDFDHCDPKR 59
           MGKGKNK    +  R Q+G+NGHSSR NH+RMEMK+ +S   KFPVKLAMWDFDHCDPKR
Sbjct: 1   MGKGKNKAHEPKNGRPQRGANGHSSRQNHRRMEMKYENSDKVKFPVKLAMWDFDHCDPKR 60

Query: 60  CSGKKLERLGLIKSLRVGQKFQGVVVSPNGKTVVCPDDKALVEENGASVVECSWARLDEV 119
           CSGKKLERLGLIKSLRVGQKFQG+VVSPNGK VVCPDD  +VE++GASVVECSWARL+EV
Sbjct: 61  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEVVEQHGASVVECSWARLEEV 120

Query: 120 PFNKIGGKNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAADLLSNFSWGP 179
           PFNKIGGK+ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR D A++LLS+FSWG 
Sbjct: 121 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGM 180

Query: 180 AFLELNKELLDIYQQCTDHDSVKAAEEKWLQKIEQEAIERKQQAKTEDIWMIGNVNRASR 239
            FLELNKELL+IYQQCTD DSVK AEE+WLQK+E+E  ERK QAK EDIWM+GN+NR   
Sbjct: 181 GFLELNKELLEIYQQCTDADSVKRAEEEWLQKLEKETQERKSQAKEEDIWMMGNINRRGG 240

Query: 240 DLPGSSGEEEEEDYLNGDSLIDVRDIKYDSLGNVI 274
                  E       +       + ++YDSLGN I
Sbjct: 241 GWQSDESESGGSSGESESEGDK-QCVEYDSLGNAI 274

>TPHA0J00320 Chr10 complement(71267..72295) [1029 bp, 342 aa] {ON}
           Anc_6.19 YOR006C
          Length = 342

 Score =  399 bits (1026), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 196/281 (69%), Positives = 226/281 (80%), Gaps = 10/281 (3%)

Query: 1   MGKGKNKESSTRP-RSQKGSNGHSSRLNHKRMEMKHVDSTT------SKFPVKLAMWDFD 53
           M KGKNK S TR  +  +GSNGH +R NHKRMEMK  ++ T      + FPVKLAMWDFD
Sbjct: 1   MAKGKNKSSETRSGKPSRGSNGHHTRTNHKRMEMKFSNAGTGANSKEAGFPVKLAMWDFD 60

Query: 54  HCDPKRCSGKKLERLGLIKSLRVGQKFQGVVVSPNGKTVVCPDDKALVEENGASVVECSW 113
           HCDPKRCSGKKLERLGLIKSLRVGQKFQG+VVSPNGK VVCPDDK  VEE GASVVECSW
Sbjct: 61  HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDKETVEEFGASVVECSW 120

Query: 114 ARLDEVPFNKIGGKNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAADLLS 173
           ARLDEVPFNKIGGK+ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR DLAA+LL 
Sbjct: 121 ARLDEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRVDLAAELLE 180

Query: 174 NFSWGPAFLELNKELLDIYQQCTDHDSVKAAEEKWLQKIEQEAIERKQQAKTEDIWMIGN 233
           +FSWG  FLELNKELL++YQ+CTD +SVK  EE+WL+KI++E  ERK Q++  DIW+ GN
Sbjct: 181 HFSWGLGFLELNKELLEMYQKCTDSESVKKVEEEWLEKIDKEVQERKSQSREGDIWLQGN 240

Query: 234 VNRASRDLPGSSGEEEEEDYLNGDSLIDVRDIKYDSLGNVI 274
            NR  +D+      + E+ Y   ++    R I+YD+LGNV+
Sbjct: 241 TNRDLQDMSDDEEFDSEQYYSEENT---ERKIRYDNLGNVL 278

>Suva_15.181 Chr15 complement(312147..313157) [1011 bp, 336 aa] {ON}
           YOR006C (REAL)
          Length = 336

 Score =  398 bits (1022), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 201/276 (72%), Positives = 230/276 (83%), Gaps = 4/276 (1%)

Query: 1   MGKGKNKESSTR-PRSQKGSNGHSSRLNHKRMEMKHVDSTTSKFPVKLAMWDFDHCDPKR 59
           MGKGKNK    +  R Q+G+NGHSSR NHKRMEMK+ +S  + FPVKLAMWDFDHCDPKR
Sbjct: 25  MGKGKNKTHEPKNGRPQRGANGHSSRQNHKRMEMKYDNSEMTNFPVKLAMWDFDHCDPKR 84

