Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D01089g6.18ON90790748610.0
Kwal_56.224146.18ON96393920760.0
NCAS0D026506.18ON95094920570.0
KAFR0A050506.18ON94894320530.0
ZYRO0C07854g6.18ON94495520470.0
KNAG0F028706.18ON95494920060.0
KLTH0C11286g6.18ON95192220020.0
Kpol_1032.76.18ON96593119990.0
TDEL0G045106.18ON96994119930.0
Suva_15.1806.18ON94893319770.0
ACR008W6.18ON98194119670.0
NDAI0I022606.18ON96795619570.0
CAGL0E02695g6.18ON94693719530.0
Smik_15.1746.18ON94593219070.0
TBLA0G010406.18ON97297119080.0
YOR005C (DNL4)6.18ON94494319020.0
TPHA0M002606.18ON96695618870.0
Skud_15.1666.18ON94793818480.0
SAKL0F10912g7.343ON6933792852e-25
TPHA0D045707.343ON7363822801e-24
ZYRO0F11572g7.343ON7313892736e-24
Kwal_56.246167.343ON7153972683e-23
ACL155W7.343ON6972962665e-23
NDAI0A019407.343ON7653682648e-23
TBLA0E020507.343ON7203822631e-22
KLLA0D12496g7.343ON7003762612e-22
YDL164C (CDC9)7.343ON7552782568e-22
Suva_4.827.343ON7553682532e-21
TDEL0C020407.343ON7053762513e-21
Skud_4.937.343ON7553682496e-21
CAGL0I03410g7.343ON7243752487e-21
KNAG0C037407.343ON7273812488e-21
Smik_4.747.343ON8453682489e-21
Kpol_2001.717.343ON7263902471e-20
KLTH0H01408g7.343ON7232902452e-20
NCAS0A141107.343ON7533802433e-20
KAFR0B008307.343ON7103692317e-19
ZYRO0E07150g6.228ON449220820.40
Suva_16.846.242ON68961820.46
NCAS0G037402.302ON41877800.66
CAGL0J11528g2.57ON557114761.9
Smik_6.4276.242ON68863762.2
ADR369C7.46ON82794762.3
Ecym_51464.377ON380119742.9
Skud_7.4023.447ON601105753.1
CAGL0L03047g1.261ON71551744.1
Kwal_55.215575.630ON271163708.7
TPHA0H005108.126ON149295719.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D01089g
         (907 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {O...  1877   0.0  
Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {...   804   0.0  
NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.1...   796   0.0  
KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6...   795   0.0  
ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} simila...   793   0.0  
KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.1...   777   0.0  
KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} simila...   775   0.0  
Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON...   774   0.0  
TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.1...   772   0.0  
Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {...   766   0.0  
ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic ho...   762   0.0  
NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {O...   758   0.0  
CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {...   756   0.0  
Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {...   739   0.0  
TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {O...   739   0.0  
YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON} ...   737   0.0  
TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON...   731   0.0  
Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {...   716   0.0  
SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {...   114   2e-25
TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.3...   112   1e-24
ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} simila...   109   6e-24
Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL1...   107   3e-23
ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homo...   107   5e-23
NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {O...   106   8e-23
TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.3...   105   1e-22
KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]...   105   2e-22
YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}  ...   103   8e-22
Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}...   102   2e-21
TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {O...   101   3e-21
Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}...   100   6e-21
CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {...   100   7e-21
KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.3...   100   8e-21
Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}...   100   9e-21
Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON} (1951...   100   1e-20
KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {...    99   2e-20
NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON} Anc_7...    98   3e-20
KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.3...    94   7e-19
ZYRO0E07150g Chr5 complement(540507..541856) [1350 bp, 449 aa] {...    36   0.40 
Suva_16.84 Chr16 (139477..141546) [2070 bp, 689 aa] {ON} YPL222W...    36   0.46 
NCAS0G03740 Chr7 (690624..691880) [1257 bp, 418 aa] {ON} Anc_2.3...    35   0.66 
CAGL0J11528g Chr10 complement(1119969..1121642) [1674 bp, 557 aa...    34   1.9  
Smik_6.427 Chr6 complement(692098..694164) [2067 bp, 688 aa] {ON...    34   2.2  
ADR369C Chr4 complement(1362309..1364792) [2484 bp, 827 aa] {ON}...    34   2.3  
Ecym_5146 Chr5 (308809..309951) [1143 bp, 380 aa] {ON} similar t...    33   2.9  
Skud_7.402 Chr7 (679536..681341) [1806 bp, 601 aa] {ON}  (REAL)        33   3.1  
CAGL0L03047g Chr12 (352032..354179) [2148 bp, 715 aa] {ON} simil...    33   4.1  
Kwal_55.21557 s55 (888748..889563) [816 bp, 271 aa] {ON} YOR036W...    32   8.7  
TPHA0H00510 Chr8 complement(98545..103023) [4479 bp, 1492 aa] {O...    32   9.6  

>KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005C DNL4 DNA ligase required for nonhomologous end-
           joining (NHEJ) forms stable heterodimer with required
           cofactor Lif1p catalyzes DNA ligation as part of a
           complex with Lif1p and Nej1p involved in meiosis not
           essential for vegetative growth
          Length = 907

 Score = 1877 bits (4861), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 907/907 (100%), Positives = 907/907 (100%)

Query: 1   MNDCENFSPSPEFKWLCDELLGKIYETSSKKHLIGKPVTVRYLEIITNFIKLWRSTVGNY 60
           MNDCENFSPSPEFKWLCDELLGKIYETSSKKHLIGKPVTVRYLEIITNFIKLWRSTVGNY
Sbjct: 1   MNDCENFSPSPEFKWLCDELLGKIYETSSKKHLIGKPVTVRYLEIITNFIKLWRSTVGNY 60

Query: 61  IYPALRLIVPFRDRRIYNVKENTLIKALCRYLRLPKSSETENRLLRWKQRAARGVKLSDF 120
           IYPALRLIVPFRDRRIYNVKENTLIKALCRYLRLPKSSETENRLLRWKQRAARGVKLSDF
Sbjct: 61  IYPALRLIVPFRDRRIYNVKENTLIKALCRYLRLPKSSETENRLLRWKQRAARGVKLSDF 120

Query: 121 CVEEIRKRQKDYEGANRITIDELNGYLDEVSQEGNGKRMGYMALTDSRAFNYCLNHMTFM 180
           CVEEIRKRQKDYEGANRITIDELNGYLDEVSQEGNGKRMGYMALTDSRAFNYCLNHMTFM
Sbjct: 121 CVEEIRKRQKDYEGANRITIDELNGYLDEVSQEGNGKRMGYMALTDSRAFNYCLNHMTFM 180

Query: 181 EMKFFFDIILKTRVLSGLENMFLTAWHPDATDYLSVVSDLDVLSQRLYNPNERLRQTDLS 240
           EMKFFFDIILKTRVLSGLENMFLTAWHPDATDYLSVVSDLDVLSQRLYNPNERLRQTDLS
Sbjct: 181 EMKFFFDIILKTRVLSGLENMFLTAWHPDATDYLSVVSDLDVLSQRLYNPNERLRQTDLS 240

Query: 241 ITISHAFEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGV 300
           ITISHAFEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGV
Sbjct: 241 ITISHAFEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGV 300

Query: 301 DFSYLYGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQS 360
           DFSYLYGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQS
Sbjct: 301 DFSYLYGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQS 360

Query: 361 ELAGIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKAI 420
           ELAGIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKAI
Sbjct: 361 ELAGIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKAI 420

Query: 421 NAEAIKDSLEQAISMGSEGIVLKHLHSKYFVGSRNTDWIKIKPEYLEQFGENMDLLIIGR 480
           NAEAIKDSLEQAISMGSEGIVLKHLHSKYFVGSRNTDWIKIKPEYLEQFGENMDLLIIGR
Sbjct: 421 NAEAIKDSLEQAISMGSEGIVLKHLHSKYFVGSRNTDWIKIKPEYLEQFGENMDLLIIGR 480

Query: 481 EQGKKDSFFCGLSISDPNEVAEKPRFISFCTIANGLSNEEFKDIERKTWGKWHIFSEDPP 540
           EQGKKDSFFCGLSISDPNEVAEKPRFISFCTIANGLSNEEFKDIERKTWGKWHIFSEDPP
Sbjct: 481 EQGKKDSFFCGLSISDPNEVAEKPRFISFCTIANGLSNEEFKDIERKTWGKWHIFSEDPP 540

Query: 541 SPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTKESEKRKYRSGCTLHFGYCKQIRYDKD 600
           SPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTKESEKRKYRSGCTLHFGYCKQIRYDKD
Sbjct: 541 SPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTKESEKRKYRSGCTLHFGYCKQIRYDKD 600

Query: 601 WKTVASFSEFEDMKDARNFYNKRKSHQVTDGKKRASKRAKIGIVNSSEPTALVAPVSNTF 660
           WKTVASFSEFEDMKDARNFYNKRKSHQVTDGKKRASKRAKIGIVNSSEPTALVAPVSNTF
Sbjct: 601 WKTVASFSEFEDMKDARNFYNKRKSHQVTDGKKRASKRAKIGIVNSSEPTALVAPVSNTF 660

Query: 661 SNCRFRVISDYFDSTKRRRISQEDLCSVILEHGGEIVYTSDENNLPQDNLYIIGEKLTRE 720
           SNCRFRVISDYFDSTKRRRISQEDLCSVILEHGGEIVYTSDENNLPQDNLYIIGEKLTRE
Sbjct: 661 SNCRFRVISDYFDSTKRRRISQEDLCSVILEHGGEIVYTSDENNLPQDNLYIIGEKLTRE 720

Query: 721 CKILLNAKNLIIRPSWIFSCIEEGYKTPFTESDIFRGELESSMDCSQFYTDFNTASLNHL 780
           CKILLNAKNLIIRPSWIFSCIEEGYKTPFTESDIFRGELESSMDCSQFYTDFNTASLNHL
Sbjct: 721 CKILLNAKNLIIRPSWIFSCIEEGYKTPFTESDIFRGELESSMDCSQFYTDFNTASLNHL 780

Query: 781 LETANRGIKNPDSDLLLPEVPLFLFSNLKLAVLNSENVLDTSILEVEFAIKCHGGELVHI 840
           LETANRGIKNPDSDLLLPEVPLFLFSNLKLAVLNSENVLDTSILEVEFAIKCHGGELVHI
Sbjct: 781 LETANRGIKNPDSDLLLPEVPLFLFSNLKLAVLNSENVLDTSILEVEFAIKCHGGELVHI 840

Query: 841 ENASIIIVFNDFISREDLFSLRQKIASKAVKESTESTPRIPRMVDISWALDSIKDNYIAE 900
           ENASIIIVFNDFISREDLFSLRQKIASKAVKESTESTPRIPRMVDISWALDSIKDNYIAE
Sbjct: 841 ENASIIIVFNDFISREDLFSLRQKIASKAVKESTESTPRIPRMVDISWALDSIKDNYIAE 900

Query: 901 TEHYQCL 907
           TEHYQCL
Sbjct: 901 TEHYQCL 907

>Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {ON}
           YOR005C (DNL4) - ATP dependent DNA ligase [contig 185]
           FULL
          Length = 963

 Score =  804 bits (2076), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/939 (46%), Positives = 590/939 (62%), Gaps = 48/939 (5%)

Query: 5   ENFSPSPEFKWLCDELLGKIYETSSKKHLIGKPVTVRYLEIITNFIKLWRSTVGNYIYPA 64
           +NF+PSP+F+WLCDEL  K+ E +  +  +GK VTV+ +E+I  FIKLWR+TVG+ IYP 
Sbjct: 37  QNFAPSPDFRWLCDELFSKLEEITEDRQKLGKAVTVKRVEVIMYFIKLWRTTVGDNIYPV 96

Query: 65  LRLIVPFRDRRIYNVKENTLIKALCRYLRLPKSSETENRLLRWKQRAARGVKLSDFCVEE 124
           LRLI+P+RD R YN+K+ TL+KA+CR L LPK S TE RLL WKQ A RG  LS FCVEE
Sbjct: 97  LRLILPYRDSRAYNIKDYTLVKAVCRSLNLPKDSLTEKRLLNWKQYAPRGTSLSKFCVEE 156

Query: 125 IRKRQKDYEGANRITIDELNGYLDEVSQEGNGKRMGYMALTDSRAFNYCLNHMTFMEMKF 184
           I KR+K+ +G+ R+TID LN  LDE+S+E + K+ G+  L+ S +F  CL +M+F E ++
Sbjct: 157 IMKRRKEPQGSQRLTIDALNKCLDELSKEASAKKWGFNGLSKSPSFQNCLQNMSFSEQRY 216

Query: 185 FFDIILKTRVLSGLENMFLTAWHPDATDYLSVVSDLDVLSQRLYNPNERLRQTDLSITIS 244
           FFDIILKTRV+ GLE+ FL  WHPDA DYL VVSDL VLS+ L+NP  RL + +LSI I 
Sbjct: 217 FFDIILKTRVIGGLEHKFLNCWHPDAQDYLGVVSDLKVLSETLWNPTMRLGKNELSINIG 276

Query: 245 HAFEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGVDFSY 304
            AF P LAKR HLSYERV +KL+ DFIIEEKMDGER+Q+HYI  G +I++LSRRG DF++
Sbjct: 277 RAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERIQLHYIERGAKIRFLSRRGTDFTH 336

Query: 305 LYGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQSELAG 364
           LYG++   G IS  LK   +V+DC+LDGEM+++D EK++VLPFG+VKS+AM ++ +    
Sbjct: 337 LYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEKNVVLPFGIVKSTAMEELMNSDTK 396

Query: 365 IAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKAINAEA 424
           +  T+ Y+PL++ FDLVYLNG SLT L L  RK YL  IL+PV   VEI+  ++A    A
Sbjct: 397 VD-TDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRSILSPVANIVEILSDVRASEPNA 455

Query: 425 IKDSLEQAISMGSEGIVLKHLHSKYFVGSRNTDWIKIKPEYLEQFGENMDLLIIGREQGK 484
           IK SLE+AI MGSEGI+LK   S Y +G+RN  WIKIKPEY E+ GE MDL++IGR+ GK
Sbjct: 456 IKVSLERAIEMGSEGIILKQFSSPYEIGARNDSWIKIKPEYFEELGETMDLVVIGRDPGK 515

Query: 485 KDSFFCGLSISDPNEVA---------------EKPRFISFCTIANGLSNEEFKDIERKTW 529
           KDS  CGL ++D  + +                 P+ ISFC IANG+S+ EFK+IERKT 
Sbjct: 516 KDSLMCGLILADETDGSSVNLASQDDPLRPKQRNPKVISFCNIANGVSDAEFKEIERKTR 575

Query: 530 GKWHIFSEDPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTKESEKRKYRSGCTLHF 589
           G W++ +  PP   LL FGTK+P EWI P  S+VLEVKAR++DT E   +KY++G TL  
Sbjct: 576 GLWNLTTACPPPSGLLEFGTKLPTEWIDPRSSLVLEVKARSVDTDELSSKKYKTGSTLRG 635

Query: 590 GYCKQIRYDKDWKTVASFSEFEDMKDARNFY-NKRKSHQVTDGKKRASKRAKIGIVNSSE 648
            YC+ +R++KDW T A+  ++E  K A N++  KRKSHQ++  K+R        + N SE
Sbjct: 636 AYCRALRFNKDWSTCATVQQYEQAKRAHNYHKGKRKSHQISPRKQRK-------LANVSE 688

Query: 649 PTALVAP-------VSNTFSNCRFRVISDYFDSTKRRRISQEDLCSVILEHGGEIVYTSD 701
              L+A         SN F   +F ++SDY DS K +R  ++ + +++ ++ G +++ + 
Sbjct: 689 LYPLLADDSRESIFESNIFQGLQFYILSDYIDSQK-KRYEKDQIGTLVRKNSGHVLHNNF 747

Query: 702 ENNLPQDNLYIIGEKLTRECKILLNAKNLIIRPSWIFSCIEEGYKTPFTESDIFRGELES 761
                   L II  K T EC+ L      II PSWIF C+  G          FR   + 
Sbjct: 748 VRREEFSRLRIISGKNTVECRSLTEKGYDIIHPSWIFDCLNYGSLVKLEPRHCFRTSRKL 807

Query: 762 SMDCSQFYTDFNTASLNHLLETANRGIKNPDS----DLLLPE----VPLFLFSNLKLAVL 813
             +  Q    F  +    L  T    + N  S     L  PE    +PLFLF N K+   
Sbjct: 808 LENSRQRVDRFGDSFCRPLSYTEFDELVNGQSVVSPHLSAPEELDGIPLFLFQNFKIYFA 867

Query: 814 NSENVLDTSILEVEFAIKCHGGEL-VHIENASIIIVFNDFISREDLF----SLRQKIASK 868
              N  D     +E  ++  GGE  + ++  ++++V   F  ++ LF     LR++IAS 
Sbjct: 868 RVGNDPDQEEY-LEKTLRLFGGERSLTLDCCNLVVVRVSFKEQKKLFKLVEGLRKRIAST 926

Query: 869 AVKESTESTPRIPRMVDISWALDSIKDNYIAETEHYQCL 907
           A   S+E   RIP +V  +W    I +  +   E +  L
Sbjct: 927 AY--SSEVDHRIPHLVSSNWLEACINEQCLVPEEDFPPL 963

>NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.18
           YOR005C
          Length = 950

 Score =  796 bits (2057), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/949 (46%), Positives = 592/949 (62%), Gaps = 55/949 (5%)

Query: 1   MNDCENFSPSPEFKWLCDELLGKIYETSSKKHL--IGKPVTVRYLEIITNFIKLWRSTVG 58
           M  C NFSPSP F+WLCDEL  K+ +  SK+    IGKPVTVRY E+I +FI LWR TVG
Sbjct: 15  MTPC-NFSPSPAFQWLCDELFVKLEDIQSKRDPKNIGKPVTVRYYEVINHFIALWRKTVG 73

Query: 59  NYIYPALRLIVPFRDRRIYNVKENTLIKALCRYLRLPKSSETENRLLRWKQRAARGVKLS 118
           N I+PAL LI+P+RDRR++N+++ TLIKA+C YL+LP++S TE RLL WK RA +GVKLS
Sbjct: 74  NDIFPALILILPYRDRRLFNIRDYTLIKAICAYLKLPRNSFTEKRLLSWKARAGKGVKLS 133

Query: 119 DFCVEEIRKRQKDYEGANRITIDELNGYLDEVSQEGNGKRMGYMALTDSRAFNYCLNHMT 178
            FCV EI+KR+ + +    ITID LN  LD++++E N K  G+  L DS  F +CL +M+
Sbjct: 134 QFCVNEIKKRKSEPKDKIEITIDRLNECLDKLAEERNSKGRGFKKLADSPTFKFCLENMS 193

Query: 179 FMEMKFFFDIILKTRVLSGLENMFLTAWHPDATDYLSVVSDLDVLSQRLYNPNERLRQTD 238
           F+E++FFFDI+LK RV+ G E+ FL AWHPDA DYLSVVSDL  ++ RL++P  RL+  D
Sbjct: 194 FIELQFFFDILLKNRVIGGQEHKFLNAWHPDAQDYLSVVSDLRTVTTRLWDPEIRLQNND 253

Query: 239 LSITISHAFEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRR 298
           L I    AF PQLAK+  +SYE++  KL++DFIIEEKMDGER+Q+HY +YGE++K+ SRR
Sbjct: 254 LVINPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFFSRR 313

Query: 299 GVDFSYLYGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQI 358
           G D++YLYGE+   G I   LKL+ +VKDCILDGEMITYD  ++++LPFGLVKSSA + +
Sbjct: 314 GTDYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSARSML 373

Query: 359 QSELAGIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMK 418
             +  GI   E Y+PLF+ FDL+++NG SL N+ L  RK+YL  I TP    +E++    
Sbjct: 374 TKD--GIM-NEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSYH 430

Query: 419 AINAEAIKDSLEQAISMGSEGIVLKHLHSKYFVGSRNTDWIKIKPEYLEQFGENMDLLII 478
             N ++I+ SLE AISMGSEGIVLK   S+Y V SRN DWIK+KPEYLEQFGENMDL++I
Sbjct: 431 RFNEDSIRKSLELAISMGSEGIVLKRYDSRYTVASRNDDWIKVKPEYLEQFGENMDLIVI 490

Query: 479 GREQGKKDSFFCGLSISDPNEVA-----------------EKP--------RFISFCTIA 513
           GR+ GKKDS  CGL++ + +E A                 + P        +F+SFC IA
Sbjct: 491 GRDPGKKDSLMCGLAVVEEDEKADLNENNDDNVIILDDDEDAPVEQERTIHKFVSFCVIA 550

Query: 514 NGLSNEEFKDIERKTWGKWHIFSEDPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDT 573
           NGLS EEFK I+RKT G W+   E PP   LL FGT++P EWI P+ SVV+EVKAR+ID 
Sbjct: 551 NGLSQEEFKQIDRKTRGLWNRSDEIPPPDTLLQFGTRLPIEWIDPKKSVVIEVKARSIDA 610

