Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D01067g6.17ON66066031790.0
SAKL0E01100g6.17ON71071316110.0
Ecym_30216.17ON67468815910.0
Kwal_56.224116.17ON68969914880.0
ACR009W6.17ON68067414830.0
ZYRO0C07876g6.17ON68169514040.0
KLTH0C11308g6.17ON69070413960.0
TDEL0G045206.17ON67970013890.0
Skud_5.276.17ON61549712691e-167
Suva_5.56.17ON61951512631e-166
Smik_5.256.17ON61549512591e-165
YEL062W (NPR2)6.17ON61551312561e-165
CAGL0L13288g6.17ON64668512291e-160
Kpol_1045.726.17ON69556612221e-159
KNAG0M011406.17ON59452811651e-152
TPHA0J003106.17ON67570211671e-151
TBLA0G010106.17ON71054511521e-148
NCAS0H008706.17ON61248011281e-146
KAFR0L003806.17ON54049010901e-141
NDAI0D008606.17ON66652210971e-140
SAKL0E12650g2.82ON167357820.37
KLLA0D02398g1.290ON120574724.4
ZYRO0F14608g8.568ON48558698.8
Kwal_33.149602.616ON757153699.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D01067g
         (660 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D01067g Chr4 complement(94114..96096) [1983 bp, 660 aa] {ON...  1229   0.0  
SAKL0E01100g Chr5 complement(83492..85624) [2133 bp, 710 aa] {ON...   625   0.0  
Ecym_3021 Chr3 complement(40454..42478) [2025 bp, 674 aa] {ON} s...   617   0.0  
Kwal_56.22411 s56 complement(115007..117076) [2070 bp, 689 aa] {...   577   0.0  
ACR009W Chr3 (371964..374006) [2043 bp, 680 aa] {ON} Syntenic ho...   575   0.0  
ZYRO0C07876g Chr3 (598500..600545) [2046 bp, 681 aa] {ON} simila...   545   0.0  
KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} simila...   542   0.0  
TDEL0G04520 Chr7 (822826..824865) [2040 bp, 679 aa] {ON} Anc_6.1...   539   0.0  
Skud_5.27 Chr5 (33530..35377) [1848 bp, 615 aa] {ON} YEL062W (REAL)   493   e-167
Suva_5.5 Chr5 (10147..12006) [1860 bp, 619 aa] {ON} YEL062W (REAL)    491   e-166
Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON...   489   e-165
YEL062W Chr5 (34407..36254) [1848 bp, 615 aa] {ON}  NPR2Subunit ...   488   e-165
CAGL0L13288g Chr12 complement(1420781..1422721) [1941 bp, 646 aa...   478   e-160
Kpol_1045.72 s1045 (167094..169181) [2088 bp, 695 aa] {ON} (1670...   475   e-159
KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {...   453   e-152
TPHA0J00310 Chr10 complement(68890..70917) [2028 bp, 675 aa] {ON...   454   e-151
TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {O...   448   e-148
NCAS0H00870 Chr8 (158877..160715) [1839 bp, 612 aa] {ON} Anc_6.1...   439   e-146
KAFR0L00380 Chr12 complement(69525..71147) [1623 bp, 540 aa] {ON...   424   e-141
NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.1...   427   e-140
SAKL0E12650g Chr5 complement(1042706..1047727) [5022 bp, 1673 aa...    36   0.37 
KLLA0D02398g Chr4 complement(202446..206063) [3618 bp, 1205 aa] ...    32   4.4  
ZYRO0F14608g Chr6 complement(1203405..1204862) [1458 bp, 485 aa]...    31   8.8  
Kwal_33.14960 s33 (890402..892675) [2274 bp, 757 aa] {ON} YKL072...    31   9.4  

>KLLA0D01067g Chr4 complement(94114..96096) [1983 bp, 660 aa] {ON}
           similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062W NPR2 Regulator of nitrogen permeases
           transcription is induced in response to proline and urea
           contains two PEST sequences
          Length = 660