Query: 60  CSGKKLERLGLIKSLRVGQKFQGVVVSPNGKTVVCPDDKALVEENGASVVECSWARLDEV 119
           CSGKKLERLGLIKSLRVGQKFQG+VVSPNG  VVCPDD  +VE++GASVVECSWARL+EV
Sbjct: 85  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGNGVVCPDDLEVVEQHGASVVECSWARLEEV 144

Query: 120 PFNKIGGKNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAADLLSNFSWGP 179
           PFNKIGGK+ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR D A+ LLS+FSWG 
Sbjct: 145 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASGLLSHFSWGL 204

Query: 180 AFLELNKELLDIYQQCTDHDSVKAAEEKWLQKIEQEAIERKQQAKTEDIWMIGNVNRASR 239
            FL+LN+ELL+IYQ+CTD +SVK AEE+WLQK+E+E  ERK Q+K EDIWM+GNVNR  +
Sbjct: 205 GFLDLNRELLEIYQKCTDSNSVKKAEEEWLQKLEKETQERKSQSKDEDIWMMGNVNR--K 262

Query: 240 DLPGSSGEEEEEDYLNGDSL-IDVRDIKYDSLGNVI 274
           D    S E E E+  +   L  D + I+YDSLGN I
Sbjct: 263 DNGAQSDESESEEDSDQSELESDKQSIEYDSLGNAI 298

>TDEL0G04500 Chr7 (818321..819226) [906 bp, 301 aa] {ON} Anc_6.19
           YOR006C
          Length = 301

 Score =  396 bits (1018), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 201/276 (72%), Positives = 226/276 (81%), Gaps = 3/276 (1%)

Query: 1   MGKGKNKESSTR-PRSQKGSNGHSSRLNHKRMEMKHVDSTTSKFPVKLAMWDFDHCDPKR 59
           M KGKNK    +   S KGSNGHSSR NHKRMEMK   +  +KFPVKLAMWDFDHCDPKR
Sbjct: 1   MSKGKNKNREAKNGHSGKGSNGHSSRQNHKRMEMKR-GTEDTKFPVKLAMWDFDHCDPKR 59

Query: 60  CSGKKLERLGLIKSLRVGQKFQGVVVSPNGKTVVCPDDKALVEENGASVVECSWARLDEV 119
           CSGKKLERLGLIKSLRVGQKFQG+VVSPNG  VVCPDDK++VEE+GASVVECSWARLDEV
Sbjct: 60  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGSGVVCPDDKSIVEEHGASVVECSWARLDEV 119

Query: 120 PFNKIGGKNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAADLLSNFSWGP 179
           PFNKIGGK+ERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGR D A++LLS+FSWG 
Sbjct: 120 PFNKIGGKHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSHFSWGL 179

Query: 180 AFLELNKELLDIYQQCTDHDSVKAAEEKWLQKIEQEAIERKQQAKTEDIWMIGNVNR-AS 238
            FLELN+ELL+IYQQCTD DSVKAAE  WL KI++E  ERK QAK EDIWM GNVNR  +
Sbjct: 180 GFLELNQELLEIYQQCTDADSVKAAESAWLVKIQKEVEERKSQAKDEDIWMTGNVNRKGT 239

Query: 239 RDLPGSSGEEEEEDYLNGDSLIDVRDIKYDSLGNVI 274
             L  +  EE  E   + +   + + ++YD LGN+I
Sbjct: 240 TFLDDNEEEESSEVEESDEEEDNGKTLRYDRLGNLI 275

>Skud_15.167 Chr15 complement(297699..298637) [939 bp, 312 aa] {ON}
           YOR006C (REAL)
          Length = 312

 Score =  393 bits (1010), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 192/278 (69%), Positives = 223/278 (80%), Gaps = 8/278 (2%)

Query: 1   MGKGKNKESSTR-PRSQKGSNGHSSRLNHKRMEMKHVDSTTSKFPVKLAMWDFDHCDPKR 59
           MGKGKNK    +  R Q+G+NGHS+R NHK MEMK+  S   KFPVKLAMWDFDHCDPKR
Sbjct: 1   MGKGKNKTHEPKNERQQRGANGHSARQNHKHMEMKYDKSEKMKFPVKLAMWDFDHCDPKR 60