Query: 574 KESEKRKYRSGCTLHFGYCKQIRYDKDWKTVASFSEFEDMKDARNFYNKRKSHQVTDGKK 633
            ES  RK+ +GCTL+ GYC+ IR DKDW+T  + SEF   K+ ++  N   S QV  G K
Sbjct: 611 AESNGRKFATGCTLYGGYCRGIREDKDWQTCYTLSEFLRTKNVKSRRN--GSDQVIHGVK 668

Query: 634 RASKRAKIGIVNSS-EPTALVAPVSNTFSNCRFRVISDYFDSTKRRRISQEDLCSVILEH 692
           R  K  +  I++ S E    +   +  F N  F VISD FD     RI +E +   I E 
Sbjct: 669 RQKKNRRKYILDQSLEEEGGLLKNTAFFRNLYFYVISDVFDDVLGTRIEKERMYKYIQEG 728

Query: 693 GGEIVYTSDENNLPQDNLYIIGEKLTRECKILLNAKNLIIRPSWIFSCIEEGY------K 746
           GG +++          NL II  KLT EC  L+     +I P WI  C++         K
Sbjct: 729 GGTLIHNIISKQFGTRNLRIISGKLTNECSALIERGYDVINPQWIVDCVQSKSLLKLEPK 788

Query: 747 TPFTESDIFRGELESSMDC--SQFYTDFNTASLNHLLETA-----NRGIKNPDSDLLLPE 799
             F  S   +   E  +D     +        L+ LLET       +G+  P +D  L +
Sbjct: 789 YCFNVSTELKKLTEKRVDTFGDSYEVPITEEQLSTLLETELNLVRVQGLVTPYADEELIK 848

Query: 800 VPLFLFSNLKLAVLNSENVLDTSILEVEFAIKCHGGEL-VHIENASIIIVFNDFISREDL 858
           +PLFLF +  +   N+E+    +I  ++  IK +GG+L   I   ++II+ N     + L
Sbjct: 849 IPLFLFQDRIMLFPNTES---KTISFLQEKIKLYGGKLTTDIGKCNLIILPN---GNQQL 902

Query: 859 FSLRQKIASKAVKESTESTPRIPRMVDISWALDSIKDNYIAETEHYQCL 907
               + + +K +  S E  P IP +V+  W   SI++N     E Y  +
Sbjct: 903 LQRTRDLLTKNIMNSGE-VPTIPYIVNPLWIERSIEENSQVPEEDYPVI 950

>KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6.18
           YOR005C
          Length = 948

 Score =  795 bits (2053), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/943 (46%), Positives = 593/943 (62%), Gaps = 54/943 (5%)

Query: 6   NFSPSPEFKWLCDELLGKIYETSSKKHLIGKPVTVRYLEIITNFIKLWRSTVGNYIYPAL 65
           NF+PSP+FKWLC+EL  K+ E  +++HL  K +T+RY EIITNF+ LWR+TVG+ IYPAL
Sbjct: 13  NFAPSPQFKWLCEELFSKLEEVPNQRHLTTKRITLRYYEIITNFVNLWRTTVGDDIYPAL 72

Query: 66  RLIVPFRDRRIYNVKENTLIKALCRYLRLPKSSETENRLLRWKQRAARGVKLSDFCVEEI 125
            L +P+RDRR+YNVK+ TLIKA+C YL+LPK+S TE RLL WKQRA R VKLS  CV E+
Sbjct: 73  ILALPYRDRRMYNVKDYTLIKAICTYLKLPKNSFTEKRLLNWKQRADRSVKLSVSCVNEM 132

Query: 126 RKRQKDYEGANRITIDELNGYLDEVSQEGNGKRMGYMALTDSRAFNYCLNHMTFMEMKFF 185
           RKR+ +    + IT+DELN  LD +SQ+ N K  GY  L++S  F YC+  M+FME+++F
Sbjct: 133 RKRKSEPVEKSPITLDELNTLLDFLSQDRNIKGRGYKNLSESSIFTYCIEKMSFMELRYF 192

Query: 186 FDIILKTRVLSGLENMFLTAWHPDATDYLSVVSDLDVLSQRLYNPNERLRQTDLSITISH 245
           FDIILK RV+   E+  L AWHPDA DYLSVVSDL  +  RL+NPN RLR  +LSI I +
Sbjct: 193 FDIILKARVIGPHEHKLLNAWHPDAEDYLSVVSDLKTVCTRLWNPNIRLRHDELSINIGY 252

Query: 246 AFEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGVDFSYL 305
           AF P LAK+  +SY+++  KL++DF IEEKMDGER+QIHY++YG  IK+LSRRGVD++YL
Sbjct: 253 AFAPHLAKKLSISYDKICKKLKNDFFIEEKMDGERIQIHYMDYGNDIKFLSRRGVDYTYL 312

Query: 306 YGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQI-QSELAG 364
           YGEN S+G I+  LKL+ +VK+C+LDGEM+TYD ++DI+LPFG+VKS+AMN + + E++G
Sbjct: 313 YGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMNALTKEEISG 372

Query: 365 IAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKAINAEA 424
               + Y PL + FDLV+LNG SL    L +RKDYL  +L P    V+I+ + +  N   
Sbjct: 373 ----QDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRCSNENI 428

Query: 425 IKDSLEQAISMGSEGIVLKHLHSKYFVGSRNTDWIKIKPEYLEQFGENMDLLIIGREQGK 484
           I+ SLE AIS+GSEGIVLK+ +S+Y +GSRN  WIKIKPEYLEQFGENMDL++IGR+  K
Sbjct: 429 IRKSLEHAISVGSEGIVLKNYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVIGRDSAK 488

Query: 485 KDSFFCGLSISD--------------------------PNEVAEKPRFISFCTIANGLSN 518
           KDSF+CGL++ D                          P       + +SFC IANG+S 
Sbjct: 489 KDSFYCGLTVLDEEEEKLVEEIDKGVVNLVSDESDYENPENNRHIKKVVSFCMIANGISQ 548

Query: 519 EEFKDIERKTWGKWHIFSEDPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTKESEK 578
            E+K+I RKT G W    E PP P L+ FGT+VP EWI PE SVVLE+KAR++D  ES  
Sbjct: 549 NEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPMEWIEPEHSVVLEIKARSLDNTESSC 608

Query: 579 RKYRSGCTLHFGYCKQIRYDKDWKTVASFSEFEDMKDARNFYNKRKSHQVTDGKKRASKR 638
           +++++GCTL+ GYC++IR D DWK  +SFS  E  +D R  +    S + T  K +  ++
Sbjct: 609 KRFKAGCTLYGGYCRRIRDDVDWK--SSFSLAELRRDRRIKHYPGTSEKDTLLKSKKRRK 666

Query: 639 AK-IGIVNSSEPTALVAPVSNTFSNCRFRVISDYFDSTKRRRISQEDLCSVILEHGGEIV 697
            + +  +N +     +   S  F    F ++SDYFD+ +  RIS++DL  ++LE+GG+I 
Sbjct: 667 KQLLTPLNQNLNPRDIQTTSKIFDGLFFYILSDYFDTNENVRISKDDLQKLLLENGGKIS 726

Query: 698 YTSDENNLPQDNLYIIGEKLTRECKILLNAKNLIIRPSWIFSCIEEGYKTPFTESDIFRG 757
           +        + NL I+  K T EC +L+     I+ P W+  C+E         S  F  
Sbjct: 727 HNIVSKRESKSNLRILCGKYTAECNVLIKRGYDILSPQWVIDCVENKKIVKIEPSHCFSV 786

Query: 758 ELESSMDCSQFYTDFNTASLNHLLETAN-----RGIKNPDSDLLLP--------EVPLFL 804
             +  M  +    D    S   LL  +      R  K+   DLL P        +VP FL
Sbjct: 787 S-DDLMALAMRRVDKYGDSYESLLSVSRLSYILRSSKDISPDLLSPANMSLDFEKVPYFL 845

Query: 805 FSNLKLAVLNSENVLDTSILEVEFAIKCHGGELV-HIENASIIIVFNDFIS--REDLFSL 861
           F   K  V+   N   +SI E    I+ +GG++V +I   +I+I     I+  RE +  +
Sbjct: 846 FWRRKAFVM-EHNFDKSSIRETILKIQLYGGKVVKNISECNIVIFPKAEITVIRESMKFI 904

Query: 862 RQKIASKAVKESTESTPRIPRMVDISWALDSIKDNYIAETEHY 904
           R  +A K V  S E  P +PR+V   W   SI+ N     E Y
Sbjct: 905 RNTLA-KTVSTSVE-LPMLPRIVSFEWIDASIEKNVQVPEEDY 945

>ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 944

 Score =  793 bits (2047), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/955 (45%), Positives = 604/955 (63%), Gaps = 74/955 (7%)

Query: 2   NDCENFSPSPEFKWLCDELLGKI--YETSSKKHLIGKPVTVRYLEIITNFIKLWRSTVGN 59
           N   NF+PSP+FKWLCDEL  KI   +  ++ H   K +TV+Y EII+ F+KLWR TVG+
Sbjct: 9   NKPHNFAPSPDFKWLCDELFVKIDNVQKQTRDHGAFKSLTVKYFEIISFFVKLWRKTVGD 68

Query: 60  YIYPALRLIVPFRDRRIYNVKENTLIKALCRYLRLPKSSETENRLLRWKQRAARGVKLSD 119
            IYPAL LI+P+RDRRI+N+K+ TLIKA+C +LRLP +S TE RLLRWK+RA RG+KLSD
Sbjct: 69  NIYPALILILPYRDRRIFNIKDYTLIKAICSFLRLPANSVTEKRLLRWKRRAGRGIKLSD 128

Query: 120 FCVEEIRKRQKDYEGANRITIDELNGYLDEVSQEGNGKRMGYMALTDSRAFNYCLNHMTF 179
           FCVEEIR+R+ +     RITID+LN  LD++++E N K  G+ +L DS  F YCL +M+F
Sbjct: 129 FCVEEIRRRRSEPLNGERITIDKLNECLDQLAEERNTKGRGFKSLADSSVFKYCLENMSF 188

Query: 180 MEMKFFFDIILKTRVLSGLENMFLTAWHPDATDYLSVVSDLDVLSQRLYNPNERLRQTDL 239
            EMK++FDIILK+RV+ G E+ FL  WHPDA DYLSVVSDL  ++ +L++P+ RL+  DL
Sbjct: 189 TEMKYYFDIILKSRVIGGQEHKFLNCWHPDARDYLSVVSDLKTVADKLWDPSHRLKNDDL 248

Query: 240 SITISHAFEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRG 299
            + +   F P LAKR ++SY++VA +L+ DF IEEKMDGER+Q+HY++YG ++K+ SRRG
Sbjct: 249 GVNLGLPFAPFLAKRLYISYDKVALRLKSDFYIEEKMDGERIQLHYMDYGRKLKWFSRRG 308

Query: 300 VDFSYLYGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQ 359
            D++YLYGE+  +G ++  L+L   V++C+LDGEMI++DTE++ VLPFGLVKSSA + + 
Sbjct: 309 NDYTYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVKSSARDSLT 368

Query: 360 SELAGIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKA 419
           +E  GI  T+ Y+PL++  D +YLNG SL N+ L  RK YL+ IL P   +VEIIQ M  
Sbjct: 369 AE--GIL-TQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSMHC 425

Query: 420 INAEAIKDSLEQAISMGSEGIVLKHLHSKYFVGSRNTDWIKIKPEYLEQFGENMDLLIIG 479
            +  +IK SLE+AI MGSEGI+LKH  SKY +G+R  +WIKIKPEYLEQFGEN+DLL+IG
Sbjct: 426 YDDTSIKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPEYLEQFGENLDLLVIG 485

Query: 480 REQGKKDSFFCGLSISDPNEVA----------------EKPR-----FISFCTIANGLSN 518
           R+ GKKDS  CGL++ + +E                  E+PR     FISFCTIANG+S 
Sbjct: 486 RDPGKKDSLMCGLAVLEGDEEPGAQSDKQVVNLDSEEEEEPRKAVKKFISFCTIANGISQ 545

Query: 519 EEFKDIERKTWGKWHIFSEDPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTKESEK 578
           EEFK IERKT GKW   +ED   P +L FG+K+P EWI+PEDSVVLEVKAR++D  ES  
Sbjct: 546 EEFKQIERKTAGKWK-NTEDHKPPKILEFGSKLPEEWIYPEDSVVLEVKARSLDNTESSG 604

Query: 579 RKYRSGCTLHFGYCKQIRYDKDWKTVASFSEFEDMKDARNFYNKRKSHQVTDGKKRASKR 638
           RK++ GCTLH GYC++IR DK+W    +  E    +  +   ++  ++Q     K+  + 
Sbjct: 605 RKFKVGCTLHGGYCRRIREDKNWTECYTLYELWQERRKKVPLSEDSNNQKPMKSKKIRRP 664

Query: 639 AKIGIVNSSEPTALVAPVSNTFSNCRFRVISDYFDSTKRRRISQEDLCSVILEHGGEIVY 698
             +  +N +      A  S+ F    F VISDY  S    RIS+E LC +I  +GG++ +
Sbjct: 665 RIVSRLNQTLSCDDEAKTSSIFDGLIFYVISDYMASQDSERISKEQLCDLISGNGGKLTF 724

Query: 699 TSDENNLPQDNLYIIGEKLTRECKILLNAKNLIIRPSWIFSCIEEGY------------- 745
               ++  +  L II  K T ECK L+     I+ P W+  C+  G+             
Sbjct: 725 NVISDHRVKGGLRIISGKYTLECKALIERGYDILSPQWLMDCVNTGFLVTIEPRHCFSVS 784

Query: 746 ----KTPFTESDIF---------RGELESSMDCSQFYTDFNTASLNHLLETANRGIKNPD 792
               K   T  D F            L   +   +F +DF+T SL+ + +          
Sbjct: 785 EDMEKIARTRVDHFGDSYDVEITEDRLRDILTSKEFDSDFSTGSLDVISD---------- 834

Query: 793 SDLLLPEVPLFLFSNLKLAVLNSENVLDTSILEVEFAIKCHGGELV-HIENASIIIVFND 851
               + ++PLFLFS   + +    + LDT +L  +  ++ +GG+L  ++   ++IIV + 
Sbjct: 835 ----VEDIPLFLFSRRIVFIPEGFSYLDTQLL--KHKVRLYGGQLTDNVNQCNLIIVPDG 888

Query: 852 FIS-REDLFS-LRQKIASKAVKESTESTPRIPRMVDISWALDSIKDNYIAETEHY 904
            I+ R  + S LR+ +++ A    TE  P IP +V  +W   SI++N     E +
Sbjct: 889 KINLRGRIISDLRRLLSTFAA--MTELPPAIPWIVIPAWIDRSIEENIQVPEEDF 941

>KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.18
           YOR005C
          Length = 954

 Score =  777 bits (2006), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/949 (44%), Positives = 587/949 (61%), Gaps = 53/949 (5%)

Query: 6   NFSPSPEFKWLCDELLGKIYETSSKKHLIG-KPVTVRYLEIITNFIKLWRSTVGNYIYPA 64
           NF+PSP+F+WLCDEL  K    +++   I  KP+TVRY E+++NF++LWR TVGN  YP 
Sbjct: 11  NFAPSPDFQWLCDELFVKFDLVATQDRRINLKPITVRYYEVVSNFVQLWRKTVGNNFYPV 70

Query: 65  LRLIVPFRDRRIYNVKENTLIKALCRYLRLPKSSETENRLLRWKQRAARGVKLSDFCVEE 124
           L L +P+RDRR YN+K+ TLIKA+C YL LPK S TE +LL WKQRA+R  +LS FCV E
Sbjct: 71  LILALPYRDRRTYNIKDVTLIKAICLYLDLPKRSSTEKKLLNWKQRASRNERLSSFCVAE 130

Query: 125 IRKRQKDYEGANR--ITIDELNGYLDEVSQEGNGKRMGYMALTDSRAFNYCLNHMTFMEM 182
           IRKR+   + + R  IT+D+LN  LD+++   + +  G   L DS  F +CL +M+F+E+
Sbjct: 131 IRKRKSGPDPSKRQAITLDKLNSILDDLANGKSSRGQGSRTLADSSHFKFCLENMSFIEL 190

Query: 183 KFFFDIILKTRVLSGLENMFLTAWHPDATDYLSVVSDLDVLSQRLYNPNERLRQTDLSIT 242
           K+FFDI+LK R++ G E+  L AWHPDA DY SVVSDL  ++++LY P+ RLR  DL++ 
Sbjct: 191 KYFFDILLKVRIIGGHEHKLLNAWHPDAVDYFSVVSDLSSVTKKLYEPSVRLRNEDLTLK 250

Query: 243 ISHAFEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGVDF 302
           I  AF P LAKR ++SYE++  KL  DF IEEKMDGER+QIHY++YG +IK+LSRRG D+
Sbjct: 251 IGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEIKFLSRRGTDY 310

Query: 303 SYLYGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQSEL 362
           +YLYG ++S+G I+  LKL+ NVK+CILDGEM+TYD EK ++LPFGLVKSSA N +  E 
Sbjct: 311 TYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKSSAKNFLSKES 370

Query: 363 AGIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKAINA 422
                  SY PLF+AFDLVYLNG SL +L L +RKDYL+KILT     V+I+ + +  N 
Sbjct: 371 IS---NGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVSFARCNNL 427

Query: 423 EAIKDSLEQAISMGSEGIVLKHLHSKYFVGSRNTDWIKIKPEYLEQFGENMDLLIIGREQ 482
           E+I  SL  AIS+GSEGI+LK L+S+Y V SRN  WIKIKP+YL+QFGENMDL+IIGR+ 
Sbjct: 428 ESITKSLAAAISVGSEGIILKKLNSRYMVASRNDSWIKIKPQYLKQFGENMDLIIIGRDP 487

Query: 483 GKKDSFFC--GLSISDP------------------NEVAEKP------RFISFCTIANGL 516
           GKKD+F C  G++I DP                  +   E P      +F+SFCTIANG+
Sbjct: 488 GKKDAFMCALGVTIDDPQPRVLQQEENVNLDLDTEDSEPETPKASRIVKFVSFCTIANGI 547

Query: 517 SNEEFKDIERKTWGKWHIFSEDPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTKES 576
           SN EFK+I++KT G W  F +  P    L FGTK P EWI P++S+VLEVK+R++D  ES
Sbjct: 548 SNAEFKEIDQKTRGLWRRFDQVKPPSEYLQFGTKKPVEWIDPKESLVLEVKSRSLDNTES 607

Query: 577 EKRKYRSGCTLHFGYCKQIRYDKDWKTVASFSEFE-DMKDARNFYNKRKSHQVTD-GKKR 634
             +KYR+G TL  GYC+ +RYDKDW T  + SEFE D +      N  +S   ++ G+K+
Sbjct: 608 NVKKYRAGVTLFGGYCRAVRYDKDWTTCYTVSEFERDRQYKLPKVNAGESITTSNKGRKK 667

Query: 635 ASKRAKIGIVNSSEPTALVAPVSNTFSNCRFRVISDYFDSTKRRRISQEDLCSVILEHGG 694
            +  + +G+++  +        S+ F N  F V+SDY D     RI +  L  +I+++GG
Sbjct: 668 RNTTSILGVISPRKKRTPEGEHSDIFQNLHFCVLSDYLDPYTGNRIDRNTLTQLIIDYGG 727

Query: 695 EIVYTSDENNLPQDNLYIIGEKLTRECKILLNAKNLIIRPSWIFSCIEEGYKTPFTESDI 754
           +++Y        +  L II +    EC  L+     I+ PSW+  CIE         +  
Sbjct: 728 KVIYNVLAKEGEEGMLRIICDGFNMECNALIKRGYDILSPSWVLDCIESARLLKLERNHC 787

Query: 755 FRGELE----SSMDCSQ----FYTDFNTASLN-----HLLETANRGIKNPDSDLLLPEVP 801
           F    E    SS    +    F  + +T  L+     HL    +      + D  L  +P
Sbjct: 788 FNVSKELMELSSTRVDEYDDSFENEISTTRLDRLIDVHLHNMPSGSFSGENLDFELRGLP 847

Query: 802 LFLFSNLKLAVLNSENVLDTSILEVEFAIKCHGGELVH-IENASIIIVFNDFISREDLFS 860
             LF +  + +  ++ + D    ++    K  GG++ H IE+ ++II+ N     ED   
Sbjct: 848 PLLFFDRSVFIAETK-LSDRIYAKISSETKLFGGQVTHTIEDCNLIIIPN--TDDEDKIQ 904

Query: 861 LRQKIASK--AVKESTESTPRIPRMVDISWALDSIKDNYIAETEHYQCL 907
           + QKI  K  ++ +   ST RIP +V   W   SIK+N     E+Y  L
Sbjct: 905 VLQKIRGKLASMIQKLNSTERIPPIVSEEWLYQSIKENIQVPEENYSVL 953

>KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 951

 Score =  775 bits (2002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/922 (44%), Positives = 594/922 (64%), Gaps = 43/922 (4%)