 Score = 1229 bits (3179), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 603/660 (91%), Positives = 603/660 (91%)

Query: 1   MTSTFDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFDTIKNYIIPKPQLCNKL 60
           MTSTFDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFDTIKNYIIPKPQLCNKL
Sbjct: 1   MTSTFDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFDTIKNYIIPKPQLCNKL 60

Query: 61  LTFKYGEYRIVCYPVNVNARYYARNSXXXXXXXXXPYDCATSPYEPAIARLGKMFKVLEE 120
           LTFKYGEYRIVCYPVNVNARYYARNS         PYDCATSPYEPAIARLGKMFKVLEE
Sbjct: 61  LTFKYGEYRIVCYPVNVNARYYARNSFNFNFVFVFPYDCATSPYEPAIARLGKMFKVLEE 120

Query: 121 QSQILSKSEQNPVYFQLKSNDSNAADQSTEMGSITISEHTDIKSTGDDGEKYLEIIKELA 180
           QSQILSKSEQNPVYFQLKSNDSNAADQSTEMGSITISEHTDIKSTGDDGEKYLEIIKELA
Sbjct: 121 QSQILSKSEQNPVYFQLKSNDSNAADQSTEMGSITISEHTDIKSTGDDGEKYLEIIKELA 180

Query: 181 KNQKSLIIEDLLMKLFLDLNNYSECLIPIDEGNSIDIKLFPVRTPPSSNISVEDVPIAVV 240
           KNQKSLIIEDLLMKLFLDLNNYSECLIPIDEGNSIDIKLFPVRTPPSSNISVEDVPIAVV
Sbjct: 181 KNQKSLIIEDLLMKLFLDLNNYSECLIPIDEGNSIDIKLFPVRTPPSSNISVEDVPIAVV 240

Query: 241 NLSDIIDVNWDPTMVKIVPYINGINSVAQIAVSARSDVELVQECIKHLMYYNCVILSDIF 300
           NLSDIIDVNWDPTMVKIVPYINGINSVAQIAVSARSDVELVQECIKHLMYYNCVILSDIF
Sbjct: 241 NLSDIIDVNWDPTMVKIVPYINGINSVAQIAVSARSDVELVQECIKHLMYYNCVILSDIF 300

Query: 301 QFSNIYAPTSEIHNFLTNPAVAKACQLFVQGDSLKQSLLPFEGRPNNIYPTGRKQASTST 360
           QFSNIYAPTSEIHNFLTNPAVAKACQLFVQGDSLKQSLLPFEGRPNNIYPTGRKQASTST
Sbjct: 301 QFSNIYAPTSEIHNFLTNPAVAKACQLFVQGDSLKQSLLPFEGRPNNIYPTGRKQASTST 360

Query: 361 VHSRRRDSNDTATTGSTSSVRDTHRNYLXXXXXXXYFRAHASENTSLATGENQMKRILPT 420
           VHSRRRDSNDTATTGSTSSVRDTHRNYL       YFRAHASENTSLATGENQMKRILPT
Sbjct: 361 VHSRRRDSNDTATTGSTSSVRDTHRNYLSSSSTSSYFRAHASENTSLATGENQMKRILPT 420

Query: 421 RSCLFDLYKSLSQGKTVKDWYKQNFEIIRDNRIDVRKLIMFGITRRLIYRVNSYPIVKNV 480
           RSCLFDLYKSLSQGKTVKDWYKQNFEIIRDNRIDVRKLIMFGITRRLIYRVNSYPIVKNV
Sbjct: 421 RSCLFDLYKSLSQGKTVKDWYKQNFEIIRDNRIDVRKLIMFGITRRLIYRVNSYPIVKNV 480