Query: 60  CSGKKLERLGLIKSLRVGQKFQGVVVSPNGKTVVCPDDKALVEENGASVVECSWARLDEV 119
           CSGKKLERLGLI+SLRVGQKFQGVVVSPNG+ VVCP+D  +VE++GASVVECSWARL+EV
Sbjct: 61  CSGKKLERLGLIRSLRVGQKFQGVVVSPNGQGVVCPNDLEIVEQHGASVVECSWARLEEV 120

Query: 120 PFNKIGGKNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAADLLSNFSWGP 179
           PFNKIGGK ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVG+ D A++LLS+FSWG 
Sbjct: 121 PFNKIGGKYERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGKMDWASELLSHFSWGL 180

Query: 180 AFLELNKELLDIYQQCTDHDSVKAAEEKWLQKIEQEAIERKQQAKTEDIWMIGNVNRASR 239
            FL+LNKELL+IYQ+CTD DSVK AE++WL+K+E E  ERK   K  DIWM+GN+NR   
Sbjct: 181 GFLDLNKELLEIYQRCTDADSVKKAEKEWLEKLEMETQERKSHTKKTDIWMMGNINRRGN 240

Query: 240 DLPG---SSGEEEEEDYLNGDSLIDVRDIKYDSLGNVI 274
            +      SGE+ E+  L        + I+YD+LGN I
Sbjct: 241 GVQSDELESGEDSEQSGLENSE----QPIEYDALGNAI 274

>CAGL0E02717g Chr5 complement(257708..258685) [978 bp, 325 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006c
          Length = 325

 Score =  393 bits (1010), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 197/279 (70%), Positives = 228/279 (81%), Gaps = 7/279 (2%)

Query: 2   GKGKNKESSTRPRSQK--GSNGHSSRLNHKRMEMKHVD-STTSKFPVKLAMWDFDHCDPK 58
           GKGKNK S    RS K  GSNGH +R NH+ MEMK+   S  S FPVKLAMWDFDHCDPK
Sbjct: 4   GKGKNK-SHDEGRSNKSGGSNGHHTRRNHRHMEMKYCGGSKDSSFPVKLAMWDFDHCDPK 62

Query: 59  RCSGKKLERLGLIKSLRVGQKFQGVVVSPNGKTVVCPDDKALVEENGASVVECSWARLDE 118
           RCSGKKLERLGLIKSLRVGQKFQG+VVSPNGK+VVCPDD+ +VE +GASVVECSWARL+E
Sbjct: 63  RCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKSVVCPDDREIVEAHGASVVECSWARLEE 122

Query: 119 VPFNKIGGKNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAADLLSNFSWG 178
           VPFNKIGGK+ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLA +LLS+FSWG
Sbjct: 123 VPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAHELLSHFSWG 182

Query: 179 PAFLELNKELLDIYQQCTDHDSVKAAEEKWLQKIEQEAIERKQQAKTEDIWMIGNVNRAS 238
             FLELNK+LL+ YQQCTD +S+K  EE WLQ+I+QE  ERK +A+TED+WM+GN NR +
Sbjct: 183 LGFLELNKDLLERYQQCTDSESIKKVEEDWLQQIDQEVQERKLKAQTEDVWMMGNTNRGN 242

Query: 239 RDLPGSSGEEEEEDYLNGDSLIDV---RDIKYDSLGNVI 274
             L   S  EEE +    +   D    ++++YD+LGN+I
Sbjct: 243 SGLMPPSDSEEEYEEEAEEEEEDTTTRKNVRYDNLGNII 281

>Ecym_3023 Chr3 complement(45641..46690) [1050 bp, 349 aa] {ON}
           similar to Ashbya gossypii ACR007W
          Length = 349

 Score =  392 bits (1008), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 184/243 (75%), Positives = 212/243 (87%), Gaps = 3/243 (1%)

Query: 1   MGKGKNKESSTRPRSQKGSNGHSSRLNHKRMEMKHVDSTTSKFPVKLAMWDFDHCDPKRC 60
           MGKG+NK+   +  SQKGSNGHSSR NH+R+E K+     SKFPV LAMWDFDHCDPKRC
Sbjct: 1   MGKGRNKDYD-KNHSQKGSNGHSSRTNHRRIETKYNAIQGSKFPVTLAMWDFDHCDPKRC 59