Query: 2   NDCENFSPSPEFKWLCDELLGKIYETSSKKHLIGKPVTVRYLEIITNFIKLWRSTVGNYI 61
           N+  NF+PSP+F+WLC+EL  ++   +  +  +GK VTV+ +EIIT FIKLWR+TVG+  
Sbjct: 19  NEPHNFAPSPDFRWLCEELFHRLDAINEHRQELGKAVTVKRVEIITCFIKLWRTTVGDDF 78

Query: 62  YPALRLIVPFRDRRIYNVKENTLIKALCRYLRLPKSSETENRLLRWKQRAARGVKLSDFC 121
           +PALRL+ P+RD R Y++K+ TLIKA+C+ L L + S TE RLL WKQ A RG  LS FC
Sbjct: 79  FPALRLMFPYRDPRAYHIKDFTLIKAVCKALNLSRDSLTERRLLNWKQYAGRGTSLSKFC 138

Query: 122 VEEIRKRQKDYEGANRITIDELNGYLDEVSQEGNGKRM-GYMALTDSRAFNYCLNHMTFM 180
           V+EI KR+K+     ++TID LN  LDE+++E +GK+  G   L++S +F +CL +++F+
Sbjct: 139 VQEISKRRKEPLPERQLTIDGLNEKLDELAKEASGKKAWGTTGLSESHSFQFCLKNLSFL 198

Query: 181 EMKFFFDIILKTRVLSGLENMFLTAWHPDATDYLSVVSDLDVLSQRLYNPNERLRQTDLS 240
           E+++FFDI+LK RV+ GLE+ FL  WHPDA  YL VV+DL +LS++L+NP+ RL + DLS
Sbjct: 199 ELRYFFDIVLKNRVIGGLEHKFLACWHPDAQIYLGVVTDLKILSKKLWNPSVRLDKRDLS 258

Query: 241 ITISHAFEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGV 300
           I I HAF P LAKR H+SYER+ SKL+HDFI+EEKMDGER+Q+HY+N G  +K+LSRRG+
Sbjct: 259 INIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRRGI 318

Query: 301 DFSYLYGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQ-IQ 359
           DFS+LYG+  + G IS  LKL  +V+DC+LDGEM++YD ++ I+LPFG+VKS+A+++ I 
Sbjct: 319 DFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKSAAVDELIN 378

Query: 360 SELAGIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKA 419
           SE+      + Y+PL++ FDLVYLNG SLT + L  RK+YL +IL+PV   VEI++ ++A
Sbjct: 379 SEVGN--ENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRA 436

Query: 420 INAEAIKDSLEQAISMGSEGIVLKHLHSKYFVGSRNTDWIKIKPEYLEQFGENMDLLIIG 479
            +A+AIK+ +++AI MGSEG+++K   S Y VG+RN  W+KIKPEY E  GE MDL++IG
Sbjct: 437 CDAKAIKNFMQRAIEMGSEGVIVKQASSTYEVGARNDHWVKIKPEYFEDLGETMDLVVIG 496

Query: 480 REQGKKDSFFCGLSISDPNEVAEK-------------PRFISFCTIANGLSNEEFKDIER 526
           R+ GKKDS  CGL +SD   + E               + +SFC +ANG+S+EEFK+I R
Sbjct: 497 RDPGKKDSLMCGLLVSDSEHILENFGPIEHGKEGDPIIKCVSFCNVANGVSDEEFKEINR 556

Query: 527 KTWGKWHIFSEDPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTKESEKRKYRSGCT 586
           KT G W  + E PP  +LL FG+K+P EWI P++SVV+EVKAR+++  E   ++YR+G T
Sbjct: 557 KTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARSVENSEYSSKRYRAGST 616

Query: 587 LHFGYCKQIRYDKDWKTVASFSEFEDMKDARNFYN-KRKSHQVTDGKKRASKRAKIGIVN 645
           LH  YC++IR DKDW T  S ++++  K A N++  KRK HQV+  +KR           
Sbjct: 617 LHSAYCRRIRNDKDWTTCTSVAQYQQAKAAHNYHRYKRKVHQVSPRRKRNVHEI-FEYCA 675

Query: 646 SSEPTALVAPVSNTFSNCRFRVISDYFDSTKRRRISQEDLCSVILEHGGEIVYTSDENNL 705
               + L    S+ F    F ++SDY  +++RRR  +  + + +++HGG IV   D    
Sbjct: 676 GEAKSELDTEGSSIFEGLHFYILSDYV-TSQRRRYERGMVAAKVVKHGGLIVKNIDMRPE 734

Query: 706 PQDNLYIIGEKLTRECKILLNAKNLIIRPSWIFSCIEEGYKTPFTESDIF---RGELESS 762
               L I+  K T EC+ L+N    II P WIF CI  G++        F   R  L++S
Sbjct: 735 HLSYLRIVSGKTTIECRNLVNRGYDIIDPCWIFDCISAGFQLGIEPKHCFQTSRRLLDNS 794

Query: 763 MDCSQFYTD-----FNTASLNHLLE---TANRGIKNPDSDLL---LPEVPLFLFSNLKLA 811
                 Y D      +T     L +   ++     +  S +L   L E PLFL    K+ 
Sbjct: 795 RQRVDQYGDSFSRPLDTTEFQQLFKFFCSSPSDFSSRISSMLQDDLDEAPLFLLQRFKIY 854

Query: 812 VLNSENVLDT-SILEVEFAIKCHGGELVH-IENASIIIVFNDFISREDLF---SLRQKIA 866
           VL ++ +    SIL  +  I+ +GG +   +E A++++V +   +    +    LRQKIA
Sbjct: 855 VLAADLIPQQFSILRRK--IELYGGVVSETLEGANLVLVPSALSTARTAYYVQELRQKIA 912

Query: 867 SKAVKESTESTPRIPRMVDISW 888
             A   +T +  RIP +V   W
Sbjct: 913 GNAFAGNTNT--RIPHIVRSEW 932

>Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON}
           complement(12295..15192) [2898 nt, 966 aa]
          Length = 965

 Score =  774 bits (1999), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/931 (45%), Positives = 584/931 (62%), Gaps = 54/931 (5%)

Query: 2   NDCE---NFSPSPEFKWLCDELLGKIYETSSK-KHLIG-KPVTVRYLEIITNFIKLWRST 56
           ND E   NFSPSP+FKWLCDEL  K+ +   + K L G KP  + Y +II NFI +WR T
Sbjct: 26  NDIEEPHNFSPSPDFKWLCDELFVKLDQIQFRPKELNGSKPKYIEYYDIINNFIDIWRRT 85

Query: 57  VGNYIYPALRLIVPFRDRRIYNVKENTLIKALCRYLRLPKSSETENRLLRWKQRAARGVK 116
           VGN IYPAL L +P+RDRR+YN+KE+ LI+ +C YL+LPK+SETE RL+RWK RA R V+
Sbjct: 86  VGNDIYPALILTIPYRDRRMYNIKESKLIRIVCDYLKLPKNSETERRLMRWKHRADRNVR 145

Query: 117 LSDFCVEEIRKRQKDYEGANRITIDELNGYLDEVSQEGNGKRMGYMALTDSRAFNYCLNH 176
           LS FCVEEI+KR+ +     +ITID+LN  LD +  E   K      +++S  F +C  +
Sbjct: 146 LSTFCVEEIKKRKGEPREKIKITIDKLNECLDNLVLERGYKGSKSQKISESETFKFCFEN 205

Query: 177 MTFMEMKFFFDIILKTRVLSGLENMFLTAWHPDATDYLSVVSDLDVLSQRLYNPNERLRQ 236
           MT++E+K+FFDI+LK +++ GLE+ FL  WHPDA DYLSVVSDL ++S +L+NP  RL+ 
Sbjct: 206 MTYVELKYFFDILLKDKIVGGLEHKFLNCWHPDAQDYLSVVSDLKIVSSKLWNPEFRLKY 265

Query: 237 TDLSITISHAFEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLS 296
            DL+I I HAF P+ AKR   SY+ +A +L++DF IEEKMDGER+Q+HY+NYG ++K+LS
Sbjct: 266 DDLTINIDHAFTPETAKRLTYSYDTIARRLKNDFFIEEKMDGERIQLHYMNYGAKLKFLS 325

Query: 297 RRGVDFSYLYGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMN 356
           RRG+D+SYLYG+N ++G I   L  H +VK+CILDGEM+TYD+ K+ +LPFGLVKSSAM 
Sbjct: 326 RRGLDYSYLYGDNRNNGAIGRYLNFHKDVKECILDGEMVTYDSVKNCILPFGLVKSSAMQ 385

Query: 357 QIQSELAGIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQY 416
            +   ++ I P + Y PL++AFDLVYLNG SL+ L L +RK+YL K+L P    VEI+  
Sbjct: 386 SLS--VSDIEP-DGYHPLYMAFDLVYLNGSSLSTLPLHQRKNYLDKLLIPCPDFVEILPA 442

Query: 417 MKAINAEAIKDSLEQAISMGSEGIVLKHLHSKYFVGSRNTDWIKIKPEYLEQFGENMDLL 476
           +   ++  IK SLE+AI +GSEGI+LK   S+Y V  R+ DWIKIKPEYLEQFGENMDL+
Sbjct: 443 LHCNDSSLIKSSLEKAIELGSEGIILKRFDSQYLVAKRSDDWIKIKPEYLEQFGENMDLI 502

Query: 477 IIGREQGKKDSFFCGLSI-------------SDPNEVAE------KPRFISFCTIANGLS 517
           +IGR+ GKKDS  CGL +             S+P + AE      K + ISFC IANG+S
Sbjct: 503 VIGRDPGKKDSLMCGLILTGDNEPEEITSLDSNPTDTAESFLKPDKRKIISFCNIANGIS 562

Query: 518 NEEFKDIERKTWGKWHIFSEDPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTKESE 577
            +EF+DI+R T+G W  F ++ P  +L  FGTK P EWI+PE SVVLE+KAR+++T ES 
Sbjct: 563 QKEFRDIDRYTFGHWIKFDDELPPQDLFEFGTKHPIEWIYPEHSVVLEIKARSLETNESA 622

Query: 578 KRKYRSGCTLHFGYCKQIRYDKDWKTVASFSEFEDMKDARN-FYNKRKSHQVTDGKKRAS 636
           + KY +G TL  GYC+QIRYDKDW +  +++EF + ++ +N   N   +  +   KKR  
Sbjct: 623 RIKYGTGSTLFGGYCRQIRYDKDWVSCFTYNEFMESRNLKNALVNYPDNKNLIGRKKRPK 682

Query: 637 KRAKIGIVNSSEPTALVAPVSNT-FSNCRFRVISDYFDSTKRRRISQEDLCSVILEHGGE 695
           KR    +    E T      SN  F    F VISDY D T   R+S+ DLC+++LEH G+
Sbjct: 683 KRMFNSLTEIFENTKDAPDESNVIFRGLHFYVISDYIDETDGSRLSKSDLCNLVLEHNGK 742

Query: 696 IVYTSDENNLPQDNLYIIGEKLTRECKILLNAKNLIIRPSWIFSCIEEG----------- 744
           +V+         + L II  K TRE   L+     II P WI  CI              
Sbjct: 743 LVHNPISRIDILNRLRIISMKYTRETTSLIERGYDIIHPQWILDCISNRKLVRLLPSHCF 802

Query: 745 ------YKTPFTESDIFRGELESSMDCSQFYTDFNTASLNHLLETANRGIKNPDSDLLLP 798
                  +   T  D +    E+S+    F    N   L    E+A++ I   ++ L   
Sbjct: 803 NVSSSLMEVTKTRVDRYGDSYETSLTEKDFEILINRQVLKS--ESADKRITEGENHL--- 857

Query: 799 EVPLFLFSNLKLAVLNSENVLDTSILEVEFAIKCHGGELVH-IENASIIIVFNDFISRED 857
           ++P+ LF N +  +   E +  T I E++  ++ +GG+LV+ I + ++I+  N       
Sbjct: 858 KIPILLFCNRRFFI--PETLPSTPIYELKSKVELYGGKLVNKISDCNVIVFTNTHTENRK 915

Query: 858 LFSLRQKIASKAVKESTESTPRIPRMVDISW 888
               + + A   +  ++   P +PR+VD +W
Sbjct: 916 EVMKKIRRALVCLDPNSMQVPVLPRIVDANW 946

>TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.18
           YOR005C
          Length = 969

 Score =  772 bits (1993), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/941 (43%), Positives = 592/941 (62%), Gaps = 63/941 (6%)

Query: 6   NFSPSPEFKWLCDELLGKI--YETSSKKHLIGKPVTVRYLEIITNFIKLWRSTVGNYIYP 63
           NF+PSP+F WLC+EL  K+   +   ++HL  KP++VRY E+I++FI+LWR TVGN I+P
Sbjct: 29  NFAPSPDFIWLCEELFVKLEDVQRQGREHLGNKPLSVRYYEVISHFIRLWRKTVGNNIFP 88

Query: 64  ALRLIVPFRDRRIYNVKENTLIKALCRYLRLPKSSETENRLLRWKQRAARGVKLSDFCVE 123
           AL L +P+RDRRIYN+K+ TL+KA+C YL LPK S TE RLL+WK+RA RGV+LS+FCVE
Sbjct: 89  ALVLSLPYRDRRIYNIKDYTLVKAICSYLALPKQSATEKRLLKWKRRATRGVRLSNFCVE 148

Query: 124 EIRKRQKDYEGANRITIDELNGYLDEVSQEGNGKRMGYMALTDSRAFNYCLNHMTFMEMK 183
           EIRKR+ +     RITID+LN  LD + +E N K  G+  L+DS  FN+CL +M+F+E++
Sbjct: 149 EIRKRKSEPSPGRRITIDKLNECLDHLVEERNAKG-GFKGLSDSPTFNFCLQNMSFIELR 207

Query: 184 FFFDIILKTRVLSGLENMFLTAWHPDATDYLSVVSDLDVLSQRLYNPNERLRQTDLSITI 243
           FFFDI+LK RV+ G E+  L  WHPDA DYLSVVSDL+ ++ RL++P  RLR+ DLSI +
Sbjct: 208 FFFDIVLKNRVIGGQEHKLLNCWHPDALDYLSVVSDLETVASRLWDPEHRLRRDDLSINL 267

Query: 244 SHAFEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGVDFS 303
            +AF PQLAK+  +SYE++ +KL +DF+IEEKMDGER+Q+HY++YG +I++LSRRGVD++
Sbjct: 268 GYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRGVDYT 327

Query: 304 YLYGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQSELA 363
            LYGEN  SG ++  L    NV+DC+LDGEMIT+DT++++VLPFG+VKSSA   + +E  
Sbjct: 328 QLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQALSTE-- 385

Query: 364 GIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKAINAE 423
           GI  ++ ++P+ +  DLVYLNG SL  L L +RK++L ++L P   +VEI+ Y++     
Sbjct: 386 GIC-SQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSEHT 444

Query: 424 AIKDSLEQAISMGSEGIVLKHLHSKYFVGSRNTDWIKIKPEYLEQFGENMDLLIIGREQG 483
           AI+ SLE++ISMGSEGIVLK   ++Y +G+RN  WIK+KPEYLEQFGEN+DL+IIGR  G
Sbjct: 445 AIRKSLEKSISMGSEGIVLKSYKARYEIGARNDYWIKVKPEYLEQFGENLDLVIIGRTPG 504

Query: 484 KKDSFFCGLSI----SDPNEVAEKPR------------------------FISFCTIANG 515
           KKDS  CGL++     D NE+  K                          FISFC IANG
Sbjct: 505 KKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFISFCVIANG 564

Query: 516 LSNEEFKDIERKTWGKWHIFSEDPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTKE 575
           +S +EFK+I+RKT G W    +  PS +LL FG+K+P EWI P++S++LEVKAR++D  E
Sbjct: 565 ISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVKARSLDNTE 624

Query: 576 SEKRKYRSGCTLHFGYCKQIRYDKDWKTVASFSEFEDMKDARNFYNKRKSHQVTDGKKRA 635
           S K+K+ +GCTLH GYC++IR DKDW    SFSE    +  ++       ++    K ++
Sbjct: 625 SSKKKFAAGCTLHGGYCRRIRDDKDWTGCYSFSELWQERLHKSSTGVGSFNKQYSKKMKS 684

Query: 636 SKRAKIGIVNSSEPTALVAPVSNTFSNCRFRVISDYFDSTKRRRISQEDLCSVILEHGGE 695
            KR        +     V   +N F   +F V+SDY D ++  RI++ +   +IL++ G+
Sbjct: 685 KKRKIDPFSGQAAKKHDVFDSTNIFKGLQFYVLSDYIDVSRNVRITKSEFDDLILQNSGK 744

Query: 696 IVYTSDENNLPQDNLYIIGEKLTRECKILLNAKNLIIRPSWIFSCIEEGYKTPFTESDIF 755
           +V      +  +    II  K T EC+ L+     I+ P WI  CI             F
Sbjct: 745 LVRNLISKHHSESQFRIISGKYTAECRALIERGYDILSPQWILDCIRNRMVVKLEPRHCF 804

Query: 756 ----------RGELESSMDCSQFYTDFNTASLNHLLETANRGIKNPDSDLL------LPE 799
                      G ++   D   F        L++L++T    +K  + +L+      L  
Sbjct: 805 NVSSELMTIVNGRVDEYGD--SFVNPITEQQLDNLIDT---NMKQTEPNLMREANSELDV 859

Query: 800 VPLFLFSNLKLAVLNSE-NVLDTSILEVEFAIKCHGGELVH-IENASIIIVFND--FISR 855
           VPLFLFS   + +     N +D   L  +F  K HGG +   I + ++II+ N+   +  
Sbjct: 860 VPLFLFSTRAVYIPPQVFNAVDAYGLTSKF--KLHGGSIASDIPSCNLIIMPNENQRLGT 917

Query: 856 EDLFSLRQKIASKAVKESTESTPRIPRMVDISWALDSIKDN 896
           + L  +RQ +     +   +STP IP +V   W   SI++N
Sbjct: 918 QSLVEMRQSVLQAMGR--NDSTPSIPYIVTPDWVEKSIEEN 956

>Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {ON}
           YOR005C (REAL)
          Length = 948

 Score =  766 bits (1977), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/933 (44%), Positives = 582/933 (62%), Gaps = 52/933 (5%)

Query: 6   NFSPSPEFKWLCDELLGKIYET-SSKKHLIGKPVTVRYLEIITNFIKLWRSTVGNYIYPA 64
           NF+PSP+F+WLC+EL  K+ E   +     GK V+ RY EII+NF +LWR TVGN IYPA
Sbjct: 13  NFAPSPDFRWLCEELFAKVEEVLINGTAGTGKSVSFRYYEIISNFTELWRKTVGNNIYPA 72

Query: 65  LRLIVPFRDRRIYNVKENTLIKALCRYLRLPKSSETENRLLRWKQRAARGVKLSDFCVEE 124
           L L +P+RDRRIYN+K+  LI+ +C YL+LPK+S TE RL  WKQR  +G  LS   VEE
Sbjct: 73  LILALPYRDRRIYNIKDYVLIRTVCSYLKLPKNSPTEQRLKDWKQRVGKGRSLSSLLVEE 132

Query: 125 IRKRQKDYEGANRITIDELNGYLDEVSQEGNGKRMGYMALTDSRAFNYCLNHMTFMEMKF 184
           I KR+ +      IT+D +N YLDE+S+E N    G+  L  S+ F +CL +MTF+E+KF
Sbjct: 133 ISKRRTE-PTRKSITVDSVNFYLDELSKEMNASGRGFKNLVKSKPFLHCLENMTFVELKF 191

Query: 185 FFDIILKTRVLSGLENMFLTAWHPDATDYLSVVSDLDVLSQRLYNPNERLRQTDLSITIS 244
           FFDI+LK RV+ G E+  L  WHPDA DYLSVVSDL V++ +LY+P+ RL+  DLSI + 
Sbjct: 192 FFDILLKNRVIGGQEHKLLNCWHPDAQDYLSVVSDLRVVTSKLYDPDIRLKNDDLSIKVG 251

Query: 245 HAFEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGVDFSY 304
            AF PQLAK+ +LSYE++   L++DF +EEKMDGER+Q+HY+NYG+ IK+ SRRG+D++Y
Sbjct: 252 FAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFFSRRGIDYTY 311

Query: 305 LYGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQSELAG 364
           LYG N  SG IS  LK   +VK+C+LDGEM+T+D  + ++LPFGLVK SA   +      
Sbjct: 312 LYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAKEALSFNDIN 371

Query: 365 IAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKAINAEA 424
                 + PL++ FDL+YLNG SLT L L +RK+YL+ IL P +  VEI++Y +  +AE+
Sbjct: 372 ---NNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSRCYDAES 428

Query: 425 IKDSLEQAISMGSEGIVLKHLHSKYFVGSRNTDWIKIKPEYLEQFGENMDLLIIGREQGK 484
           +K SLE AIS+GSEG+VLKH  S Y V SRN +WIK+KPEYLE+FGEN+DL+IIGR+ GK
Sbjct: 429 VKKSLEVAISLGSEGVVLKHYSSSYNVASRNNNWIKVKPEYLEEFGENLDLIIIGRDSGK 488

Query: 485 KDSFFCGLSISD-----------PNEV---------AEKP-----RFISFCTIANGLSNE 519
           KDSF  GL + D           P+E+         A  P     + +SFC+IANG+S E
Sbjct: 489 KDSFMLGLLVVDEQETGKTDQEGPSEILNDSSTERRATNPKKRVRKVLSFCSIANGISQE 548