Query: 481 GTWDILKSLVSKEPKTHYGSGSSKNIFSAADIKVVDTKEEGNQSDKLDAADEXXXXXXXX 540
           GTWDILKSLVSKEPKTHYGSGSSKNIFSAADIKVVDTKEEGNQSDKLDAADE        
Sbjct: 481 GTWDILKSLVSKEPKTHYGSGSSKNIFSAADIKVVDTKEEGNQSDKLDAADELLKSLYQK 540

Query: 541 XXXXXDVPNTMSKFARYYDDSPSNNAFTEXXXXXXXXXXXXXXXFDFGTAGQQKTVTEVP 600
                DVPNTMSKFARYYDDSPSNNAFTE               FDFGTAGQQKTVTEVP
Sbjct: 541 LSLKQDVPNTMSKFARYYDDSPSNNAFTESTSRKSSSGSHQKVSFDFGTAGQQKTVTEVP 600

Query: 601 DLGDGXXXXXXXXXXXXXLILLESLSNAETFDKVCTKLKKSRHEVELLLKDLGHYNIVNS 660
           DLGDG             LILLESLSNAETFDKVCTKLKKSRHEVELLLKDLGHYNIVNS
Sbjct: 601 DLGDGEKVEVWKKKKEEELILLESLSNAETFDKVCTKLKKSRHEVELLLKDLGHYNIVNS 660

>SAKL0E01100g Chr5 complement(83492..85624) [2133 bp, 710 aa] {ON}
           similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062W NPR2 Regulator of nitrogen permeases
           transcription is induced in response to proline and urea
           contains two PEST sequences
          Length = 710

 Score =  625 bits (1611), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/713 (48%), Positives = 436/713 (61%), Gaps = 56/713 (7%)

Query: 1   MTSTFDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFDTIKNYIIPKPQLCNKL 60
           M+S FDGFVPIHTVFY++FHPTEG+KVR+QFPP +LEN  I+FDTIKNY+IPKPQLCNKL
Sbjct: 1   MSSHFDGFVPIHTVFYSVFHPTEGTKVRYQFPPTNLENNDINFDTIKNYVIPKPQLCNKL 60

Query: 61  LTFKYGEYRIVCYPVNVNARYYARNSXXXXXXXXXPYDCATSPYEPAIARLGKMFKVLEE 120
           LTFKYG YR+ CYPVNVNA YYARNS         PY+CATSPYEPA+ARLGKMF+VLEE
Sbjct: 61  LTFKYGPYRLACYPVNVNASYYARNSFNFNFVFVFPYNCATSPYEPAVARLGKMFRVLEE 120

Query: 121 QSQILSKSEQNPVYFQLKSN-----------DSNAAD--QSTEMG-----SITISEHTDI 162
           QSQILSK+E +PVYF LKS            D   +D  + TE G     S    E   I
Sbjct: 121 QSQILSKAENDPVYFHLKSQESSTNSSSHPVDQGGSDRPKDTEQGTGLNNSQDSKEQGKI 180

Query: 163 KSTGDDGEKYLEIIKELAKNQKSLIIEDLLMKLFLDLNNYSECLIPIDEGNSIDIKLFPV 222
           +  G   EKY EI+ +L K +K L IEDL+ KL+ DLNNYSEC IPID GNS+DIKLFP+
Sbjct: 181 EGQGAAIEKYHEIMDDLEKGKKRLSIEDLITKLYQDLNNYSECFIPIDSGNSVDIKLFPL 240

Query: 223 RTPPSSNISVEDVPIAVVNLSDIIDVNWDPTMVKIVPYINGINSVAQIAVSARSDVELVQ 282
             PP+S +S EDVPI+ VNL+ +IDVNWDPTM+KIVP+ING+NS+A+IA  + SD +LV 
Sbjct: 241 LAPPNSCLSFEDVPISTVNLAKLIDVNWDPTMLKIVPFINGVNSIAKIAKFSSSDTDLVI 300