Query: 61  SGKKLERLGLIKSLRVGQKFQGVVVSPNGKTVVCPDDKALVEENGASVVECSWARLDEVP 120
           SGKKLERLGLIKSLRV QKFQG+VVSPNGKTVVCP+D+ + E+ G SVVECSWARL+E+P
Sbjct: 60  SGKKLERLGLIKSLRVKQKFQGIVVSPNGKTVVCPNDREIAEKYGVSVVECSWARLEEIP 119

Query: 121 FNKIGGKNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAADLLSNFSWGPA 180
           F KIGG++ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR DLA  LLS+FSWG  
Sbjct: 120 FEKIGGRHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLAETLLSHFSWGLG 179

Query: 181 FLELNKELLDIYQQCTDHDSVKAAEEKWLQKIEQEAIERKQQAKTEDIWMIGNVNR--AS 238
           FLELNKE+L+IYQ+CTDHDS+KAAEE WL++IE EA+ER++Q K  DIWM+GNVNR  AS
Sbjct: 180 FLELNKEILEIYQKCTDHDSIKAAEEAWLKQIETEAMERRKQTKENDIWMMGNVNRKNAS 239

Query: 239 RDL 241
           ++L
Sbjct: 240 KEL 242

>ZYRO0C07832g Chr3 (594511..595356) [846 bp, 281 aa] {ON} similar to
           uniprot|Q12094 Saccharomyces cerevisiae YOR006C
           Hypothetical ORF
          Length = 281

 Score =  387 bits (995), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 185/251 (73%), Positives = 213/251 (84%), Gaps = 8/251 (3%)

Query: 1   MGKGKNKESSTR-PRSQKGSNGHSSRLNHKRMEMKH---VDSTTSKFPVKLAMWDFDHCD 56
           MGKGKNK    R  R  +G+NGH+S+ NHK MEMKH    +S  + FPVKL MWDFDHCD
Sbjct: 1   MGKGKNKNHEVRSTRPGRGANGHNSKQNHKHMEMKHGGASNSNKTNFPVKLGMWDFDHCD 60

Query: 57  PKRCSGKKLERLGLIKSLRVGQKFQGVVVSPNGKTVVCPDDKALVEENGASVVECSWARL 116
           PKRCSGKKLERLGLI+SLRVGQKFQGVVV+PNG  VVCP+DK++VEE+GASVVECSWARL
Sbjct: 61  PKRCSGKKLERLGLIRSLRVGQKFQGVVVTPNGTGVVCPNDKSIVEEHGASVVECSWARL 120

Query: 117 DEVPFNKIGGKNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAADLLSNFS 176
           DEVPFN+IGG++ERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGR D A++LLSNFS
Sbjct: 121 DEVPFNRIGGRHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSNFS 180

Query: 177 WGPAFLELNKELLDIYQQCTDHDSVKAAEEKWLQKIEQEAIERKQQAKTEDIWMIGNVNR 236
           +GP+FLE+N ELL+IYQQCTD +SVK AE  WL+KIE+E  +RK QAK EDIWM GNVNR
Sbjct: 181 YGPSFLEINAELLEIYQQCTDAESVKDAESAWLEKIEKEIKDRKAQAKNEDIWMTGNVNR 240

Query: 237 ASRDLPGSSGE 247
               +P +S E
Sbjct: 241 ----MPAASQE 247

>NCAS0H00810 Chr8 complement(146860..147831) [972 bp, 323 aa] {ON}
           Anc_6.19 YOR006C
          Length = 323

 Score =  370 bits (949), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 188/288 (65%), Positives = 230/288 (79%), Gaps = 15/288 (5%)

Query: 1   MGKGKNK---ESSTRPRSQKGSNGHSSRLNHKRMEM-KHVDSTTS---KFPVKLAMWDFD 53
           MGKGKNK   +  ++ R  +G+NGHSSR NHK MEM KH +  TS   K PVKL MWDFD
Sbjct: 1   MGKGKNKKRDDGDSKGRQHRGANGHSSRHNHKNMEMRKHENEDTSNVKKIPVKLGMWDFD 60

Query: 54  HCDPKRCSGKKLERLGLIKSLRVGQKFQGVVVSPNGKTVVCPDDKALVEENGASVVECSW 113
           HCDPKRCSGKKLERLGLIKSL++GQ+FQG+++SPNGK VV P+D  +++E GA+VVECSW
Sbjct: 61  HCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPEDADIIKEFGAAVVECSW 120

Query: 114 ARLDEVPFNKI----GGKNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAA 169
           ARLDE+PF+K+    GGKNERLLPYLVAANQVNYGRPW+LNCVEALAACFAI+GR+D AA
Sbjct: 121 ARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEALAACFAIIGRSDWAA 180

Query: 170 DLLSNFSWGPAFLELNKELLDIYQQCTDHDSVKAAEEKWLQKIEQEAIERKQQAKTEDIW 229
           DLLSNFSWG  FL LN+EL ++Y QCTD DS++ A+E WL KI++EA ERK QA+  DIW
Sbjct: 181 DLLSNFSWGMNFLTLNEELFELYSQCTDSDSIQEAQEAWLNKIDEEAKERKLQAQDNDIW 240

Query: 230 MIGNVNRAS---RDLPGSSGEEEEEDYLNGDSLIDVRDIKYDSLGNVI 274
           ++GN NR +   RDL  S G+E+EE+    D L + + +KYD+LGNVI
Sbjct: 241 LMGNTNRVNDNLRDLTLSDGDEDEEEEDAEDYLTE-KSVKYDNLGNVI 287

>KLTH0C11264g Chr3 (925534..926574) [1041 bp, 346 aa] {ON} similar
           to uniprot|Q12094 Saccharomyces cerevisiae YOR006C
           Hypothetical ORF
          Length = 346

 Score =  368 bits (944), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 188/292 (64%), Positives = 227/292 (77%), Gaps = 22/292 (7%)

Query: 2   GKGKNKESSTRPRSQKGSNGHSSRLNHKRMEMKHVDSTTSK-FPVKLAMWDFDHCDPKRC 60
           GKG NK+      S K S+GH+S   H+ +E KH  + + K FPVKLAMWDFD CDPKRC
Sbjct: 7   GKGSNKQRGAH--SSKPSSGHTS--THRHVESKHGANKSGKNFPVKLAMWDFDQCDPKRC 62

Query: 61  SGKKLERLGLIKSLRVGQKFQGVVVSPNGKTVVCPDDKALVEENGASVVECSWARLDEVP 120
           SGKKLERLG+IKSLRVGQKFQG+VVSPNGK+VVCP+D+ +VEENGA+VVECSWARLDEVP
Sbjct: 63  SGKKLERLGIIKSLRVGQKFQGIVVSPNGKSVVCPNDRNIVEENGAAVVECSWARLDEVP 122

Query: 121 FNKIGGKNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAADLLSNFSWGPA 180
           FNKIGG+NERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR DLA +LLS+FSWG  
Sbjct: 123 FNKIGGRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRLDLATELLSHFSWGLQ 182

Query: 181 FLELNKELLDIYQQCTDHDSVKAAEEKWLQKIEQEAIERKQQAKTEDIWMIGNVNRA--- 237
           FLELNKELL++YQ+CTD DS+K AE+ WL++IE+EA ERK +   +D+W+ GNVN     
Sbjct: 183 FLELNKELLEVYQRCTDADSIKKAEDAWLEQIEKEAQERKARNPGDDLWLTGNVNHKKGH 242

Query: 238 ------SRDLP--GSSGEE-EEEDYLNGDSLIDVRD-----IKYDSLGNVIS 275
                 ++D    GS+ E+ E  +Y + +S  D  +     +KYDSLGN I+
Sbjct: 243 GVTQNENKDEAEVGSTWEQGENSEYESDESAADGEEAYHGPVKYDSLGNEIT 294

>NDAI0D00790 Chr4 complement(175697..176902) [1206 bp, 401 aa] {ON}
           Anc_6.19 YOR006C
          Length = 401

 Score =  369 bits (948), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 188/307 (61%), Positives = 231/307 (75%), Gaps = 33/307 (10%)

Query: 1   MGKGKNK---ESSTRPRSQKGSNGHSSRLNHKRMEMK-HVDSTTS--------------- 41
           MGKGKNK   +    PR+ +G+NGHSSR NHK MEMK H D T++               
Sbjct: 45  MGKGKNKSRDDGPKNPRAHRGANGHSSRHNHKNMEMKKHNDFTSTQMVNDNDDGIDEIHS 104