Query: 520 EFKDIERKTWGKWHIFSEDPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTKESEKR 579
           EFK+I+RKT G W   S   P P++L FG+K+P EWI P +S+VLE+K+R++D  E+  +
Sbjct: 549 EFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESIVLEIKSRSLDNTETNMQ 608

Query: 580 KYRSGCTLHFGYCKQIRYDKDWKTVASFSE-FEDMKDARNFYNKRKSHQVTDGKKR--AS 636
           KY + CTL+ GYC++IRYDKDW    +  E +E+ +   N      SHQV + + +    
Sbjct: 609 KYATNCTLYGGYCRRIRYDKDWTECYTLDELYENRRTKSN-----PSHQVENLQLQLVPK 663

Query: 637 KRAKIGIVNSSEPTALVAPVSNTFSNCRFRVISDYFDSTKRRRISQEDLCSVILEHGGEI 696
           KR +  + +  + +    P+S  F+   F V+SDY +S    RI++ +L  VI++HGG++
Sbjct: 664 KRKRALVSDPFQQSREQKPISGVFAGLFFYVLSDYINSVTGVRITRSELNDVIVKHGGKL 723

Query: 697 VYTSDENNLPQDNLYIIGEKLTRECKILLNAKNLIIRPSWIFSCIEEGYKTP------FT 750
           ++          ++ +IG KLTREC+ L++    I+ P WI  C       P      F+
Sbjct: 724 IHNVILKRHCIGDVRLIGCKLTRECRALIDRGYDILHPRWIMDCTAYNKLLPIEPSYCFS 783

Query: 751 ESDIFRGELESSMDC--SQFYTDFNTASLNHLLETANR--GIKNPDSDLLLPEVPLFLFS 806
            S   R      +DC    F  D + + L+ L ++       +  D    L  +PLFLFS
Sbjct: 784 VSGKLRAVARRRVDCFGDSFENDISESKLSSLQKSQPDLLSTRQADKSFELQIIPLFLFS 843

Query: 807 NLKLAVLNSENVLDTSILEVEFAIKCHGGELVHIENAS--IIIVFNDFISREDLFSLRQK 864
           N ++  +    +     + +E  I+  GG++   ++ S  III + D I R D       
Sbjct: 844 N-RIVYIPRSKIGPKDEMLLEMKIRLFGGKITDQQSLSNLIIIPYADPIWRGDCLEEVHS 902

Query: 865 IASKAVKES-TESTPRIPRMVDISWALDSIKDN 896
             ++ VK S +++ PRIPR+V   W   SI +N
Sbjct: 903 QINEHVKASNSDTVPRIPRIVTPEWVDHSISEN 935

>ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR005C (DNL4)
          Length = 981

 Score =  762 bits (1967), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/941 (42%), Positives = 585/941 (62%), Gaps = 51/941 (5%)

Query: 6   NFSPSPEFKWLCDELLGKIYETSSKKHLIGKPVTVRYLEIITNFIKLWRSTVGNYIYPAL 65
           NFSPSP+F WLCDEL  K+ E + KK  +GKP  VR LEI +NF+ LWR TVGN IYPAL
Sbjct: 53  NFSPSPDFCWLCDELFIKLEEVALKKKDLGKPRKVRNLEITSNFVSLWRKTVGNDIYPAL 112

Query: 66  RLIVPFRDRRIYNVKENTLIKALCRYLRLPKSSETENRLLRWKQRAARGVKLSDFCVEEI 125
            L +P+ DRR Y VK+ TL+KALC++++LP++SETE RLL WKQ A RGVKLS FCVEE+
Sbjct: 113 VLSLPYNDRRSYRVKDVTLVKALCKHMKLPRNSETERRLLHWKQNAPRGVKLSTFCVEEL 172

Query: 126 RKRQKDYEGANRITIDELNGYLDEVSQEGNGKRMGYMALTDSRAFNYCLNHMTFMEMKFF 185
           +KR+++     R++IDE+NG LD++  E N  +  Y++L +S AFNYCL HM+++E++FF
Sbjct: 173 QKRRREPVVPKRMSIDEVNGMLDKLEHESNVGKWSYISLAESPAFNYCLEHMSYVELRFF 232

Query: 186 FDIILKTRVLSGLENMFLTAWHPDATDYLSVVSDLDVLSQRLYNPNERLRQTDLSITISH 245
           FDI+LK  ++SGLE++ L+ WHPDA  Y  VVSDL +++  LY+PNERL + DLS+ I +
Sbjct: 233 FDIVLKVPIVSGLESLLLSCWHPDAESYFKVVSDLRIVAHTLYDPNERLEKNDLSVRIGY 292

Query: 246 AFEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGVDFSYL 305
           AF P +A+R  + YE+V++KL +DF +EEKMDG+R+Q+HY++YG  I Y SR G++++YL
Sbjct: 293 AFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNGINYTYL 352

Query: 306 YGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQSELAG- 364
           YGENSS G IS  LK    VK+CILDGEM++YD E   +LPFGL KS A +Q+  E  G 
Sbjct: 353 YGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVNFETTGH 412

Query: 365 IAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKAINAEA 424
             PT  Y+PL+  FDL+YLNG+ LTN  + +RK+YL KIL P +  V ++   +  +AEA
Sbjct: 413 TEPT--YRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCSDAEA 470

Query: 425 IKDSLEQAISMGSEGIVLKHLHSKYFVGSRNTDWIKIKPEYLEQFGENMDLLIIGREQGK 484
           I  +L  A++ GSEGIVLK   SKY VG R+  WIKIKPEYLE FGENMDL++IGR++G+
Sbjct: 471 ITAALGAAVAHGSEGIVLKKARSKYSVGKRDDSWIKIKPEYLENFGENMDLVVIGRDKGR 530

Query: 485 KDSFFCGLSISDPNE-------------------VAEKP---RFISFCTIANGLSNEEFK 522
           KDSF C L+++D +E                   +  +P   +FISFC+IANG+SNEEFK
Sbjct: 531 KDSFICALAVTDDSEKNNPSSYESGSDSDSDSEPIIVQPKIEKFISFCSIANGISNEEFK 590

Query: 523 DIERKTWGKWHIFSEDPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTKESEKRKYR 582
           +I+R T G W  + E  P  + + FGTK P EWI P++SVVLEVKAR+ID +ES+   Y+
Sbjct: 591 EIDRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKARSIDNEESKSDLYK 650

Query: 583 SGCTLHFGYCKQIRYDKDWKTVASFSEFEDMKDARNFYNKRKSHQVTDGKKRASKRAK-- 640
           +G TL+  YCK+IR+DK+W T ++ +E++  ++AR+++N   S     GK R+S R +  
Sbjct: 651 TGSTLYNAYCKRIRHDKNWSTASTVAEYDTAREARSYFN--VSQNAKFGKDRSSPRKRRT 708

Query: 641 ---IGIVNSSEPTALVAPVSNTFSNCRFRVISDYFDSTKRRRISQEDLCSVILEHGGEIV 697
              +G ++ ++P+      ++      F V S YFD   ++ I   ++   ++  GG  +
Sbjct: 709 FHLVGDIDVTKPSK-----ADFLKGYYFYVTSGYFDLQSKKNIDASEIGEAVVSCGGTYI 763

Query: 698 YTSDENNLPQDNLYIIGEKLTRECKILLNAKNLIIRPSWIFSCIEEGYKTPFTESDIFRG 757
           +         D LYI+G K TRE K+L+     II P W+  C++ G         ++  
Sbjct: 764 HNL-RIRASLDKLYILGCKDTRELKMLIERGYDIIHPEWLMDCVKYGTMLQIEPKYVYSA 822

Query: 758 ELESSMDCSQFYTDFNTASLNHLLETANRGIKNPD----------SDLLLPEVPLFLFSN 807
             E           +  +    + E   + + N            +D +     L +F  
Sbjct: 823 SEELMKQARNQEDKYGESYQLPVTEDTLKALANKQVEEGYASEMGTDAVSEYERLLIFKG 882

Query: 808 LKLAVLNSENVLDTSILEVEFAIKCHGGELVH-IENASIIIVFNDFISREDLFSLRQKIA 866
               +L+      +    V++ I+  GGE+ + +E A+I++   D  S+  L ++R  I 
Sbjct: 883 WLFYILDDYAYHSSWSDIVKWNIESCGGEVTNDLELATIVVAVKDCFSQLSLQAVRNNIG 942

Query: 867 SKAVKESTESTPRIPRMVDISWALDSIKDNYIAETEHYQCL 907
           ++ +  S +  P IP++V   W    ++  Y+ + + Y  +
Sbjct: 943 AR-ITGSNDVQP-IPKIVTSEWVEACMEAQYLVDEDEYAAI 981

>NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {ON}
           Anc_6.18 YOR005C
          Length = 967

 Score =  758 bits (1957), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/956 (43%), Positives = 587/956 (61%), Gaps = 70/956 (7%)

Query: 6   NFSPSPEFKWLCDELLGKI-----YETSSKKHLIGKPVTVRYLEIITNFIKLWRSTVGNY 60
           NF+PSP F+WLCDEL  K+       TS       KP+ V+Y E+I +FI LWR TVGN 
Sbjct: 21  NFAPSPSFRWLCDELFVKLERIQQASTSKASKEFQKPINVQYYEVIQHFINLWRKTVGND 80

Query: 61  IYPALRLIVPFRDRRIYNVKENTLIKALCRYLRLPKSSETENRLLRWKQRAARGVKLSDF 120
           IYPAL LI+P+RDRRIYNV++ TLIKA+C YL+LPK+S TE RLL WKQRA R V+LS F
Sbjct: 81  IYPALILILPYRDRRIYNVRDYTLIKAICSYLKLPKNSFTEKRLLSWKQRAGRSVRLSSF 140

Query: 121 CVEEIRKRQKDYEGANR--ITIDELNGYLDEVSQEGNGK-RMGYMALTDSRAFNYCLNHM 177
            V EI+KR+ + +   R  ITID+LN  LD +S+E N K  MGY  L+DS  F +CL +M
Sbjct: 141 IVSEIKKRKSEPQVGTREEITIDKLNQCLDSLSEERNSKGSMGYRGLSDSPTFVFCLENM 200

Query: 178 TFMEMKFFFDIILKTRVLSGLENMFLTAWHPDATDYLSVVSDLDVLSQRLYNPNERLRQT 237
           TF+E++FFFDIILK+RV+ G E+ FL  WHPDA DYLSVVSDL  ++ +L++P   L+  
Sbjct: 201 TFVELQFFFDIILKSRVIGGHEHKFLNVWHPDAQDYLSVVSDLKTVANKLWDPAVHLKND 260

Query: 238 DLSITISHAFEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSR 297
           DL+I +   F PQ AK+  +SYE++ +KL+HDF IEEKMDGER+Q+HY +YG ++ +LSR
Sbjct: 261 DLTINVGSPFAPQSAKKLSISYEKICAKLKHDFFIEEKMDGERIQLHYQDYGNKLSFLSR 320

Query: 298 RGVDFSYLYGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQ 357
           RG D++YLYGE+   G +S  L L  NV++C+LDGEM+T+D E++ +LPFGLVKSSA + 
Sbjct: 321 RGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVLDGEMVTFDKERNALLPFGLVKSSARSI 380

Query: 358 IQSELAGIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYM 417
           I  E  G+A  E Y+PL + FDLVYLNG SL N+ L +RK YL KI TP    VE+++  
Sbjct: 381 ITQE--GVA-NEGYRPLLMVFDLVYLNGVSLVNIPLYQRKLYLEKIFTPERHIVELLRSK 437

Query: 418 KAINAEAIKDSLEQAISMGSEGIVLKHLHSKYFVGSRNTDWIKIKPEYLEQFGENMDLLI 477
           +  +  +IK++LE AIS+GSEG+VLKH +S+Y V SRN DWIK+KPEYLEQFGENMDL++
Sbjct: 438 RCSDERSIKNALEHAISIGSEGVVLKHYNSRYTVASRNDDWIKVKPEYLEQFGENMDLIV 497

Query: 478 IGREQGKKDSFFCGLSI-----------------------------SDPNEVAEKP---R 505
           IG++ GKKDS  CGL++                              + NE+  +    R
Sbjct: 498 IGKDPGKKDSLMCGLAVVEEDEPEIDEDGNEIVNLDSQDSIGEGEDKEGNEIEREKTIKR 557

Query: 506 FISFCTIANGLSNEEFKDIERKTWGKWHIFSEDPPSPNLLGFGTKVPYEWIHPEDSVVLE 565
           F+SFC+IANG+S EEFK I R T G W    E PP  +LL FG++VP EWI P+DS+V+E
Sbjct: 558 FVSFCSIANGISQEEFKYIGRITKGCWKKSDEIPPPSDLLEFGSRVPAEWIDPKDSIVIE 617

Query: 566 VKARAIDTKESEKRKYRSGCTLHFGYCKQIRYDKDWKTVASFSEFEDMKDARNFYNKR-- 623
           VKAR+++  E   +K+++G TL+ GYC+QIR DKDWKT  + SE   MK  +   NKR  
Sbjct: 618 VKARSLNNDEEATKKFKTGITLYGGYCRQIREDKDWKTCYTLSELRRMKRFKLGSNKRAN 677

Query: 624 --KSHQVTDGKKRASKRAKIGIVNSSEPTALVAPVSNTFSNCRFRVISDYFDSTKRRRIS 681
              +H +   K+R ++R   G     E T      S  F    F VISD  D+T   R+S
Sbjct: 678 NDATHALDSSKRRKARRIDYGFEKYFEQTPTTLDQSRIFDGLYFYVISDVVDATG-SRVS 736

Query: 682 QEDLCSVILEHGGEIVYTSDENNLPQDNLYIIGEKLTRECKILLNAKNLIIRPSWIFSCI 741
           +E+L   IL  GG IV+     +  ++   I+  K T EC+ L++    II P W+  CI
Sbjct: 737 REELYDKILNRGGVIVHNVIAKHHGENQFRILCGKYTAECQSLIDRGYDIIEPQWVLDCI 796

Query: 742 EEGY------KTPFTESDIFRGELESSMD--CSQFYTDFNTASLNHLLETANRGIKNPDS 793
           ++        K  F  S+      +  +D     F    +  S + L+E   R ++N   
Sbjct: 797 KDDMLLKLEPKYCFNVSEELMKIAKRRVDGFGDSFEAQISEDSFSRLIERNVRSLRNAPP 856

Query: 794 DL---LLPEVPLFLFSNLKLAVLNSENVLDTSILEVEFAIKCHGGELV-HIENASIIIV- 848
            +   ++  VPLFLF    + +   +  L T   +++  I+ +GG+    + + +++++ 
Sbjct: 857 SIQYDMVDTVPLFLFYGRTILLRIKDKALFT---KLKVQIRLYGGKTTGDLASCNLVVIQ 913

Query: 849 FNDFISREDLFSLRQKIASKAVKESTESTPRIPRMVDISWALDSIKDN-YIAETEH 903
            N+    +D+ S   K+ S      T+  P +P +V   W   SI +   + E +H
Sbjct: 914 QNEIAVAKDVRSSLLKLTS-----DTDKPPVLPYIVTPEWIDSSISEGCQVPEEDH 964

>CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005c DNL4 DNA ligase IV
          Length = 946

 Score =  756 bits (1953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/937 (43%), Positives = 591/937 (63%), Gaps = 53/937 (5%)

Query: 6   NFSPSPEFKWLCDELLGKIYETSSKK--HLIGKPVTVRYLEIITNFIKLWRSTVGNYIYP 63
           NF+PSP+F WLC++L  KI     ++  +L+ KPVT RY E+I+NF  LWR+TVGN IYP
Sbjct: 24  NFAPSPDFLWLCEQLFAKIDHVQFERANNLLTKPVTARYYEVISNFTTLWRTTVGNNIYP 83

Query: 64  ALRLIVPFRDRRIYNVKENTLIKALCRYLRLPKSSETENRLLRWKQRAARGVKLSDFCVE 123
           ALRLI+P+RDRR++N+K+ TLIKA+C +L+LPK S TE +L+ WKQ A R V+LS FCVE
Sbjct: 84  ALRLILPYRDRRVFNIKDYTLIKAICAFLKLPKDSSTEKKLINWKQDAGRSVRLSKFCVE 143

Query: 124 EIRKRQKD--YEGANRITIDELNGYLDEVSQEGNGKRMGYMALTDSRAFNYCLNHMTFME 181
           EI+KR+ +   +   RITID+LNGYLD+++ E   +   +  L +S   N CL  MTF+E
Sbjct: 144 EIKKRRSEPQIDRNERITIDDLNGYLDQLAIERTEQGRSFKNLANSDIMNKCLTSMTFLE 203

Query: 182 MKFFFDIILKTRVLSGLENMFLTAWHPDATDYLSVVSDLDVLSQRLYNPNERLRQTDLSI 241
           M++FFDI+LK R L G E+  L  WHPDA DYLSVVSDL+ +++RL++P++RL   DL I
Sbjct: 204 MQYFFDILLKNRPLGGHEHKLLNCWHPDAQDYLSVVSDLETVAKRLWDPSQRLGNQDLKI 263

Query: 242 TISHAFEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGVD 301
            I  AF PQLA + H+SY+++  KL  DF IEEKMDGER+Q+HY N+G  IK+ SRR  D
Sbjct: 264 NIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYSRRATD 323

Query: 302 FSYLYGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQSE 361
           ++YLYG N  +G ++  + L+ NVKDC+LD E++T+D+   IVLPFG+VKSSA N +  +
Sbjct: 324 YTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKNMLSQD 383

Query: 362 LAGIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKAIN 421
             GI  T+ + PL + FD++YLNG +L +L   +R++YL +ILTP    +EII+ ++A +
Sbjct: 384 --GI-DTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSIRAND 440

Query: 422 AEAIKDSLEQAISMGSEGIVLKHLHSKYFVGSRNTDWIKIKPEYLEQFGENMDLLIIGRE 481
            + IK SLE+A+S+GSEGI+LK   S+Y + SR+ DWIKIKPEYLEQFGENMDL+++GR+
Sbjct: 441 EQMIKKSLEKALSVGSEGIILKRYDSRYVIASRSDDWIKIKPEYLEQFGENMDLVLMGRD 500

Query: 482 QGKKDSFFCGL-----SISD---------PNEVAEKPR-FISFCTIANGLSNEEFKDIER 526
             KKDS   GL      I D           E +++ R F+S C IANG+SNEE+K+I+R
Sbjct: 501 PSKKDSLMLGLLDYEEVIQDSPIMVNSQSSEENSQRFRGFVSLCIIANGISNEEYKEIDR 560

Query: 527 KTWGKWHIFSEDPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTKESEKRKYRSGCT 586
           KT G W+  SE  P    + FG+KVP +WI P+ S++LE+KAR++D   S +RK+ +GCT
Sbjct: 561 KTKGLWND-SEKIPPLEYMKFGSKVPRQWIDPKKSLILEIKARSLDNTRSSERKFAAGCT 619

Query: 587 LHFGYCKQIRYDKDWKTVASFSEFEDMKDARNFYNKRKSHQVTDGKKRASKRAKIGIVNS 646
           L  GYC+QIR DK+WKT  +  EFE  K   N + KR S +    +K  SK+ +  I++S
Sbjct: 620 LFGGYCRQIREDKNWKTCYTLQEFERAKSGNN-WRKRGSSK---PQKVISKKRRYNIISS 675

Query: 647 S----EPTALVAPVSNTFSNCRFRVISDYFDSTKRRRISQEDLCSVILEHGGEIVYTSDE 702
                E  A +   S+ F    F V+SDYFD  KR+RI + ++  VI+ +GG++V     
Sbjct: 676 VNKALEDFAELEHRSDIFDGMYFYVLSDYFDGVKRKRIKKSEIQKVIVANGGQLVQNVIT 735

Query: 703 NNLPQDNLYIIGEKLTRECKILLNAKNLIIRPSWIFSCIEEGYKTPFTESDIFRGELESS 762
            N   ++L II  + T EC  L+     II P W+F C+  G       S  F    +  
Sbjct: 736 RNYNLNDLRIISSRNTVECNSLIVRGYDIISPKWVFDCLLSGKIMKLEPSHCFNFS-KQL 794

Query: 763 MDCS---------QFYTDFNTASLNHLL--ETANRGIKNPDS--DLLLPEVPLFLFSNLK 809
           MD +          +  D N    + L   +      + PD   D  L +VP FLF    
Sbjct: 795 MDYAYKRIDQYGDPYERDINKYEWSSLTSEKICTTAKQQPDVQFDNSLMDVPHFLFHGRI 854

Query: 810 LAVLNSENVLDTSILEVEFAIKCHGGELVH-IENASIIIVFNDFISREDLFSLRQKIASK 868
           + +L+  N    +I +  F +  +GG++ + + +A+++IV      R  +  +R++I+S+
Sbjct: 855 VFLLSDNN----NIQKESFMVDAYGGKVTNELSSANLVIVVGAVTQRR-INDIRKQISSE 909