Query: 283 ECIKHLMYYNCVILSDIFQFSNIYAPTSEIHNFLTNPAVAKACQLFVQGDSLKQSLLPFE 342
           EC+KHL+YYNCV+L+DIFQFSNIYA TS I  FLT+P +A  CQ +V    L+   LPFE
Sbjct: 301 ECVKHLIYYNCVVLADIFQFSNIYASTSLISEFLTDPTLASECQTYVTSSDLELYRLPFE 360

Query: 343 GRPNNI-YPTGRKQASTSTVHS-RRRDSNDTATTGSTSSVRDTHRNYLXXXXXXXYFRAH 400
            RPN +   + RKQ S+ST+H+   R+S +   +    S   T RN           R  
Sbjct: 361 SRPNLLSMHSSRKQNSSSTIHTVGVRNSPNRTNSLDYPSELSTRRNNFSSSSASSLMRVR 420

Query: 401 ---ASENTSLATGENQMKRILPTRSCLFDLYKSLSQGKTVKDWYKQNFEIIRDNRIDVRK 457
                  T  A  E + + +LPT+SCLFDLY+SL QG+TVK+WYK NFEIIRDN IDVR+
Sbjct: 421 DRSGQSTTGSAVDEQESRLLLPTKSCLFDLYRSLHQGETVKEWYKINFEIIRDNHIDVRR 480

Query: 458 LIMFGITRRLIYRVNSYPIVKNVGTWDILKSLVS--------KEPKTHYGSGSSKNIFSA 509
            I FGI R LIYR  +YP++KN+G  ++LK+L S        ++ K       + N+FS 
Sbjct: 481 FITFGIVRGLIYRCYAYPVMKNLGALEMLKTLKSASDSRSLRRKLKFREKKNFTNNVFST 540

Query: 510 ADIKVVDTKEEGN---------QSDKLDAADEXXXXXXXXXXXXXD-------VPNTMSK 553
           ADIKV      G           +  +D A+E                     V N MS+
Sbjct: 541 ADIKVDLEHSPGGAPAEIFNRKHTSNVDMAEEVLKDAYKKLSIIESMDDNLYHVHNPMSR 600

Query: 554 FARYYDDS------PSNNAFTEXXXXXXXXXXXXXXXFDFGTAGQQKTVTEVPDLGDGXX 607
              Y  DS       S     +               F+ G +  Q    E  +  +   
Sbjct: 601 L--YGHDSGESSTKGSRKGSRKGSSSTMESETRSKVAFEKGRSPWQVEEDEKKERTEEVS 658

Query: 608 XXXXXXXXXXXLILLESLSNAETFDKVCTKLKKSRHEVELLLKDLGHYNIVNS 660
                      L LL+S+ + +TFDK+C +L+K R EVE LLK++GHYNI+NS
Sbjct: 659 NLLKEKRHEEFL-LLKSVKSVDTFDKICMRLEKDREEVEQLLKEMGHYNIINS 710

>Ecym_3021 Chr3 complement(40454..42478) [2025 bp, 674 aa] {ON}
           similar to Ashbya gossypii ACR009W
          Length = 674

 Score =  617 bits (1591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/688 (49%), Positives = 433/688 (62%), Gaps = 42/688 (6%)

Query: 1   MTSTFDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFDTIKNYIIPKPQLCNKL 60
           M++ FDGFVPIH++FY+LFHPTEG+KVRFQFPP+SLEN  I FDTIKNY+IPKPQLCNKL
Sbjct: 1   MSNHFDGFVPIHSIFYSLFHPTEGTKVRFQFPPDSLENSGISFDTIKNYVIPKPQLCNKL 60