Query: 42  --KFPVKLAMWDFDHCDPKRCSGKKLERLGLIKSLRVGQKFQGVVVSPNGKTVVCPDDKA 99
             K PVKL MWDFDHCDPKRCSGKKLERLGLIKSL++GQ+FQG+++SPNGK VV PDD  
Sbjct: 105 VKKIPVKLGMWDFDHCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPDDAD 164

Query: 100 LVEENGASVVECSWARLDEVPFNKI----GGKNERLLPYLVAANQVNYGRPWRLNCVEAL 155
           +++E GA+VVECSWARLDE+PF+K+    GGKNERLLPYLVAANQVNYGRPW+LNCVEAL
Sbjct: 165 IIKEFGAAVVECSWARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEAL 224

Query: 156 AACFAIVGRTDLAADLLSNFSWGPAFLELNKELLDIYQQCTDHDSVKAAEEKWLQKIEQE 215
           AACFAI+GR+D A+DLLSNFSWG  FL+LN+EL ++Y +CTD DSVKAA+E+WL KIEQE
Sbjct: 225 AACFAIIGRSDWASDLLSNFSWGLNFLKLNEELFELYSKCTDSDSVKAAQEEWLDKIEQE 284

Query: 216 AIERKQQAKTEDIWMIGNVNRASRDLPGSS--------GEEEEEDYLNGDSLIDVRDIKY 267
           A ERK QA+  DIWM+GN NR   +L   +         EE +E+   G+ +   ++++Y
Sbjct: 285 ATERKLQAQETDIWMMGNTNRLDANLRSMNISDEDEEEEEEYDEEEDGGEHITRNKELRY 344

Query: 268 DSLGNVI 274
           D+LGNVI
Sbjct: 345 DNLGNVI 351

>Kwal_56.22421 s56 complement(120212..121225) [1014 bp, 337 aa] {ON}
           YOR006C - Hypothetical ORF [contig 185] FULL
          Length = 337

 Score =  359 bits (922), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 182/282 (64%), Positives = 215/282 (76%), Gaps = 24/282 (8%)

Query: 14  RSQKGSN----GHSSRLNHKRMEMKH-VDSTTSKFPVKLAMWDFDHCDPKRCSGKKLERL 68
           RS KGSN    GHS+R +   +E KH   +    FPVKLAMWDFD CDPKRCSGKKLERL
Sbjct: 6   RSNKGSNKVRTGHSNRSSSGYVETKHGAHNNGRNFPVKLAMWDFDQCDPKRCSGKKLERL 65

Query: 69  GLIKSLRVGQKFQGVVVSPNGKTVVCPDDKALVEENGASVVECSWARLDEVPFNKIGGKN 128
           G+IKSLRVGQKFQG+VVSPNGK VVCP+DK +VEE+GA+VVECSWARL+E+PFNKIGG+N
Sbjct: 66  GIIKSLRVGQKFQGIVVSPNGKGVVCPNDKQIVEESGAAVVECSWARLNEIPFNKIGGRN 125

Query: 129 ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAADLLSNFSWGPAFLELNKEL 188
           ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR DLA +LL++FSWG  FLELNKEL
Sbjct: 126 ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLATELLAHFSWGLGFLELNKEL 185

Query: 189 LDIYQQCTDHDSVKAAEEKWLQKIEQEAIERKQQAKTEDIWMIGNVNRASR--------- 239
           +++YQ+CTD +SVK AE  WL+KIE+EA ER+  + T+D+WM GNVNR S          
Sbjct: 186 IEVYQKCTDAESVKEAEASWLEKIEREANERRNHSATDDLWMTGNVNRRSPLGNDTESSQ 245

Query: 240 -------DLPGSSGEEEEEDYLNGDSLIDVRDIKYDSLGNVI 274
                  D      ++ E+DY  G+     R +KYD+LGN I
Sbjct: 246 EESENSVDTGDEEDDDNEDDYATGNR---KRVVKYDNLGNEI 284

>KAFR0L00390 Chr12 complement(71329..72318) [990 bp, 329 aa] {ON}
           Anc_6.19 YOR006C
          Length = 329

 Score =  327 bits (837), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 160/267 (59%), Positives = 203/267 (76%), Gaps = 8/267 (2%)

Query: 16  QKGSNGHSSRLNHKRMEMKHVDSTTSKFPVKLAMWDFDHCDPKRCSGKKLERLGLIKSLR 75
           +  SNGH SR N+K+ME K   S  + FPVKLAMWDFDHCDPKRCSGKKLERL LI+SL+
Sbjct: 20  RTNSNGHHSRHNNKKMEFKQHVSRETSFPVKLAMWDFDHCDPKRCSGKKLERLNLIRSLK 79