Query: 869 AVKESTESTPRIPRMVDISWALDSIKDNYIAETEHYQ 905
            +K+  +  PRIP MV   W  D IK N     ++Y+
Sbjct: 910 VIKQ--DHPPRIPDMVSEGWLYDCIKQNTQVAEDNYR 944

>Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {ON}
           YOR005C (REAL)
          Length = 945

 Score =  739 bits (1907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/932 (42%), Positives = 570/932 (61%), Gaps = 51/932 (5%)

Query: 5   ENFSPSPEFKWLCDELLGKIYETSSKKHL-IGKPVTVRYLEIITNFIKLWRSTVGNYIYP 63
           +NF+PSP+FKWLC+EL  KI E   K  +  GK  + +Y E+++NF+++WR TVGN IYP
Sbjct: 12  QNFAPSPDFKWLCEELFSKIDEVQVKGTIGTGKSRSFKYYEVLSNFVEMWRKTVGNNIYP 71

Query: 64  ALRLIVPFRDRRIYNVKENTLIKALCRYLRLPKSSETENRLLRWKQRAARGVKLSDFCVE 123
           AL L +P+RDRRIYN+K+  LI+ +C YL+LPK+S TE RL  WKQR  +G  LS   VE
Sbjct: 72  ALILALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEGRLKDWKQRVGKGKNLSSLLVE 131

Query: 124 EIRKRQKDYEGANRITIDELNGYLDEVSQEGNGKRMGYMALTDSRAFNYCLNHMTFMEMK 183
           EI KR+ +  G   ITID +N  LDE+S++ +    G+  L  S  F +CL  M+F+E+K
Sbjct: 132 EIAKRRSEPNG-KAITIDGINSTLDELSKDRSTSGRGFKNLVKSSPFLHCLESMSFVELK 190

Query: 184 FFFDIILKTRVLSGLENMFLTAWHPDATDYLSVVSDLDVLSQRLYNPNERLRQTDLSITI 243
           +FFDI+LK+RV+ G E+ FL+ WHPDA DYLSVVSDL V++ +LY+P  RL+  DL+I +
Sbjct: 191 YFFDILLKSRVIGGQEHKFLSCWHPDAQDYLSVVSDLKVVASKLYDPRVRLKNDDLTIKV 250

Query: 244 SHAFEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGVDFS 303
             AF PQLAK+ +L YE++   L +DF++EEKMDGER+Q+HY+NYG+ +++ SRRG+D++
Sbjct: 251 GFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFYSRRGIDYT 310

Query: 304 YLYGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQSELA 363
           YLYG + SSG IS  L    NV++C+LDGEM+T+D  + ++LPFGLVK SA + +     
Sbjct: 311 YLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGSAKDALSFNSI 370

Query: 364 GIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKAINAE 423
                  + PL+V FDL+YLNG SLT L L +RK+YL  ILTPV+  VE+++  +  N E
Sbjct: 371 N---NVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSRCYNVE 427

Query: 424 AIKDSLEQAISMGSEGIVLKHLHSKYFVGSRNTDWIKIKPEYLEQFGENMDLLIIGREQG 483
           +IK SLE AIS+GSEG+VLK+ +S Y V SRN +WIK+KPEYLE+FGEN+DL+IIGR+ G
Sbjct: 428 SIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLVIIGRDPG 487

Query: 484 KKDSFFCGLSISDPNEVAEK------------------------PRFISFCTIANGLSNE 519
           KKDSF  GL + +  E+ ++                         + +SFC++ANG+S E
Sbjct: 488 KKDSFMLGLLLLNEKEMDKRDQEVSSGIANNSKNENILYSQKKVKKILSFCSVANGISQE 547

Query: 520 EFKDIERKTWGKWHIFSEDPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTKESEKR 579
           EFK+I+RKT G W   SE  P  ++  FG+K+P EWI P +S+VLE+K+R++D  E+  +
Sbjct: 548 EFKEIDRKTRGCWKKTSEVAPPASIFEFGSKIPAEWIEPNESIVLEIKSRSLDNTETNMQ 607

Query: 580 KYRSGCTLHFGYCKQIRYDKDWKTVASFSEFEDMKDAR--NFYNKRKSHQVTDGKKRASK 637
           KY + CTL+ GYCK+IR+DKDW    + +E  D + AR    Y   KSH     K    K
Sbjct: 608 KYATSCTLYGGYCKRIRFDKDWTDCFTLNELYDSRSARFNPSYQAEKSHL----KLVRKK 663

Query: 638 RAKIGIVNSSEPTALVAPVSNTFSNCRFRVISDYFDSTKRRRISQEDLCSVILEHGGEIV 697
           R ++   N+ +      P S  F+   F V+SDY  +    RI++ +L + I+ HGG ++
Sbjct: 664 RREVLTSNTFDQKTEQIPTSIIFAGLYFYVLSDYVTNASEVRITRGELENAIVRHGGRLI 723

Query: 698 YTSDENNLPQDNLYIIGEKLTRECKILLNAKNLIIRPSWIFSCIEEGYKTP------FTE 751
           Y          ++ +I  K T EC+ L+N    I+ PSW+  C+      P      F  
Sbjct: 724 YNIILKRHYIGDVRLISCKNTTECRALINRGYDILHPSWVIDCVAYKKLIPIEPCYCFNV 783

Query: 752 SDIFRGELESSMDC--SQFYTDFNTASLNHLLETANRGIKNPDS---DLLLPEVPLFLFS 806
           S   R   E  +DC    F  D +   L+ LL  +   +  P+    D  +   PLFLFS
Sbjct: 784 SQKMRAVAEKRVDCLGDSFENDISETKLS-LLYKSQHNLPPPEEVERDAEVQVFPLFLFS 842

Query: 807 NLKLAVLNSENVLDTSILEVEFAIKCHGGELVHIENAS--IIIVFNDFISREDLFSLRQK 864
           N ++  +    +       +E  I+  GG++   ++    +II + D   R+D      +
Sbjct: 843 N-RIVYIPPRKIGMKYEKTLEMKIRLFGGKITDRQSLCNLVIIPYGDPTWRKDCIKEVNE 901

Query: 865 IASKAVKESTESTPRIPRMVDISWALDSIKDN 896
              + VK + ++ P+IPR+V   W   SI  N
Sbjct: 902 QIKEQVK-ALDTIPKIPRIVAPEWVDHSIYGN 932

>TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {ON}
           Anc_6.18 YOR005C
          Length = 972

 Score =  739 bits (1908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/971 (42%), Positives = 594/971 (61%), Gaps = 90/971 (9%)

Query: 5   ENFSPSPEFKWLCDELLGKI------YETSSKKHLIGKPVTVRYLEIITNFIKLWRSTVG 58
           +NF+PSP+FKWLCDEL  KI       +  +   +  KP++ RY + IT+FIKLWR+T+G
Sbjct: 24  KNFAPSPDFKWLCDELFVKIDKIREQIKNKTANTISNKPISTRYFDTITHFIKLWRTTIG 83

Query: 59  NYIYPALRLIVPFRDRRIYNVKENTLIKALCRYLRLPKSSETENRLLRWKQRAARGVKLS 118
           + I+PALRLI+P+RDRR+YN+K+ TLI+A+C YL+LPK+S  E RL+RWK +A R   L+
Sbjct: 84  DDIFPALRLILPYRDRRVYNIKDLTLIRAICSYLKLPKNSVVERRLIRWKYKADRYETLA 143

Query: 119 DFCVEEIRKRQKDYE--GANRITIDELNGYLDEV---SQEGNGKRMGYMALTDSRAFNYC 173
            FC+ EI KR+ + +     RI+ID+LN  LD++    Q  N K+     L     F +C
Sbjct: 144 TFCIHEISKRKNEPQVTQVERISIDKLNEILDDLVVNRQNWNNKKRS--NLLQVETFKFC 201

Query: 174 LNHMTFMEMKFFFDIILKTRVLSGLENMFLTAWHPDATDYLSVVSDLDVLSQRLYNPNER 233
           L +MTF+E+K+FFDII+K ++L  LENMFL  WHPD+ +YLSVVSDL  LS +L+NP+ +
Sbjct: 202 LENMTFIELKYFFDIIVKNKILGSLENMFLKIWHPDSKEYLSVVSDLRTLSNKLWNPSIK 261

Query: 234 LRQTDLSITISHAFEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIK 293
           +  +DLSI + + F PQLAKR  LSY+ ++++L +DF IEEKMDGER+Q+HY+NYGE +K
Sbjct: 262 INNSDLSIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGETVK 321

Query: 294 YLSRRGVDFSYLYGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSS 353
           + SR G D++YLYG + S+G I+  L+LH NVK+C+LDGEM+T+D+    VLPFGLVKSS
Sbjct: 322 FFSRHGTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSS 381

Query: 354 AMNQIQSELAGIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEI 413
           A +Q+  +       +S+ PLF+ FD++YLNG SL +L L +RK++L  +LTP +  VEI
Sbjct: 382 ASSQLNKKDID---NDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEI 438

Query: 414 IQYMKAINAEAIKDSLEQAISMGSEGIVLKHLHSKYFVGSRNTDWIKIKPEYLEQFGENM 473
           +  ++  ++  IK  L+ AIS+GSEGIVLK   SKY   +R+ +WIK+KPEYLE+FGENM
Sbjct: 439 LSSIRCTDSIQIKKGLDAAISVGSEGIVLKQYISKYIPNARHNNWIKVKPEYLEEFGENM 498

Query: 474 DLLIIGREQGKKDSFFCG----------------------LSISDPNEVAEKP-----RF 506
           DL++IGR+ GKKD   CG                      +S S  +++  KP     + 
Sbjct: 499 DLIVIGRDSGKKDCLICGILVTEEKQELSENMKRESEIEIISDSGDDDLDTKPSQGIKKV 558

Query: 507 ISFCTIANGLSNEEFKDIERKTWGKWHIFSEDPPSPNLLGFGTKVPYEWIHPEDSVVLEV 566
           ISFCTIANGLS  E K+I R T G W  ++ + P  ++L FGTK P EWI+P+DSVVLE+
Sbjct: 559 ISFCTIANGLSQNELKEINRITRGAWKNYNNETPPIDVLEFGTKKPVEWIYPQDSVVLEI 618

Query: 567 KARAIDTKESEKRKYRSGCTLHFGYCKQIRYDKDWKTVASFSEFEDMKDARNFYNKRKSH 626
           KAR++D  +  + KY +GCTL+ GYC+QIR DKDW +  +  +          YN+ K H
Sbjct: 619 KARSLDRTDQTQYKYATGCTLYGGYCRQIRQDKDWTSCYTLHDLT--------YNEIKRH 670

Query: 627 QVTDGKK----RASKRAKIGIVNSSEPTALVAP------VSNTFSNCRFRVISDYFDSTK 676
           +  +  K    R+  R K  I++   P  ++        +S+ F    F +ISDY   + 
Sbjct: 671 EKKNKNKQTLIRSYSRKKSKIIS---PAGMLPNGTDLRLISDLFHGLYFYIISDYIPDSD 727

Query: 677 RRRISQEDLCSVILEHGGEIVYTSDENNLPQDNLYIIGEKLTRECKILLNAKNLIIRPSW 736
            +RI +ED+CS+I+++GG ++Y           L I+  K T EC  L+     +I  SW
Sbjct: 728 AQRIDREDICSLIIKNGGRVIYNVIAKTYTISKLRILSSKSTIECTDLVRRGYDVINLSW 787

Query: 737 IFSCIEEGYKTPFTESD---IFRGELESSMDCSQFYTDFNTASLN-----HLLETANRGI 788
           +F C++ G   P   +    +    L  + D    + D   A+L       LL++    +
Sbjct: 788 LFDCLQAGVILPLEPAHCLFVSNELLAIATDRIDKFGDSYEATLIDSKLLKLLDSNINKV 847

Query: 789 KNPDSDLLL-------PEVPLFLFSNLKLAVLNSENVL---DTSILEVEFAIKCHGGELV 838
              +S+LLL         +P+FLF+N K  ++  + +L   DT I    F IK +GG LV
Sbjct: 848 NRSNSNLLLINKDEGVDSIPIFLFTNRKFFLIKEDILLGDRDTLI----FQIKLYGGSLV 903

Query: 839 -HIENASIII-VFNDFISREDLFSLRQKIASKAVKESTESTPRIPRMVDISWALDSIKDN 896
             +E+ +II+ V    +  + L  LR K+  + V ++    P IPR V++SW  +SIK  
Sbjct: 904 TKLEDCNIIVGVCGSQLVNKKLGDLRCKLVKQYV-DANFPQP-IPRAVNVSWITESIKAG 961

Query: 897 YIAETEHYQCL 907
           Y    E Y  L
Sbjct: 962 YQLSPEDYPIL 972

>YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON}
           DNL4DNA ligase required for nonhomologous end-joining
           (NHEJ), forms stable heterodimer with required cofactor
           Lif1p, interacts with Nej1p; involved in meiosis, not
           essential for vegetative growth
          Length = 944

 Score =  737 bits (1902), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/943 (42%), Positives = 573/943 (60%), Gaps = 74/943 (7%)

Query: 5   ENFSPSPEFKWLCDELLGKIYETS-SKKHLIGKPVTVRYLEIITNFIKLWRSTVGNYIYP 63
           +NF+PSP+FKWLC+EL  KI+E   +     GK  + +Y EII+NF+++WR TVGN IYP
Sbjct: 12  QNFAPSPDFKWLCEELFVKIHEVQINGTAGTGKSRSFKYYEIISNFVEMWRKTVGNNIYP 71

Query: 64  ALRLIVPFRDRRIYNVKENTLIKALCRYLRLPKSSETENRLLRWKQRAARGVKLSDFCVE 123
           AL L +P+RDRRIYN+K+  LI+ +C YL+LPK+S TE RL  WKQR  +G  LS   VE
Sbjct: 72  ALVLALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEQRLKDWKQRVGKGGNLSSLLVE 131

Query: 124 EIRKRQKDYEGANRITIDELNGYLDEVSQEGNGKRMGYMALTDSRAFNYCLNHMTFMEMK 183
           EI KR+ +   +  ITID +N YLD +S +      G+ +L  S+ F +C+ +M+F+E+K
Sbjct: 132 EIAKRRAE-PSSKAITIDNVNHYLDSLSGDRFASGRGFKSLVKSKPFLHCVENMSFVELK 190

Query: 184 FFFDIILKTRVLSGLENMFLTAWHPDATDYLSVVSDLDVLSQRLYNPNERLRQTDLSITI 243
           +FFDI+LK RV+ G E+  L  WHPDA DYLSV+SDL V++ +LY+P  RL+  DLSI +
Sbjct: 191 YFFDIVLKNRVIGGQEHKLLNCWHPDAQDYLSVISDLKVVTSKLYDPKVRLKDDDLSIKV 250

Query: 244 SHAFEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGVDFS 303
             AF PQLAK+ +LSYE++   L  DF++EEKMDGER+Q+HY+NYGE IK+ SRRG+D++
Sbjct: 251 GFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIKFFSRRGIDYT 310

Query: 304 YLYGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQSELA 363
           YLYG + SSG IS  L+   +VK+C+LDGEM+T+D ++ ++LPFGLVK SA   +     
Sbjct: 311 YLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGSAKEALS--FN 368

Query: 364 GIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKAINAE 423
            I   + + PL++ FDL+YLNG SLT L L +RK YL  IL+P++  VEI++  +    E
Sbjct: 369 SINNVD-FHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRSSRCYGVE 427

Query: 424 AIKDSLEQAISMGSEGIVLKHLHSKYFVGSRNTDWIKIKPEYLEQFGENMDLLIIGREQG 483
           +IK SLE AIS+GSEG+VLK+ +S Y V SRN +WIK+KPEYLE+FGEN+DL++IGR+ G
Sbjct: 428 SIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLIVIGRDSG 487

Query: 484 KKDSFFCGLSISDPNEVAEK------------------------PRFISFCTIANGLSNE 519
           KKDSF  GL + D  E  +                          + +SFC+IANG+S E
Sbjct: 488 KKDSFMLGLLVLDEEEYKKHQGDSSEIVDHSSQEKHIQNSRRRVKKILSFCSIANGISQE 547

Query: 520 EFKDIERKTWGKWHIFSEDPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTKESEKR 579
           EFK+I+RKT G W   SE  P  ++L FG+K+P EWI P +S+VLE+K+R++D  E+  +
Sbjct: 548 EFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIKSRSLDNTETNMQ 607

Query: 580 KYRSGCTLHFGYCKQIRYDKDWKTVASFSEFEDMKDARNFYNKRKSHQVTDGKKRASKRA 639
           KY + CTL+ GYCK+IRYDK+W    + ++  +            S  V       ++R+
Sbjct: 608 KYATNCTLYGGYCKRIRYDKEWTDCYTLNDLYE------------SRTVKSNPSYQAERS 655

Query: 640 KIGIVNSSEPTALVA----------PVSNTFSNCRFRVISDYFDSTKRRRISQEDLCSVI 689
           ++G++       L++          P+SN F+   F V+SDY       RI++ +L   I
Sbjct: 656 QLGLIRKKRKRVLISDSFHQNRKQLPISNIFAGLLFYVLSDYVTEDTGIRITRAELEKTI 715

Query: 690 LEHGGEIVYTSDENNLPQDNLYIIGEKLTRECKILLNAKNLIIRPSWIFSCIEEGYKT-- 747
           +EHGG+++Y          ++ +I  K T ECK L++    I+ P+W+  CI   YK   
Sbjct: 716 VEHGGKLIYNVILKRHSIGDVRLISCKTTTECKALIDRGYDILHPNWVLDCI--AYKRLI 773

Query: 748 ------PFTESDIFRGELESSMDC--SQFYTDFNTASLNHL----LETANRGIKNPDSDL 795
                  F  S   R   E  +DC    F  D +   L+ L    L     G    DS+ 
Sbjct: 774 LIEPNYCFNVSQKMRAVAEKRVDCLGDSFENDISETKLSSLYKSQLSLPPMGELEIDSE- 832

Query: 796 LLPEVPLFLFSNLKLAVLNSENVLDTSILEVEFAIKCHGGELVHIENAS--IIIVFNDFI 853
            +   PLFLFSN    V   +   +  I+E++  IK  GG++   ++    III + D I
Sbjct: 833 -VRRFPLFLFSNRIAYVPRRKISTEDDIIEMK--IKLFGGKITDQQSLCNLIIIPYTDPI 889

Query: 854 SREDLFSLRQKIASKAVKESTESTPRIPRMVDISWALDSIKDN 896
            R+D  +   +   + +K S ++ P+I R+V   W   SI +N
Sbjct: 890 LRKDCMNEVHEKIKEQIKAS-DTIPKIARVVAPEWVDHSINEN 931

>TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON}
           Anc_6.18 YOR005C
          Length = 966

 Score =  731 bits (1887), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/956 (41%), Positives = 598/956 (62%), Gaps = 90/956 (9%)

Query: 6   NFSPSPEFKWLCDELLGKIYETSSK-KHLIGKPVTVRYLEIITNFIKLWRSTVGNYIYPA 64
           NFSPSP+FKWLC+EL  K+ E   K K +  +P  ++Y  +I NFI LWR TVGN IYPA
Sbjct: 18  NFSPSPDFKWLCNELFVKLDEVRLKPKSVDTRPKNIQYDIVINNFIHLWRVTVGNDIYPA 77

Query: 65  LRLIVPFRDRRIYNVKENTLIKALCRYLRLPKSSETENRLLRWKQRAARGVKLSDFCVEE 124
           LRLI+P+RDRR Y ++E+TLI+ +C YL+L K+S TE RL RWKQ+A R + LS FC++E
Sbjct: 78  LRLILPYRDRRNYYIREHTLIRIVCDYLKLQKNSVTEQRLRRWKQKARRSINLSSFCIQE 137

Query: 125 IRKRQKDYEGANRITIDELNGYLDEVSQEGNGKRMGYMA----LTDSRAFNYCLNHMTFM 180
           I+KR  +     +ITID+LN  LD +S E +  ++   +    L+   +  YC  +M+F+
Sbjct: 138 IKKRLSEPVSKEKITIDKLNSILDSLSMERSSSKITNGSSGKKLSQLESIKYCFENMSFI 197

Query: 181 EMKFFFDIILKTRVLSGLENMFLTAWHPDATDYLSVVSDLDVLSQRLYNPNERLRQTDLS 240
           E+++FFDI++K R++ GLE+ FL AWHPDA DYLSVVS+L++++++L+NPN RL   DL+
Sbjct: 198 ELEYFFDILIKARLIGGLEHKFLNAWHPDANDYLSVVSELNIVTEKLWNPNFRLNSKDLT 257

Query: 241 ITISHAFEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGV 300
           I + +AFEPQLAK+ +LSYE ++ ++ + F IEEKMDGER+QIHY++YG QIKY SRRG 
Sbjct: 258 IALHNAFEPQLAKKVNLSYEVLSRRMNNKFTIEEKMDGERIQIHYMDYGHQIKYFSRRGN 317

Query: 301 DFSYLYGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQS 360
           D++YLYG++ S+  IS  L+L+ +VK+CILDGEM++YD  ++ +LPFG+VKS A N ++ 
Sbjct: 318 DYTYLYGKDKSTATISKYLQLNEDVKECILDGEMVSYDKSRNCILPFGMVKSGAANSLK- 376