Query: 61  LTFKYGEYRIVCYPVNVNARYYARNSXXXXXXXXXPYDCATSPYEPAIARLGKMFKVLEE 120
           LTFKYG YR+VCYPVN+NA YYARNS         PYD ATSPYEPAI RLGKMF+VLEE
Sbjct: 61  LTFKYGSYRLVCYPVNINASYYARNSFSFDFVFVFPYDSATSPYEPAIGRLGKMFRVLEE 120

Query: 121 QSQILSKSEQNPVYFQLKSNDSNAADQSTEMGSITISEHT---DIKSTGDDG--EKYLEI 175
           QSQ+LSK E++P+Y+ LK+ D  A DQ++E      +       I+    +   EKY EI
Sbjct: 121 QSQVLSKIERDPIYYHLKTQDVKAVDQNSEEPESKNNPQNCNDKIRRGHHEHAFEKYHEI 180

Query: 176 IKELAKNQKSLIIEDLLMKLFLDLNNYSECLIPIDEGNSIDIKLFPVRTPPSSNISVEDV 235
           +K +A N+K L IEDL+ KL+ DLNNYSECLIP+D GN+IDIKLFP+  PP+S  SVEDV
Sbjct: 181 MKHIAMNEKQLSIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLAPPNSCFSVEDV 240

Query: 236 PIAVVNLSDIIDVNWDPTMVKIVPYINGINSVAQIAVSARSDVELVQECIKHLMYYNCVI 295
           PIA +NL D +DVNWDPTMVKIVPYINGINS+A+I+  + SDV LV EC+KHL+YY+CV+
Sbjct: 241 PIAKLNLIDWVDVNWDPTMVKIVPYINGINSIAKISKYSDSDVGLVMECVKHLIYYDCVV 300

Query: 296 LSDIFQFSNIYAPTSEIHNFLTNPAVAKACQLFV---QGDSLKQSLLPFEGRPNNIYPTG 352
           L D+FQFSNIYAPTS++  FLT+P++A+ CQL+V   +   L Q  LPFEGRPN  + + 
Sbjct: 301 LVDMFQFSNIYAPTSQLSEFLTDPSIARECQLYVISSEDSELHQ--LPFEGRPNANH-SR 357

Query: 353 RKQASTSTVHSRRRDSNDTATTGSTSSVRD-THRNYLXXXXXXXYFRAHASENTSLATGE 411
              AST T  + +R         S SS  +   +              H+S+N+      
Sbjct: 358 NPTASTITFGTLKRTIYTNPRPESFSSNTEFAQKPNANTSLPSEPSITHSSKNSEFNHEN 417

Query: 412 NQ--MKRILPTRSCLFDLYKSLSQGKTVKDWYKQNFEIIRDNRIDVRKLIMFGITRRLIY 469
           N+  + R LPTRSCLFDLY+SLSQG+T+KDWYK NFE+IR NRIDVR+ I FG+ R+LIY
Sbjct: 418 NKGILNRTLPTRSCLFDLYRSLSQGQTMKDWYKMNFEVIRKNRIDVRRFITFGVFRKLIY 477

Query: 470 RVNSYPIVKNVGTWDILKSLVSKEPKTHYGS---GSSKNIFSAADIKVVDTKEEGNQSDK 526
           R  SYP+ K++GT D+LK         ++ S    +S N+FS ADI  VD  E      K
Sbjct: 478 RCYSYPVAKSIGTLDMLKRFDYASLPNNFMSPKNNNSNNVFSTADI-CVDFGEPSQFRKK 536

Query: 527 -----LDAADEXXXXXXXXXXXXXDVPNTMSKFARYYDDSPSNNAFTEXXXXXXXXXXXX 581
                 DAADE              +PN + +  R    S  N+A               
Sbjct: 537 PLVPNTDAADEVLRDAYKKLSLNERLPNPLDQITRSKKLSLENDA----------SANVD 586