Query: 76  VGQKFQGVVVSPNGKTVVCPDDKALVEENGASVVECSWARLDEVPFNKIGG-KNERLLPY 134
           + QKFQG+ VSPNGK  V P+D+ LV E G +VVECSWAR+DE+PF+K    K +RLLPY
Sbjct: 80  INQKFQGITVSPNGKKFVSPEDRELVTEFGCAVVECSWARIDEIPFSKFSTPKLDRLLPY 139

Query: 135 LVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAADLLSNFSWGPAFLELNKELLDIYQQ 194
           LVAANQVNYGRPW+LNCVEA+AAC AIVG  DLA +LLS+FSWG  FL+LN+ELL+IYQQ
Sbjct: 140 LVAANQVNYGRPWKLNCVEAIAACLAIVGFMDLAEELLSHFSWGVNFLKLNRELLEIYQQ 199

Query: 195 CTDHDSVKAAEEKWLQKIEQEAIERK--QQAKTEDIWMIGNVNRASRDLPGSSGEEEEED 252
           CTD D ++AA++ W+ +IE+E  ERK    A+  DIWM GNVNR       +  E+ E++
Sbjct: 200 CTDSDEIEAAQDAWMDQIEKEVQERKASNNAQNVDIWMSGNVNRIDESDEDNEDEDSEDE 259

Query: 253 YLNGDSLIDV-----RDIKYDSLGNVI 274
            +  D+L ++     R+++YD+LGN+I
Sbjct: 260 EVTYDNLGNIIENEPREVRYDNLGNII 286

>TBLA0A07250 Chr1 complement(1806584..1807498) [915 bp, 304 aa] {ON}
           Anc_6.19 YOR006C
          Length = 304

 Score =  325 bits (834), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 168/280 (60%), Positives = 201/280 (71%), Gaps = 17/280 (6%)

Query: 1   MGKGKNKESSTRPRSQKGSNGHSSRLNHKRMEMKH---VDSTTSKFPVKLAMWDFDHCDP 57
           M KGKNK      RS + SN      N +R E KH   + ST + FPVKLAMWDFDHCDP
Sbjct: 1   MAKGKNK--GHEERSNRKSN------NSRRNESKHSLSIKSTKTNFPVKLAMWDFDHCDP 52

Query: 58  KRCSGKKLERLGLIKSLRVGQKFQGVVVSPNGKTVVCPDDKALVEENGASVVECSWARLD 117
           KRCSGKKLER GL +SLRVGQ+F G+VVSPNGK VV P D+  +E+ G +VVECSWARLD
Sbjct: 53  KRCSGKKLERTGLAQSLRVGQRFNGMVVSPNGKRVVSPADRETIEQYGIAVVECSWARLD 112

Query: 118 EVPFNKIGGK--NERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAADLLSNF 175
           EVPFNK+GGK  NE LLPYLVAAN VNYGRPWRLNCVEA AAC AIVG  + A+ +L  F
Sbjct: 113 EVPFNKLGGKPSNEVLLPYLVAANPVNYGRPWRLNCVEAFAACLAIVGFKEYASKVLEGF 172

Query: 176 SWGPAFLELNKELLDIYQQCTDHDSVKAAEEKWLQKIEQEAIERKQQAKTEDIWMIGNVN 235
           SWG AFLELN ELLDIY  CTD  SV+ A+++WL+KIE E  ERK++  + D W+IGN N
Sbjct: 173 SWGHAFLELNDELLDIYGNCTDSISVEKAQDEWLEKIELENKERKEKMNSADAWLIGNTN 232

Query: 236 RASRDLPGSSGEEEEEDYLNGDSLIDVRDIKYDSLGNVIS 275
           R + +   +S E  E++     S +   D +YD+LGN+IS
Sbjct: 233 RKNLNDFDNSSESTEDNI----STVSSADERYDALGNLIS 268

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.132    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,114,485
Number of extensions: 1396863
Number of successful extensions: 3906
Number of sequences better than 10.0: 47
Number of HSP's gapped: 3979
Number of HSP's successfully gapped: 48
Length of query: 314
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 205
Effective length of database: 40,982,805
Effective search space: 8401475025
Effective search space used: 8401475025
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 65 (29.6 bits)