Query: 361 ELAGIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKAI 420
            + G+   +   PLF+ FD+++LNG  LTNL L +RK+YL+ ILTP +  +EI+++  A 
Sbjct: 377 -IDGLE-NDLCSPLFIVFDVLFLNGSPLTNLPLYQRKEYLSNILTPKKSHIEILKFSIAH 434

Query: 421 NAEAIKDSLEQAISMGSEGIVLKHLHSKYFVGSRNTDWIKIKPEYLEQFGENMDLLIIGR 480
           ++E+I+ +L+ AIS+GSEGIVLK   S Y VG RN DWIK+KPEYLEQFGEN+DL++IGR
Sbjct: 435 DSESIRSALQAAISVGSEGIVLKKYDSLYSVGDRNNDWIKVKPEYLEQFGENLDLIVIGR 494

Query: 481 EQGKKDSFFCGLSISDPNEVAEK-------------------------------PRFISF 509
           + GKKDS  CG+++ +  E  EK                                +FISF
Sbjct: 495 DPGKKDSLMCGVAVLENEESYEKILQEEVITLTSDDDDSQNNIPEDKPIRTKRITKFISF 554

Query: 510 CTIANGLSNEEFKDIERKTWGKWHIFSEDPPSPNLLGFGTKVPYEWIHPEDSVVLEVKAR 569
           C IANG+SNEEFK+I+RKT+G W  FS++ P  + L FGT++P EWI+P DSVVLEVKAR
Sbjct: 555 CVIANGISNEEFKEIDRKTFGCWKKFSDEAPPTDYLEFGTRLPVEWINPHDSVVLEVKAR 614

Query: 570 AIDTKESEKRKYRSGCTLHFGYCKQIRYDKDWKTVASFSEFEDMKDARNFYNKRKSHQVT 629
           +++  E+ + K+++G TL+  YC++IR DKD+    +FS   D+  A N   KR S ++ 
Sbjct: 615 SLENNEALRDKFKTGYTLYGAYCRRIRTDKDFNDCYTFS---DLVIATN--KKRSSSELY 669

Query: 630 DG----KKRASKRAKIGIVNSS-----EPTALVAPVSNTFSNCRFRVISDYFDSTKRRRI 680
                 KK+ S+ +K+ ++N +     + T   + +   F    F VISDY DS    R+
Sbjct: 670 GNHSHIKKKRSRTSKVNMLNQTLSIQDDDTGFTSKI---FDGLSFFVISDYVDSNSSFRL 726

Query: 681 SQEDLCSVILEHGGEIVYTSDENNLPQDNLYIIGEKLTRECKILLNAKNLIIRPSWIFSC 740
             ++L ++I  +GG++++     NL +  + I+  K T EC  L+     II P WI  C
Sbjct: 727 RIDELINIIKVNGGQLIFNLVSQNLNEKYVRIMSCKKTFECNELIKRGYDIIHPKWILDC 786

Query: 741 IEEGYKTPFTESDIFRGELESSMDCSQFYTDFNTASLNHLLETANRGIKNPDSDLLLP-- 798
           I       F  S  F        + SQ  +  +   ++ L ++  + I   + +LL+   
Sbjct: 787 IANDKLLDFEPSHCF--------NVSQSLSTISKQRVDLLGDSYQKYITEEELELLISSK 838

Query: 799 ------------------EVPLFLFSNLKLAVLNSENVLDTSILEVEFAIKCHGGELV-H 839
                             ++P+FLFSN K A    +   +  + E    IK +GG  V +
Sbjct: 839 TPKEQLYSNPLQFDQQIEKIPIFLFSN-KKAYTPKQCFSEKLLKETNLYIKLYGGTSVNN 897

Query: 840 IENASIIIVFNDF--ISREDLFSLRQKIASKAVKESTESTPRIPRMVDISWALDSI 893
           I + ++II+ ++    S E + S+R++++  AV  S+ +   IPR+V   W   SI
Sbjct: 898 INDCNVIIIGDEHSKSSNEKISSIRKELSIHAV--SSNNVIPIPRIVSYKWIEKSI 951

>Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {ON}
           YOR005C (REAL)
          Length = 947

 Score =  716 bits (1848), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/938 (41%), Positives = 576/938 (61%), Gaps = 62/938 (6%)

Query: 5   ENFSPSPEFKWLCDELLGKIYETS-SKKHLIGKPVTVRYLEIITNFIKLWRSTVGNYIYP 63
           +NF+PSP+FKWLC+EL  +I     +     GK  + +Y EII+NF++ WR  VGN IYP
Sbjct: 12  QNFAPSPDFKWLCEELFVRIDNVRINGTAGTGKSASFKYYEIISNFVESWRKGVGNNIYP 71

Query: 64  ALRLIVPFRDRRIYNVKENTLIKALCRYLRLPKSSETENRLLRWKQRAARGVKLSDFCVE 123
           AL L +P+RDRRIYN+K+  LI+ +C YL+LP++S TE RL  WKQR +R   LS   VE
Sbjct: 72  ALVLALPYRDRRIYNIKDYILIRTICSYLKLPRNSVTEQRLKSWKQRVSRARNLSSLLVE 131

Query: 124 EIRKRQKDYEGANRITIDELNGYLDEVSQEGNGKRMGYMALTDSRAFNYCLNHMTFMEMK 183
           EI KR+ +  G + ITID +N YLDE+S+E +    G+  L +S+ F  CL  M+F+E+K
Sbjct: 132 EIAKRRPEPNGKS-ITIDGVNDYLDELSKERSISGRGFKDLVNSKPFLSCLESMSFVELK 190

Query: 184 FFFDIILKTRVLSGLENMFLTAWHPDATDYLSVVSDLDVLSQRLYNPNERLRQTDLSITI 243
           +FFDI+LK RV+ G E+ FL  WHPDA DYLSVVSDL V++ +LY+P  RL+  DLSI +
Sbjct: 191 YFFDIVLKNRVIGGQEHRFLNCWHPDAQDYLSVVSDLKVVTSKLYDPRVRLKNDDLSIKV 250

Query: 244 SHAFEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGVDFS 303
             AF PQLAK+  L YE++   L +DF+IEEKMDGER+Q+HY+NYG+ IK+ SRRG+D++
Sbjct: 251 GFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFFSRRGIDYT 310

Query: 304 YLYGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQSELA 363
           YLYG + SSG IS  LKL   VK+C+LDGEM+T+D+ + ++LPFGLVK SA   +     
Sbjct: 311 YLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAKGVLSCSDI 370

Query: 364 GIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKAINAE 423
                  ++PL++ FDL+YLN  SL  L L +RK YL+ ILTP +  VEI+Q  +  + +
Sbjct: 371 N---NSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTRCYDVQ 427

Query: 424 AIKDSLEQAISMGSEGIVLKHLHSKYFVGSRNTDWIKIKPEYLEQFGENMDLLIIGREQG 483
           ++K+SLE AIS+GSEG+VLK+ +S Y + SRN +WIK+KPEYLE+FGEN+DL+IIGR+ G
Sbjct: 428 SVKNSLEVAISLGSEGVVLKYYNSSYNIASRNYNWIKVKPEYLEEFGENLDLIIIGRDSG 487

Query: 484 KKDSFFCGLSISDPNEVAEKPR--------------------------FISFCTIANGLS 517
           KKDSF  GL + D  E+ E+ +                           +SFC++ANG+S
Sbjct: 488 KKDSFMLGLLVIDEREMEERDQELSSSEVVNDSKIEQDVINSKKKVKKVLSFCSVANGIS 547

Query: 518 NEEFKDIERKTWGKWHIFSEDPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTKESE 577
           +EEFK+I R+T G W   S+  P P++L FG+++P EWI P DS+VLE+K+R++D  E+ 
Sbjct: 548 HEEFKEINRRTRGHWKRTSDFSP-PSILQFGSRIPAEWIEPSDSIVLEIKSRSLDNTETS 606

Query: 578 KRKYRSGCTLHFGYCKQIRYDKDWKTVASFSEFEDMKDARNFYNKRKSHQVTDGKKRASK 637
            R+Y + CTL+ GYC++IRYDKDW    + ++  + +  ++  N++  +       +  K
Sbjct: 607 IRRYATSCTLYGGYCRRIRYDKDWTDCYTLAQLYEDRPIKSKPNQQDENFQLQLAHKKRK 666

Query: 638 RAKIGIVNSSEPTALVAP---VSNTFSNCRFRVISDYFDSTKRRRISQEDLCSVILEHGG 694
           RA I     S+P   +     +S+ F+   F V+SDY       RI++  L   I++HGG
Sbjct: 667 RALI-----SDPFHQIREQKLISSIFAGLFFYVLSDYVTKDTGVRITRAGLEDAIVKHGG 721

Query: 695 EIVYTSDENNLPQDNLYIIGEKLTRECKILLNAKNLIIRPSWIFSCIEEGYKT------- 747
           ++++          ++ +I  K T EC+IL++    I+ PSW+  CI   YK        
Sbjct: 722 KLIHNVILKRHCIGDVRLISCKTTIECRILIDRGYDIVHPSWVMDCI--AYKQLIFIEPS 779

Query: 748 -PFTESDIFRGELESSMDC--SQFYTDFNTASLNHLLET----ANRGIKNPDSDLLLPEV 800
             F+ S   R   E  +DC    F  + +   L+ L ++    ++ G    DS+  +  +
Sbjct: 780 YCFSVSHKLREVAEKRVDCLGDSFENNISERKLSLLFKSRQDLSSIGEIGIDSEAQV--I 837

Query: 801 PLFLFSNLKLAVLNSENVLDTSILEVEFAIKCHGGELVHIENAS--IIIVFNDFISREDL 858
           PLFLFSN  + +  ++  L    L +E  I+  GGE+   ++    III + D   R+D 
Sbjct: 838 PLFLFSNRIVYIPRTKTGLREEKL-LEMKIRLFGGEITGQQSLCNLIIIPYVDSSRRKDC 896

Query: 859 FSLRQKIASKAVKESTESTPRIPRMVDISWALDSIKDN 896
                +   + +K S  + P++ R+V   W   SI +N
Sbjct: 897 IEKVNEQIKEQMKAS-HTVPKVARIVSPGWVDHSINEN 933

>SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 693

 Score =  114 bits (285), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 96/379 (25%), Positives = 175/379 (46%), Gaps = 27/379 (7%)

Query: 247 FEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGVDFSYLY 306
            +P LAK +    E +       F  E K DGER Q+H +  G    Y SR G + +  Y
Sbjct: 329 LKPMLAKPSKSITEVLDRFHGEKFTCEYKYDGERAQVHLLPDGSMNIY-SRNGENMTERY 387

Query: 307 GENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQSELAGIA 366
            E      ++     H      ILD E + +DTE+  +LPF ++ +     ++++   + 
Sbjct: 388 PELHIRDYLADPETTH----SLILDCEAVAWDTEQGKILPFQILSTRKRKGVEAKDVKV- 442

Query: 367 PTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKAINAEAIK 426
                +    AFD++  NG+SL N +L  R++YL ++L PV    +    + + N E ++
Sbjct: 443 -----RVCLFAFDMLCYNGQSLINNSLLERREYLQRVLKPVTGQFQFANELNSSNLEDVQ 497

Query: 427 DSLEQAISMGSEGIVLKHL---HSKYFVGSRNTDWIKIKPEYLEQFGENMDLLIIGR--E 481
             LEQ++    EG+++K L    S Y    R+ +W+K+K +YL+  G+++DL ++G    
Sbjct: 498 KYLEQSVKDACEGLMVKVLEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYG 557

Query: 482 QGKKDSFFCGLSISDPNEVAEKPRFISFCTIANGLSNEEFKDIERKTWGKWHIFSEDPPS 541
           +GK+   + G  +   N+  +   F + C I  G S+E    +    + K    S + P 
Sbjct: 558 RGKRTGTYGGFLLGCYNQ--DTGEFETCCKIGTGFSDEMLVSL----YEKLKPSSLEQPK 611

Query: 542 PNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTK---ESEKRKYRSGCTLHFGYCKQIRYD 598
              +   +  P  W  P  +++ EV    +      ++    Y  G +L F    +IR D
Sbjct: 612 AFYVYDSSAEPDVWFEP--TMLFEVLTADLSLSPIYKAGNSAYGKGISLRFPRFIRIRDD 669

Query: 599 KDWKTVASFSEFEDMKDAR 617
           KD +   S  +  ++ +++
Sbjct: 670 KDVEDATSSEQIVELYESQ 688

>TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.343
           YDL164C
          Length = 736

 Score =  112 bits (280), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 100/382 (26%), Positives = 171/382 (44%), Gaps = 54/382 (14%)

Query: 247 FEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGVDFSYLY 306
            +P LAK T    E + +    +FI E K DGER Q+H +  GE ++  SR G + +  Y
Sbjct: 359 LKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLEGGE-MRIYSRNGENMTERY 417

Query: 307 GE--------------NSSSG--PISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLV 350
            E              N   G   I P       VKD ILD E++ +D E+  +LPF ++
Sbjct: 418 PELDVKDFLCVVKAITNDQEGENAIQP-------VKDIILDCEVVAWDVEQKKILPFQVL 470

Query: 351 KSSAMNQIQSELAGIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERS 410
            +     +  +   +      +    AFDL+YLN + + N +L  R++ L K+   V   
Sbjct: 471 TTRKRKNVDLKDVKV------RVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPGE 524

Query: 411 VEIIQYMKAINAEAIKDSLEQAISMGSEGIVLKHL---HSKYFVGSRNTDWIKIKPEYLE 467
            +    +   + + ++  L+QA+    EG+++K L    S Y    R+ +W+K+K +YL+
Sbjct: 525 FQYATSLITSDMDELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYLD 584

Query: 468 QFGENMDLLIIGR--EQGKKDSFFCGLSISDPNEVAEKPRFISFCTIANGLSNEEFKDIE 525
             G+++DL+++G    +GK+   + G  +   NE  ++  F + C I  G S+E      
Sbjct: 585 GVGDSLDLVVMGAYFGKGKRTGSYGGFLLGCYNEDTQE--FETCCKIGTGFSDE------ 636

Query: 526 RKTWGKWHIFSE----DPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTK---ESEK 578
               G  H   +    D P    +   +  P  W   +  V+ EV    +      ++  
Sbjct: 637 --MLGNLHTLLQPTEIDNPPMTYIYDSSAEPDVWFQAK--VLFEVLTADLSLSPVYKAGN 692

Query: 579 RKYRSGCTLHFGYCKQIRYDKD 600
            +Y  G +L F    +IR DKD
Sbjct: 693 SRYDKGISLRFPRFLRIREDKD 714

>ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} similar
           to uniprot|P04819 Saccharomyces cerevisiae YDL164C CDC9
           DNA ligase found in the nucleus and mitochondria an
           essential enzyme that joins Okazaki fragments during DNA
           replication also acts in nucleotide excision repair base
           excision repair and recombination
          Length = 731

 Score =  109 bits (273), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 97/389 (24%), Positives = 177/389 (45%), Gaps = 36/389 (9%)

Query: 241 ITISHAFEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGV 300
           +T     +P LAK T    E +       F+ E K DGER Q+H +  G  ++  SR G 
Sbjct: 363 LTPGIPLKPMLAKPTKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDG-TMRIYSRNGE 421

Query: 301 DFSYLYGE----NSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMN 356
           + +  Y E    +  S P + SL         ILD E + +D E+  +LPF ++ +    
Sbjct: 422 NMTERYPEIDIRDFLSDPSTESL---------ILDCEAVAWDKEQGKILPFQVLSTRKRK 472

Query: 357 QIQSELAGIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQY 416
            + ++   +      +    AFDL+  NG+ L N +L  R+D L K+  PV+        
Sbjct: 473 DVDAKDVKV------RVCLFAFDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANK 526

Query: 417 MKAINAEAIKDSLEQAISMGSEGIVLKHL---HSKYFVGSRNTDWIKIKPEYLEQFGENM 473
           +   N E ++  L+Q++    EG+++K L    S Y    R+ +W+K+K +YL   G+++
Sbjct: 527 LITANIEELQHFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSL 586

Query: 474 DLLIIGR--EQGKKDSFFCGLSISDPNEVAEKPRFISFCTIANGLSNEEFKDIERKTWGK 531
           DL ++G    +GK+   + G  +   N+  +   + + C I  G S E  + +    + +
Sbjct: 587 DLCVLGAYYGRGKRTGTYGGFLLGCYNQ--DTGEYETCCKIGTGFSEELLQQL----YDR 640

Query: 532 WHIFSEDPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTK---ESEKRKYRSGCTLH 588
               + + P+   +    + P  W  P  +++ EV A  +      ++   +Y  G +L 
Sbjct: 641 LKPTAMEAPAAFYVYDSAQQPDVWFEP--TLLFEVLAADLSLSPVYKAGSAQYDKGISLR 698

Query: 589 FGYCKQIRYDKDWKTVASFSEFEDMKDAR 617
           F    +IR DK  +   S  +  D+ +A+
Sbjct: 699 FPRFLRIRDDKSVEEATSSEQVVDLYEAQ 727

>Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL164C
           (CDC9) - DNA ligase [contig 161] FULL
          Length = 715

 Score =  107 bits (268), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 96/397 (24%), Positives = 185/397 (46%), Gaps = 43/397 (10%)

Query: 241 ITISHAFEPQLAKRTHLSYERVASKLQ-HDFIIEEKMDGERLQIHYINYGEQIKYLSRRG 299
           +T     +P LAK +  S   V  + Q   F  E K DGER Q+H +  G  ++  SR G
Sbjct: 346 LTPGIPLKPMLAKPSK-SISEVLDRFQGQRFTCEYKYDGERAQVHLLPDG-SMRIYSRNG 403

Query: 300 VDFSYLYGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQ 359
            + +  Y E + S  ++   + H  + DC    E + +D +K+++LPF ++ +     + 
Sbjct: 404 ENMTERYPEINISDFVAHPDETHTLILDC----EAVAWDKDKNVILPFQVLSTRKRKGVV 459

Query: 360 SELAGIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKA 419
           +E   +      +    AFD++  N + L N +L  R+ YL +IL PV   +++   +  
Sbjct: 460 AEDVKV------RVCLFAFDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTT 513

Query: 420 INAEAIKDSLEQAISMGSEGIVLKHL---HSKYFVGSRNTDWIKIKPEYLEQFGENMDLL 476
           ++ + ++  L+Q++    EG+++K L    S Y    R+ +W+K+K +YL+  G+++DL 
Sbjct: 514 MSLDEMQLYLDQSVKDCCEGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLC 573

Query: 477 IIGR--EQGKKDSFFCGLSISDPNEVAEKPRFISFCTIANGLSNEEFKDIERKTW----- 529
           ++G    +GK+   + G  +   N+  +   F + C I  G S+E  +++  K       
Sbjct: 574 VLGAYYGRGKRTGTYGGFLLGCYNQ--DTGEFETCCKIGTGFSDEMLQNLYEKLSPTEIP 631

Query: 530 --GKWHIFSEDPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTKESEK---RKYRSG 584
               ++++SE           +  P  W+ P  S++ EV    +      K     Y  G
Sbjct: 632 EPKAFYVYSE-----------SAQPDVWLEP--SMLFEVLTADLSLSPVYKAGGSSYGKG 678

Query: 585 CTLHFGYCKQIRYDKDWKTVASFSEFEDMKDARNFYN 621
            +L F    +IR DK  +   S  +  +  ++++  N
Sbjct: 679 ISLRFPRFIRIRDDKSVEDATSSEQVIEFYESQSHIN 715

>ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL164C (CDC9)
          Length = 697

 Score =  107 bits (266), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 83/296 (28%), Positives = 140/296 (47%), Gaps = 32/296 (10%)

Query: 241 ITISHAFEPQLAKRTHLSYERVASKLQ-HDFIIEEKMDGERLQIHYINYGEQIKYLSRRG 299
           +T     +P LAK T  S   V  + Q   F  E K DGER Q+H +  G  I+  SR  
Sbjct: 327 LTPGIPLKPMLAKPTK-SITEVLDRFQGQRFTCEYKYDGERAQVHLMEDG-TIRIYSRNS 384

Query: 300 VDFSYLYGENSSSGPISPSLKLHF------NVKDCILDGEMITYDTEKDIVLPFGLVKSS 353
            + +  Y          P ++ H         +  I+D E + +D EK  +LPF ++ + 
Sbjct: 385 ENMTERY----------PEIQFHQFLANPQTTRSLIIDCEAVAWDNEKQKILPFQVLSTR 434

Query: 354 AMNQIQSELAGIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEI 413
               +  EL  +      +    AFDL+YLNG+SL   +L  R+ +L  +L  V   ++ 
Sbjct: 435 KRKGV--ELKDV----KVRVCLFAFDLLYLNGESLLKCSLADRRKHLYSVLKVVPGELQF 488

Query: 414 IQYMKAINAEAIKDSLEQAISMGSEGIVLKHL---HSKYFVGSRNTDWIKIKPEYLEQFG 470
              +  +    ++  LEQ++S   EG+++K L    S+Y    R+ +W+K+K +YLE  G
Sbjct: 489 ANEITTMELSELQTYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLKLKKDYLEGVG 548

Query: 471 ENMDLLIIGR--EQGKKDSFFCGLSISDPNEVAEKPRFISFCTIANGLSNEEFKDI 524
           +++DL ++G    +GK+   + G  +   N   E+  F + C I  G S E  + +
Sbjct: 549 DSLDLAVLGAYYGRGKRTGTYGGFLLGCYNPDLEE--FETCCKIGTGFSEEVLQSL 602

>NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {ON}
           Anc_7.343 YDL164C
          Length = 765

 Score =  106 bits (264), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 94/368 (25%), Positives = 163/368 (44%), Gaps = 27/368 (7%)

Query: 247 FEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGVDFSYLY 306
            +P LAK T    E +       F  E K DGER Q+H +  G  ++  SR G + +  Y
Sbjct: 401 LKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDG-TMRIYSRNGENMTERY 459

Query: 307 GENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQSELAGIA 366
            E      I   +K     K  ILD E + +D E+  +LPF ++ +     +      +A
Sbjct: 460 PEIH----IGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKRKDV------LA 509

Query: 367 PTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKAINAEAIK 426
                +    AFD++  N   L N +L+ R++ L ++ TP     +    +   N + ++
Sbjct: 510 KDVKVRVCLFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATELTTSNLDELQ 569

Query: 427 DSLEQAISMGSEGIVLKHL---HSKYFVGSRNTDWIKIKPEYLEQFGENMDLLIIGR--E 481
             L+Q+++   EG+++K L    S Y    R+ +W+K+K +YLE  G+++DL ++G    
Sbjct: 570 KFLDQSVNDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVLGAYYG 629

Query: 482 QGKKDSFFCGLSISDPNEVAEKPRFISFCTIANGLSNEEFKDIERKTWGKWHIFSEDPPS 541
           +GK+   + G  +   N+      F + C I  G S+E  + +  K   K  +   D P 
Sbjct: 630 RGKRTGTYGGFLLGCYND--NTGEFETCCKIGTGFSDEMLQQLHEKL--KATVI--DGPK 683

Query: 542 PNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTK---ESEKRKYRSGCTLHFGYCKQIRYD 598
              +   +  P  W  P  S++ EV    +      ++    Y  G +L F    +IR D
Sbjct: 684 ATYIYDSSAEPDVWFEP--SLLFEVLTADLSLSPIYKAGSSAYDKGVSLRFPRFIRIRED 741

Query: 599 KDWKTVAS 606
           K  +   S
Sbjct: 742 KGVEDATS 749

>TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.343
           YDL164C
          Length = 720

 Score =  105 bits (263), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 98/382 (25%), Positives = 167/382 (43%), Gaps = 27/382 (7%)

Query: 239 LSITISHAFEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRR 298
           + +T     +P LAK T    E + +     F  E K DGER Q+H +  G  ++  SR 
Sbjct: 348 IKLTPGIPLKPMLAKPTKSISEVLDTFQNIQFTSEYKYDGERAQVHLLPDGS-MRIYSRN 406

Query: 299 GVDFSYLYGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQI 358
           G D +  Y E +    I   L         ILD E + +D E   +LPF ++ +     +
Sbjct: 407 GEDMTQRYPELN----IQDYLVDSTTTTQLILDCEAVAWDVELQKILPFQVLSTRKRKSV 462

Query: 359 QSELAGIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMK 418
             +L  I      +    AFD++  N  SL N  L  R+D L  I  P     +    + 
Sbjct: 463 --DLKDI----KVRVCLFAFDILRHNNDSLINNTLRERRDILHSITKPCPGQFQFATELT 516

Query: 419 AINAEAIKDSLEQAISMGSEGIVLKHL---HSKYFVGSRNTDWIKIKPEYLEQFGENMDL 475
             N + ++  L++AI    EG+++K L    S Y    R+ +W+K+K +YL+  G+++DL
Sbjct: 517 TSNLDELQTFLDKAIKDSCEGLMVKSLDGTDSHYEPSKRSRNWLKLKKDYLQGMGDSLDL 576

Query: 476 LIIGR--EQGKKDSFFCGLSISDPNEVAEKPRFISFCTIANGLSNEEFKDIERKTWGKWH 533
            ++G    +GK+   + G  ++  N+  E+  F + C I  G S+E  + +    +    
Sbjct: 577 CVLGAYYGRGKRTGTYGGFLLACYNQDTEE--FETCCKIGTGFSDEMLQTL----YNGLK 630

Query: 534 IFSEDPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTK---ESEKRKYRSGCTLHFG 590
             + + P  N +   +  P  W +P  ++V EV    +      ++    Y  G +L F 
Sbjct: 631 ETAIESPRANFVFDSSAEPDVWFNP--TMVFEVLTADLSLSPIYKAGSTVYGKGISLRFP 688

Query: 591 YCKQIRYDKDWKTVASFSEFED 612
              +IR DK      S  +  D
Sbjct: 689 RFIRIRTDKSVNDATSSEQVID 710

>KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]
           {ON} similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination,
          Length = 700

 Score =  105 bits (261), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 98/376 (26%), Positives = 170/376 (45%), Gaps = 43/376 (11%)

Query: 247 FEPQLAKRTHLSYERVASKLQH-DFIIEEKMDGERLQIHYINYGEQIKYLSRRGVDFSYL 305
            +P LAK T  S   V  + Q   F  E K DGER Q+H    G  +K  SR G D +  
Sbjct: 337 LQPMLAKPTK-SISEVLDRFQGTKFTCEYKYDGERAQVHLCRDG-SMKIYSRNGEDMTER 394

Query: 306 YGENSSSGPISPSLKLHFNVKDC------ILDGEMITYDTEKDIVLPFGLVKSSAMNQIQ 359
           Y          P + +   VKD       I+D E + +D E+  +LPF ++ +     + 
Sbjct: 395 Y----------PEIDVKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKRKGV- 443

Query: 360 SELAGIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKA 419
            EL  +      +    AFD++ LN + L N +   R+  L       +   +    +  
Sbjct: 444 -ELKDV----KVRVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELTT 498

Query: 420 INAEAIKDSLEQAISMGSEGIVLKHLH---SKYFVGSRNTDWIKIKPEYLEQFGENMDLL 476
            N + ++  L+Q++    EG+++K L    S Y    R+ +W+K+K +YLE  G+++DL+
Sbjct: 499 TNFDELQKYLDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDLV 558

Query: 477 IIGR--EQGKKDSFFCGLSISDPNEVAEKPRFISFCTIANGLSNEEFKDIERKTWGKWHI 534
           ++G    +GK+   + G  +   N  +E+  F + C I  G S+E  +D+    + K   
Sbjct: 559 VLGAYYGRGKRTGTYGGFLLGCYNLDSEE--FETCCKIGTGFSDEMLQDL----YTKLKD 612

Query: 535 FSEDPPSPNLLGFGTKVPYE-WIHPEDSVVLEVKARAIDTKESEKRKYRS---GCTLHFG 590
            + + PS N++ + +  P + W  P  S++ EV    +      K  + +   G +L F 
Sbjct: 613 TTVEHPSTNVI-YDSSAPADVWFEP--SMLFEVLTADLSLSPVYKAGFEAFGKGISLRFP 669

Query: 591 YCKQIRYDKDWKTVAS 606
              +IR DK+     S
Sbjct: 670 RFVRIRDDKNVTDATS 685

>YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}
           CDC9DNA ligase found in the nucleus and mitochondria, an
           essential enzyme that joins Okazaki fragments during DNA
           replication; also acts in nucleotide excision repair,
           base excision repair, and recombination
          Length = 755

 Score =  103 bits (256), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 77/278 (27%), Positives = 139/278 (50%), Gaps = 18/278 (6%)

Query: 247 FEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGVDFSYLY 306
            +P LAK T    E +       F  E K DGER Q+H +N G  ++  SR G + +  Y
Sbjct: 391 LKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDG-TMRIYSRNGENMTERY 449

Query: 307 GENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQSELAGIA 366
            E +    I+  ++     K+ ILD E + +D ++  +LPF ++ +     +  EL  + 
Sbjct: 450 PEIN----ITDFIQDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDV--ELNDV- 502

Query: 367 PTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKAINAEAIK 426
                K    AFD++  N + L N +L+ R++YLTK+   V    +    +   N + ++
Sbjct: 503 ---KVKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITTNNLDELQ 559

Query: 427 DSLEQAISMGSEGIVLKHL---HSKYFVGSRNTDWIKIKPEYLEQFGENMDLLIIGR--E 481
             L+++++   EG+++K L    S Y    R+ +W+K+K +YLE  G+++DL ++G    
Sbjct: 560 KFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYG 619

Query: 482 QGKKDSFFCGLSISDPNEVAEKPRFISFCTIANGLSNE 519
           +GK+   + G  +   N+  +   F + C I  G S+E
Sbjct: 620 RGKRTGTYGGFLLGCYNQ--DTGEFETCCKIGTGFSDE 655

>Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 91/368 (24%), Positives = 167/368 (45%), Gaps = 27/368 (7%)

Query: 247 FEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGVDFSYLY 306
            +P LAK T    E +       F  E K DGER Q+H ++ G  ++  SR G + +  Y
Sbjct: 391 LKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLDDG-TMRIYSRNGENMTERY 449

Query: 307 GENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQSELAGIA 366
            E      I+  ++     K+ ILD E + +D E+  +LPF ++ +     +  EL+ + 
Sbjct: 450 PEIK----ITDFIQDLDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRKDV--ELSDV- 502

Query: 367 PTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKAINAEAIK 426
                +    AFD++  NG+ L N +L  R++ LTK+   V    +    +   N + ++
Sbjct: 503 ---KVRVCLFAFDVLCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTDNLDELQ 559

Query: 427 DSLEQAISMGSEGIVLKHL---HSKYFVGSRNTDWIKIKPEYLEQFGENMDLLIIGR--E 481
             L+++++   EG+++K L    S Y    R+ +W+K+K +YLE  G+++DL ++G    
Sbjct: 560 KFLDESVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYG 619

Query: 482 QGKKDSFFCGLSISDPNEVAEKPRFISFCTIANGLSNEEFKDIERKTWGKWHIFSEDPPS 541
           +GK+   + G  +   N+  +   F + C I  G S+E  + +  +          D P 
Sbjct: 620 RGKRTGTYGGFLLGCYNQ--DTGEFETCCKIGTGFSDESLQQLHERLTPTII----DGPK 673

Query: 542 PNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTK---ESEKRKYRSGCTLHFGYCKQIRYD 598
              +   +  P  W  P  + + EV    +      ++    +  G +L F    +IR D
Sbjct: 674 ATFVFDSSAEPDVWFEP--TTLFEVLTADLSLSPIYKAGSTTFAKGVSLRFPRFLRIRED 731

Query: 599 KDWKTVAS 606
           K  +   S
Sbjct: 732 KGVEDATS 739

>TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {ON}
           Anc_7.343 YDL164C
          Length = 705

 Score =  101 bits (251), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 89/376 (23%), Positives = 171/376 (45%), Gaps = 29/376 (7%)

Query: 247 FEPQLAKRTHLSYERVASKLQ-HDFIIEEKMDGERLQIHYINYGEQIKYLSRRGVDFSYL 305
            +P LAK T  S   V  + Q   F  E K DGER Q+H +  G  ++  SR G + +  
Sbjct: 342 LKPMLAKPTK-SITEVLDRFQGQTFTSEYKYDGERAQVHLLEDG-TMRIYSRNGENMTER 399

Query: 306 YGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQSELAGI 365
           Y E S    I   +    + K  ILD E + +D  +  +LPF ++ +     ++++   +
Sbjct: 400 YPEIS----IRDFVADLEHTKTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEAKDVKV 455

Query: 366 APTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKAINAEAI 425
                 +    AFD++  NG+   N +L  R++ L ++  PV    +    +   + E +
Sbjct: 456 ------RVCLFAFDIICHNGERQINKSLRERRELLAQVTKPVAGEFQYAVELTTSSVEEL 509

Query: 426 KDSLEQAISMGSEGIVLKHL---HSKYFVGSRNTDWIKIKPEYLEQFGENMDLLIIGR-- 480
           +  L+Q++    EG+++K L    S Y    R+ +W+K+K +YL+  G+++DL ++G   
Sbjct: 510 QKFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLGAYY 569

Query: 481 EQGKKDSFFCGLSISDPNEVAEKPRFISFCTIANGLSNEEFKDIERKTWGKWHIFSEDPP 540
            +GK+   + G  +   N+  +   F + C I  G S+E  + +    + ++   + D P
Sbjct: 570 GRGKRTGTYGGFLLGCYNQ--DSGEFETCCKIGTGFSDEMLQQL----YERFSKTTLDGP 623

Query: 541 SPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTK---ESEKRKYRSGCTLHFGYCKQIRY 597
               +   +  P  W  P  + + EV    +      ++    Y  G +L F    ++R 
Sbjct: 624 KATYVFDSSAEPDVWFEP--TTLFEVLTADLSLSPVYKAGASTYDKGVSLRFPRFVRLRD 681

Query: 598 DKDWKTVASFSEFEDM 613
           DK  +   S ++  ++
Sbjct: 682 DKSVEDATSSAQIVEL 697

>Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score =  100 bits (249), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 91/368 (24%), Positives = 166/368 (45%), Gaps = 27/368 (7%)

Query: 247 FEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGVDFSYLY 306
            +P LAK T    E +       F  E K DGER Q+H +N G  ++  SR G + +  Y
Sbjct: 391 LKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDG-TMRIYSRNGENMTERY 449

Query: 307 GENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQSELAGIA 366
            E      I+  ++   + K+ ILD E + +D E+  +LPF ++ +     +  EL  + 
Sbjct: 450 PEIK----ITDFIQDLNSTKNLILDCEAVAWDKEQKKILPFQILSTRKRKDV--ELHDV- 502

Query: 367 PTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKAINAEAIK 426
                K    AFD++  N + L N +L  R+++L K+   V    +    +   N + ++
Sbjct: 503 ---KVKVCLFAFDILCYNDERLINKSLRERREHLAKVTKVVPGEFQYATQIITNNLDELQ 559

Query: 427 DSLEQAISMGSEGIVLKHL---HSKYFVGSRNTDWIKIKPEYLEQFGENMDLLIIGR--E 481
             L+++++   EG+++K L    S Y    R+ +W+K+K +YLE  G+++DL ++G    
Sbjct: 560 KFLDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYG 619

Query: 482 QGKKDSFFCGLSISDPNEVAEKPRFISFCTIANGLSNEEFKDIERKTWGKWHIFSEDPPS 541
           +GK+   + G  +   N+  +   F + C I  G S+E  + +  +          D P 
Sbjct: 620 RGKRTGTYGGFLLGCYNQ--DTGEFETCCKIGTGFSDEMLQLLHERLTPTII----DGPK 673

Query: 542 PNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTK---ESEKRKYRSGCTLHFGYCKQIRYD 598
              +   +  P  W  P  + + EV    +      ++    +  G +L F    +IR D
Sbjct: 674 ATFVFDASAEPDVWFEP--TTLFEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIRED 731

Query: 599 KDWKTVAS 606
           K  +   S
Sbjct: 732 KGVEDATS 739

>CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {ON}
           highly similar to uniprot|P04819 Saccharomyces
           cerevisiae YDL164c CDC9 DNA ligase
          Length = 724

 Score =  100 bits (248), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 92/375 (24%), Positives = 163/375 (43%), Gaps = 27/375 (7%)

Query: 247 FEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGVDFSYLY 306
            +P LAK T    E +       F  E K DGER Q+H +  G  ++  SR G + +  Y
Sbjct: 360 LKPMLAKPTKAINEVLDRFQGQTFTSEYKYDGERAQVHLLKDG-TMRIYSRNGENMTERY 418

Query: 307 GENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQSELAGIA 366
            E      I   L    +    ILD E + +D E++ +LPF ++ +     +      + 
Sbjct: 419 PEIQ----IKDFLADPASTTSLILDCEAVAWDKEQNKILPFQVLTTRKRKDVNINEVKV- 473

Query: 367 PTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKAINAEAIK 426
                +    AFD++  N   L N  L +R++ L ++  PVE   +    M   N + ++
Sbjct: 474 -----RVCLFAFDILLHNDMRLINEPLSKRREVLHEVTKPVEGEFQYATQMTTSNLDELQ 528

Query: 427 DSLEQAISMGSEGIVLKHL---HSKYFVGSRNTDWIKIKPEYLEQFGENMDLLIIGR--E 481
             L++++    EG+++K +    S Y    R+ +W+K+K +YLE  G+++DL ++G    
Sbjct: 529 KFLDESVKNSCEGLMVKMMDGVESYYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYFG 588

Query: 482 QGKKDSFFCGLSISDPNEVAEKPRFISFCTIANGLSNEEFKDIERKTWGKWHIFSEDPPS 541
           +GK+   + G  +   N  A+   F + C I  G S E  + +    + K      D P 
Sbjct: 589 RGKRTGTYGGFLLGCYN--ADSEDFETCCKIGTGFSEEMLQTL----YEKLSPTVIDGPK 642

Query: 542 PNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTK---ESEKRKYRSGCTLHFGYCKQIRYD 598
              +   +  P  W  P  +++ EV    +      ++    Y  G +L F    +IR D
Sbjct: 643 GTYVFDSSAEPDVWFEP--TMLFEVLTADLSLSPIYKAGSSVYDKGISLRFPRFLRIRDD 700

Query: 599 KDWKTVASFSEFEDM 613
           K  +   S  +  +M
Sbjct: 701 KSVEDATSSEQIIEM 715

>KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.343
           YDL164C
          Length = 727

 Score =  100 bits (248), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 96/381 (25%), Positives = 169/381 (44%), Gaps = 39/381 (10%)

Query: 247 FEPQLAKRTHLSYERVASKLQ-HDFIIEEKMDGERLQIHYINYGEQIKYLSRRGVDFSYL 305
            +P LAK T  S   +  + Q   F  E K DGER Q+H +  G  ++  SR G + +  
Sbjct: 363 LKPMLAKPTK-SISEIFDRFQDQKFTCEYKYDGERAQVHLLEDG-TMRIYSRNGENMTER 420

Query: 306 YGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLV-----KSSAMNQIQS 360
           Y E      I   +    + K  ILD E + +D E++ +LPF ++     K   +N+I+ 
Sbjct: 421 YPEIH----IRDFVTDLSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDVDINEIKV 476

Query: 361 ELAGIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKAI 420
            +              AFD++  N + L N +L+ R+D L  I   V    +    M   
Sbjct: 477 RVC-----------LFAFDILLHNDEKLINKSLQERRDILHSITKEVTGEFQFATEMTTT 525

Query: 421 NAEAIKDSLEQAISMGSEGIVLKHL---HSKYFVGSRNTDWIKIKPEYLEQFGENMDLLI 477
           N E ++  L+Q++    EG+++K L    S Y    R+ +W+K+K +YL   G+++DL +
Sbjct: 526 NLEELQSFLDQSVKNSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCV 585

Query: 478 IGR--EQGKKDSFFCGLSISDPNEVAEKPRFISFCTIANGLSNEEFKDIERKTWGKWHIF 535
           +G    +GK+   + G  +   N+  +   F + C I  G S+E  + +  +   K  + 
Sbjct: 586 LGAYFGRGKRTGNYGGFLLGCYNQ--DTGEFETACKIGTGFSDEVLQQLHERL--KSTVI 641

Query: 536 SEDPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTK---ESEKRKYRSGCTLHFGYC 592
             D P    +   +  P  W  P  +++ EV    +      ++    Y  G +L F   
Sbjct: 642 --DLPKATYVFDPSAEPDVWFEP--TLLFEVLTADLSLSPVYKAGSSTYDKGVSLRFPRF 697

Query: 593 KQIRYDKDWKTVASFSEFEDM 613
            ++R DK  +   S  +  +M
Sbjct: 698 LRLREDKGVEDATSSEQIVEM 718

>Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}
           YDL164C (REAL)
          Length = 845

 Score =  100 bits (248), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 92/368 (25%), Positives = 167/368 (45%), Gaps = 27/368 (7%)

Query: 247 FEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGVDFSYLY 306
            +P LAK T    E +       F  E K DGER Q+H +N G  ++  SR G + +  Y
Sbjct: 481 LKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDG-TMRIYSRNGENMTERY 539

Query: 307 GENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQSELAGIA 366
            E   +  I   L +    K+ ILD E + +D ++  +LPF ++ +     +  EL  + 
Sbjct: 540 PEIKITDFIQ-DLDI---TKNLILDCEAVAWDKDQAKILPFQVLSTRKRKDV--ELNDV- 592

Query: 367 PTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKAINAEAIK 426
                +    AFD++  N + L N++L  R++YLTK+   V    +    +   N + ++
Sbjct: 593 ---KVRVCLFAFDILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNNLDELQ 649

Query: 427 DSLEQAISMGSEGIVLKHL---HSKYFVGSRNTDWIKIKPEYLEQFGENMDLLIIGR--E 481
             L+++++   EG+++K L    S Y    R+ +W+K+K +YLE  G+++DL ++G    
Sbjct: 650 KFLDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYG 709

Query: 482 QGKKDSFFCGLSISDPNEVAEKPRFISFCTIANGLSNEEFKDIERKTWGKWHIFSEDPPS 541
           +GK+   + G  +   N+  +   F + C I  G S+E  + +  +          D P 
Sbjct: 710 RGKRTGTYGGFLLGCYNQ--DTGEFETCCKIGTGFSDEMLQLLHARLTPTII----DGPK 763

Query: 542 PNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTK---ESEKRKYRSGCTLHFGYCKQIRYD 598
              +   +  P  W  P  + + EV    +      ++    +  G +L F    +IR D
Sbjct: 764 ATYVFDSSAEPDVWFEP--TTLFEVLTADLSLSPIYKAGSTTFDKGVSLRFPRFLRIRED 821

Query: 599 KDWKTVAS 606
           K  +   S
Sbjct: 822 KGVEDATS 829

>Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON}
           (195103..197283) [2181 nt, 727 aa]
          Length = 726

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 100/390 (25%), Positives = 173/390 (44%), Gaps = 53/390 (13%)

Query: 247 FEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGVDFSYLY 306
            +P LAK T    E + +    +F  E K DGER Q+H ++ GE ++  SR G + +  Y
Sbjct: 358 LKPMLAKPTKAINEVLDAFQGEEFTCEYKYDGERGQVHLLSNGE-MRIYSRNGENMTERY 416

Query: 307 GENSSSGPISPSLKLH-FNVKD---------CILDGEMITYDTEKDIVLPFGLVKSSAMN 356
                     P L +  F VKD          ILD E++ +D E++ +LPF ++ +    
Sbjct: 417 ----------PELHIEDFLVKDESNTDKEVSLILDCEVVAWDNEQNKILPFQVLSTRKRK 466

Query: 357 QIQSELAGIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQY 416
            +  EL  +      +    AFD++Y NG+ L    L  R+  L ++   V    +    
Sbjct: 467 GV--ELKDV----KVRVCLFAFDILYYNGEGLITKTLRERRKILHEVTKCVPGEFQYATS 520

Query: 417 MKAINAEAIKDSLEQAISMGSEGIVLKHL---HSKYFVGSRNTDWIKIKPEYLEQFGENM 473
           +     + I+  L+QAI    EG+++K L    S+Y    R+ +W+K+K +YL   G+++
Sbjct: 521 LITAELDEIQKFLDQAIKDSCEGLMVKILDGEESRYEPSKRSRNWLKLKKDYLAGVGDSL 580

Query: 474 DLLIIGR--EQGKKDSFFCGLSISDPNEVAEKPRFISFCTIANGLSNEEFKDIERKTWGK 531
           DL ++G    +GK+   + G  +   N+  +   + + C I  G S+E    +       
Sbjct: 581 DLCVMGAYYGKGKRTGTYGGFLLGCYNQ--DSGEYETCCKIGTGFSDEMLTKL------- 631

Query: 532 WHIFSED----PPSPNLLGFGTKV-PYEWIHPEDSVVLEVKARAIDTK---ESEKRKYRS 583
           + +F E+    P S     F +   P  W  P+  V+ EV    +      ++    Y  
Sbjct: 632 YELFREEEIEVPKS--FYNFDSSAEPDIWFEPK--VLFEVLTADLSLSPIYKAGSATYDK 687

Query: 584 GCTLHFGYCKQIRYDKDWKTVASFSEFEDM 613
           G +L F    +IR DK  +   S  +  +M
Sbjct: 688 GISLRFPRFLRIRDDKSVEDATSSDQIIEM 717

>KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 723

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 75/290 (25%), Positives = 138/290 (47%), Gaps = 20/290 (6%)

Query: 241 ITISHAFEPQLAKRTHLSYERVASKLQ-HDFIIEEKMDGERLQIHYINYGEQIKYLSRRG 299
           +T     +P LAK +  S   V  + Q   F  E K DGER Q+H +  G  ++  SR G
Sbjct: 354 LTPGIPLKPMLAKPSK-SISEVLDRFQGQRFTCEYKYDGERAQVHLLPDG-SMRIYSRNG 411

Query: 300 VDFSYLYGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQ 359
            + +  Y E   S  I+   + H  + DC    E + +D EK+ +LPF ++ +     + 
Sbjct: 412 ENMTERYPEIRISDFIADPARTHTLILDC----EAVAWDKEKNTILPFQVLSTRKRKGVA 467

Query: 360 SELAGIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKA 419
            E   +      +    AFD++  N + L    L  R+  L + L PV   +++   +  
Sbjct: 468 VEDVKV------RVCLFAFDILCYNDEPLITRPLAERRACLERALVPVPGELQLASEVTT 521

Query: 420 INAEAIKDSLEQAISMGSEGIVLKHLH---SKYFVGSRNTDWIKIKPEYLEQFGENMDLL 476
           ++ + ++  L+QA+    EG+++K L    S Y    R+ +W+K+K +YL+  G+++DL 
Sbjct: 522 MSLDELQHYLDQAVRDCCEGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLC 581

Query: 477 IIGR--EQGKKDSFFCGLSISDPNEVAEKPRFISFCTIANGLSNEEFKDI 524
           ++G    +GK+   + G  +   N+  +   + + C I  G S E  + +
Sbjct: 582 VLGAYYGRGKRTGTYGGFLLGCYNQ--DSGEYETCCKIGTGFSEEMLQTL 629

>NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON}
           Anc_7.343 YDL164C
          Length = 753

 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 92/380 (24%), Positives = 168/380 (44%), Gaps = 29/380 (7%)

Query: 236 QTDLSITISHAFEPQLAKRTHLSYERVASKLQHD-FIIEEKMDGERLQIHYINYGEQIKY 294
           +T  S+      +P LAK T  +   +  + Q + F  E K DGER Q+H ++ G  ++ 
Sbjct: 379 ETHCSLRPGIPLKPMLAKPTK-AINEILDRFQGEIFTSEYKYDGERAQVHLLSDG-TMRI 436

Query: 295 LSRRGVDFSYLYGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSA 354
            SR G + +  Y E      I+  L         ILD E + +D E++ +LPF ++ +  
Sbjct: 437 YSRNGENMTERYPEIHIRDFIADPLV----TSTLILDCEAVAWDNEQNKILPFQVLSTRK 492

Query: 355 MNQIQSELAGIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEII 414
              +  +   +      K    AFD++  N + L N +L  R+  L ++   V    +  
Sbjct: 493 RKDVDLKDVKV------KVCLFAFDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYA 546

Query: 415 QYMKAINAEAIKDSLEQAISMGSEGIVLKHL---HSKYFVGSRNTDWIKIKPEYLEQFGE 471
             M + N + ++  L+Q++    EG+++K L    S Y    R+ +W+K+K +YLE  G+
Sbjct: 547 TEMTSSNLDELQKFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGD 606

Query: 472 NMDLLIIGR--EQGKKDSFFCGLSISDPNEVAEKPRFISFCTIANGLSNEEFKDIERKTW 529
           ++DL +IG    +GK+   + G  +   N+  +   F + C I  G S+E  + +    +
Sbjct: 607 SLDLCVIGAYYGRGKRTGMYGGFLLGCYNQ--DTGEFETCCKIGTGFSDEMLQQL----Y 660

Query: 530 GKWHIFSEDPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTK---ESEKRKYRSGCT 586
            +      D P    +   +  P  W  P  +++ EV    +      ++    Y  G +
Sbjct: 661 TRLTPTVLDGPKATFVYDSSAEPDVWFEP--TLLFEVLTADLSLSPIYKAGSSTYDKGIS 718

Query: 587 LHFGYCKQIRYDKDWKTVAS 606
           L F    + R DK  +   S
Sbjct: 719 LRFPRFIRTREDKGVEDATS 738

>KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.343
           YDL164C
          Length = 710

 Score = 93.6 bits (231), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 90/369 (24%), Positives = 167/369 (45%), Gaps = 29/369 (7%)

Query: 247 FEPQLAKRTHLSYERVASKLQH-DFIIEEKMDGERLQIHYINYGEQIKYLSRRGVDFSYL 305
            +P LAK T    E V  + Q+  F  E K DGER Q+H +N G  ++  SR G + +  
Sbjct: 346 LKPMLAKPTKTIME-VFDRFQNIHFTSEYKYDGERAQVHLMNDG-SMRIYSRNGENMTER 403

Query: 306 YGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQSELAGI 365
           Y E + +  I   L L    K  I+D E + +D E+  +LPF ++ +     +  +   +
Sbjct: 404 YPEINVTDFIK-DLNL---TKSLIIDCEAVAWDREEKKILPFQVLSTRKRKDVDIKDIKV 459

Query: 366 APTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKAINAEAI 425
                 +    AFD++  N + L N +L  R++ L  +   V       + +   N + +
Sbjct: 460 ------RICLFAFDILCHNDEKLINKSLRERREILHSVTREVHGEFTYAKELSTNNLDEL 513

Query: 426 KDSLEQAISMGSEGIVLKHLH---SKYFVGSRNTDWIKIKPEYLEQFGENMDLLIIGR-- 480
           +  L+Q++    EG+++K L    S Y    R+ +W+K+K +YL+  G+++DL ++G   
Sbjct: 514 QLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLGAFY 573

Query: 481 EQGKKDSFFCGLSISDPNEVAEKPRFISFCTIANGLSNEEFKDIERKTWGKWHIFSEDPP 540
            +GK+   + G  +   N+  +   F + C I  G S+E  + +    + +    + D P
Sbjct: 574 GRGKRTGTYGGFLLGCYNQ--DTGEFETACKIGTGFSDEVLQSL----YDRLKSTTIDGP 627

Query: 541 SPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTK---ESEKRKYRSGCTLHFGYCKQIRY 597
               +   +  P  W  P  +++ EV    +      ++    Y  G +L F    ++R 
Sbjct: 628 KATYIYDSSAQPDVWFEP--TLLFEVLTADLSMSPIYKAGASTYSKGISLRFPRFIRLRE 685

Query: 598 DKDWKTVAS 606
           DK  +   S
Sbjct: 686 DKSVEEATS 694

>ZYRO0E07150g Chr5 complement(540507..541856) [1350 bp, 449 aa] {ON}
           highly similar to uniprot|Q01159 Saccharomyces
           cerevisiae YGL130W CEG1 mRNA guanylyltransferase (mRNA
           capping enzyme), alpha subunit
          Length = 449

 Score = 36.2 bits (82), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 50/220 (22%), Positives = 97/220 (44%), Gaps = 50/220 (22%)

Query: 266 LQHDFIIEEKMDGER-LQIHYIN--YGEQIKYLSRRGVDFSYLYGENSSSGPISPSLKLH 322
           L+ D+ + EK DG R L +  IN    EQ  ++  R  +F  + G      P     +L 
Sbjct: 57  LEQDYYVCEKTDGLRVLMLILINPVTREQGCFMIDRENNFYLVNGFRFPRLPHKDKKELL 116

Query: 323 FNVKD-CILDGEMITYDTEKDIVLPFGLVKSSAMNQIQSELAGIAPTESYKPLFVAFDLV 381
             ++D  +LDGE++              ++++ M +++ EL            ++ FD +
Sbjct: 117 ETLQDGTLLDGELV--------------IQTNPMTKLK-ELR-----------YLMFDCL 150

Query: 382 YLNGKSLTNLALERRKDYLTK-----------------ILTPVERSVEIIQYMKAINAEA 424
            +NG+ LT      R  +L K                 +  P + S++ + +  + +   
Sbjct: 151 AINGRCLTPSPTSSRLAHLGKEFFKPYFDLRLVYPDQCVTFPFKISMKHMSF--SYDLLK 208

Query: 425 IKDSLEQAISMGSEGIVLKHLHSKYFVGSRNTDWIKIKPE 464
           + +SLE+   M S+G++   + + YFVG +++  +K KPE
Sbjct: 209 VANSLEKLPHM-SDGLIFTPVKTPYFVGGKDSLLLKWKPE 247

>Suva_16.84 Chr16 (139477..141546) [2070 bp, 689 aa] {ON} YPL222W
           (REAL)
          Length = 689

 Score = 36.2 bits (82), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 34/61 (55%), Gaps = 7/61 (11%)

Query: 104 LLRWKQRAARGVKLSDFCVEEIRKRQKDYEGANRITIDELNGYLD-------EVSQEGNG 156
           L RW+Q     +KLSD+C++E+ +  + +EG   + I + + + D       +V ++ NG
Sbjct: 234 LFRWRQDLEGLIKLSDYCIDEVFEAGRQFEGKPDLNIFKTDFFPDNETKIDQQVEKDENG 293

Query: 157 K 157
           K
Sbjct: 294 K 294

>NCAS0G03740 Chr7 (690624..691880) [1257 bp, 418 aa] {ON} Anc_2.302
           YML005W
          Length = 418

 Score = 35.4 bits (80), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 43/77 (55%), Gaps = 10/77 (12%)

Query: 273 EEKMDGERLQIHYINYGEQIKYLSRRGVDFSYLYGENSSSGPISP--SLKLHFNVK-DCI 329
           +EK+ G+RL+I +IN G  +   S++G   +    +N ++  I P  SL +H NV  D I
Sbjct: 311 DEKLGGDRLKIRHINLG--LLPSSKQGWPIALKIIQNHNNSEIVPIVSLHIHENVHIDQI 368

Query: 330 LDGEMITYDTEKDIVLP 346
            DG  +     +D+VLP
Sbjct: 369 EDGSFV-----RDVVLP 380

>CAGL0J11528g Chr10 complement(1119969..1121642) [1674 bp, 557 aa]
           {ON} similar to uniprot|P53870 Saccharomyces cerevisiae
           YNL193w
          Length = 557

 Score = 33.9 bits (76), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 52/114 (45%), Gaps = 19/114 (16%)

Query: 1   MNDCENFSPSP-EFKWLCDELLGKIYETSSKKHLIGKPVTVRYLEIITNFIKLWRSTVGN 59
           ++D +  +P+  E +W    +L KIY+T      I K +  R  ++I+  I+     + N
Sbjct: 391 LDDGQQITPANVEEQWFFSSMLSKIYQT------ISKQLNERRGDVISGKIRGLSDQLSN 444

Query: 60  YIYPALRLIVPFRDRRIYNVKENTLIKALCRYLRLPKSSETENRLLRWKQRAAR 113
            ++    +I+        N  +N L++A    +R P    +E R +   Q+ AR
Sbjct: 445 IVFRQCDIII--------NASDNDLLRAFLMSIRNP----SETRTIEILQKNAR 486

>Smik_6.427 Chr6 complement(692098..694164) [2067 bp, 688 aa] {ON}
           YPL222W (REAL)
          Length = 688

 Score = 33.9 bits (76), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 31/63 (49%), Gaps = 7/63 (11%)

Query: 104 LLRWKQRAARGVKLSDFCVEEIRKRQKDYEGANRITIDELNGYLD-------EVSQEGNG 156
           L RW+Q     +KLSD+C+EE+      +EG     +   + + D       +V ++ NG
Sbjct: 233 LFRWRQDLQGLIKLSDYCIEELFDGGAQFEGKPDFDVFRKDFFPDSEKKIDEQVKKDENG 292

Query: 157 KRM 159
           K +
Sbjct: 293 KEL 295

>ADR369C Chr4 complement(1362309..1364792) [2484 bp, 827 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR346W
           (REV1)
          Length = 827

 Score = 33.9 bits (76), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 43/94 (45%), Gaps = 19/94 (20%)

Query: 660 FSNCRFRVISDYFDSTKRRRISQEDLCSVILEHGGEIVY----TSDENNLPQDNLYIIGE 715
           F  CR  V + + D  +      E+L   I+ HGG  V+     SD  ++  +++ +   
Sbjct: 44  FRGCRVHV-NGHTDPDR------EELRREIVMHGGTFVHYLARPSDVTHIVAEHVPVAKR 96

Query: 716 KLTRECKILLNAKNLIIRPSWIFSCIEEGYKTPF 749
           +L   CK+        +RP+W+ +C+  G   P+
Sbjct: 97  RLWHACKV--------VRPAWVSACLCSGELVPW 122

>Ecym_5146 Chr5 (308809..309951) [1143 bp, 380 aa] {ON} similar to
           Ashbya gossypii ABL083W
          Length = 380

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 48/119 (40%), Gaps = 20/119 (16%)

Query: 113 RGVKLSDFCVEEIRKRQKDYEGANRITIDELNGYLD---------EVSQEGNGKRMGYMA 163
           R +KL +  VE +     D  G  R  +D + G +D         E  +  NG R+   A
Sbjct: 98  RKMKLDNIRVESVLVDHNDLTGVAREVVDNVIGIIDHHEDNNMHKESIKRANGPRIIEPA 157

Query: 164 LT-DSRAFNYCLNHMTFMEMKFFFDIILKTRVLSGLENMFLTAWHPDATDYLSVVSDLD 221
            +  S  FNY LN++    +K   DI            +FL+A   D  +    V+ LD
Sbjct: 158 GSCSSLVFNYWLNNLGIQRLKPLTDI----------SKLFLSALLMDTVNMKYKVTKLD 206

>Skud_7.402 Chr7 (679536..681341) [1806 bp, 601 aa] {ON}  (REAL)
          Length = 601

 Score = 33.5 bits (75), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 43/105 (40%), Gaps = 13/105 (12%)

Query: 648 EPTALVAPVSNTFSNCRFRVISDYFDSTKRRRISQEDLCSVILEHGGEIVYTSD----EN 703
           +P+   +P ++ FSN  F V          R +  + L  +IL  GG I+  +     EN
Sbjct: 348 QPSKYDSPAASLFSNFSFYV---------GREVPIDILEFLILSCGGNIISEAALDRIEN 398

Query: 704 NLPQDNLYIIGEKLTRECKILLNAKNLIIRPSWIFSCIEEGYKTP 748
               D   I  + + R       A    I+P WIF CI +G   P
Sbjct: 399 KKDIDMSKITHQIVDRPALKNKVAGRTYIQPQWIFDCINKGELVP 443

>CAGL0L03047g Chr12 (352032..354179) [2148 bp, 715 aa] {ON} similar
           to uniprot|P36120 Saccharomyces cerevisiae YKR024c DBP7
           RNA helicase
          Length = 715

 Score = 33.1 bits (74), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 27/51 (52%)

Query: 632 KKRASKRAKIGIVNSSEPTALVAPVSNTFSNCRFRVISDYFDSTKRRRISQ 682
           K+R  KRAK+   N+ E   +  PVS    N   +++S  F S + ++ S+
Sbjct: 54  KERGDKRAKVDTGNAQEKKNIPKPVSKADVNINSQIVSSLFTSNRAKQTSE 104

>Kwal_55.21557 s55 (888748..889563) [816 bp, 271 aa] {ON} YOR036W
           (PEP12) - integral membrane protein; c-terminal TMD;
           located in endosome [contig 128] FULL
          Length = 271

 Score = 31.6 bits (70), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 32/163 (19%), Positives = 74/163 (45%), Gaps = 26/163 (15%)

Query: 1   MNDCENFSPSPEFKWLCDELLGKIYETSSKKHLIGKPVTVRYLEIITNFIKLWR--STVG 58
           +N+  +FS +P+F+   D+++  ++E +             +L  +  FIK  +   + G
Sbjct: 8   LNEAPHFSDNPQFEEWVDKIMNNLFEMNG------------HLSTLQQFIKTLQKNQSQG 55

Query: 59  NYIYPALRLIVPFRDRRIYNVKENT----LIKALCRYLRLPKSSETENRLLRWKQRAARG 114
           N      ++I     + +Y++   T    +I +L   +   + +E +   L  + +  R 
Sbjct: 56  N---TRSKMIANLDKKSVYHINAITELLKVINSLVHKINEIEETELDRAQLISRDKLTRD 112

Query: 115 VKLSDFCVEEIRKRQKDYEGANRITIDELNGYL--DEVSQEGN 155
           VK   + V+E ++ QK++   +++   +    L  DE ++E N
Sbjct: 113 VK---YSVQEFQEAQKEFTSTSKVMNAQAKQALAEDEETREDN 152

>TPHA0H00510 Chr8 complement(98545..103023) [4479 bp, 1492 aa] {ON}
           Anc_8.126 YGL173C
          Length = 1492

 Score = 32.0 bits (71), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 41/95 (43%), Gaps = 6/95 (6%)

Query: 230 PNERLRQTDLSITISHAFEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYG 289
           P E+ R +   I ++  F PQ+ +        V S ++H+  +E K + E+L +H I YG
Sbjct: 704 PEEKERNS-FGIDLTFRFNPQVDEVYKSPLNGVFSDIKHNHCMEIKFEMEKLDLHEIRYG 762

Query: 290 EQIKYLSRRGVDFSYLYGENSSSGPISPSLKLHFN 324
                L     D  YL     S   I    KL +N
Sbjct: 763 -----LLPEAKDGKYLSAGFPSFDTIPFDAKLEYN 792

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 100,257,471
Number of extensions: 4603875
Number of successful extensions: 13043
Number of sequences better than 10.0: 63
Number of HSP's gapped: 13256
Number of HSP's successfully gapped: 63
Length of query: 907
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 788
Effective length of database: 39,836,145
Effective search space: 31390882260
Effective search space used: 31390882260
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 70 (31.6 bits)