Query: 582 XXXFDFGTAGQQKTVTEVPD---------LGDGXXXXXXXXXXXXXLILLESLSNAETFD 632
                  T+G  K + ++ D                           +LL+S+ N ++FD
Sbjct: 587 NRKLSSSTSGTAKVLFDMKDRLSNKDFEYRDQNAASTELKRKRQQQFLLLKSIKNVDSFD 646

Query: 633 KVCTKLKKSRHEVELLLKDLGHYNIVNS 660
           K+  KL+ ++ EVE LLK  G YNI+NS
Sbjct: 647 KIAIKLEINKQEVEELLKATGEYNIINS 674

>Kwal_56.22411 s56 complement(115007..117076) [2070 bp, 689 aa] {ON}
           YEL062W (NPR2) - Non-membrane-embedded, PEST
           sequence-containing protein [contig 185] FULL
          Length = 689

 Score =  577 bits (1488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/699 (46%), Positives = 416/699 (59%), Gaps = 51/699 (7%)

Query: 1   MTSTFDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFDTIKNYIIPKPQLCNKL 60
           M+  FDGFVP+H + YT+FHPTEG+KVR QFPP  LE   I FDTIKNY+IPKPQLCNKL
Sbjct: 1   MSGHFDGFVPVHCILYTIFHPTEGTKVRHQFPPGCLEASDITFDTIKNYVIPKPQLCNKL 60

Query: 61  LTFKYGEYRIVCYPVNVNARYYARNSXXXXXXXXXPYDCATSPYEPAIARLGKMFKVLEE 120
           LTFKYG +R+VCYPVNV A YYARNS         PYDCATSPYE AIARLGKMF VLEE
Sbjct: 61  LTFKYGSFRLVCYPVNVIAPYYARNSFSFDFVFVFPYDCATSPYESAIARLGKMFTVLEE 120

Query: 121 QSQILSKSEQNPVYFQLKSNDSNA------ADQSTEMGSITISEHTDIKSTGDDGEKYLE 174
           QSQILSK+E + VYFQLK+ DS+        + +   G++  +E +  +S G   EKY E
Sbjct: 121 QSQILSKAENSHVYFQLKTRDSHKHTNQEPVNDNELQGTLKNNEASQSESHGYAFEKYHE 180

Query: 175 IIKELAKNQKSLIIEDLLMKLFLDLNNYSECLIPIDEGNSIDIKLFPVRTPPSSNISVED 234
           I+K+L    K + +EDL+ K++ DLNNYSECLIPID GN++DIKLFP+ +PPSS +S ED
Sbjct: 181 ILKDLNGPNKRISVEDLITKIYRDLNNYSECLIPIDSGNAVDIKLFPLLSPPSSCLSFED 240

Query: 235 VPIAVVNLSDIIDVNWDPTMVKIVPYINGINSVAQIAVSARSDVELVQECIKHLMYYNCV 294
           VP+  VNL+ +IDVNWDPTM+KIVPYING NS+A++A  + SD  LV ECI+HL+YYNCV
Sbjct: 241 VPMPTVNLAKLIDVNWDPTMLKIVPYINGTNSIAKVAKLSDSDCNLVVECIRHLLYYNCV 300

Query: 295 ILSDIFQFSNIYAPTSEIHNFLTNPAVAKACQLFVQGD-SLKQSLLPFEGRP-----NNI 348
           IL+DIFQF NIYAPTSE+  FLTNPA+A  CQ++V  D S   S LPFE +P     NNI
Sbjct: 301 ILADIFQFQNIYAPTSELSRFLTNPALATECQIYVTLDESTHISDLPFERKPSRTTYNNI 360

Query: 349 YPTGRKQASTSTVHSRRRDSNDTATTGSTSSVRDTHRNYLXXXXXXXYFRAHASENTSLA 408
            P  R  +ST  V  + R+ +    +  T+ +  + RN           + H   + SL 
Sbjct: 361 -PV-RNSSSTLDVQRKGREMS-IKESSFTAGIDQSGRNQYTPQSHTSSIQCHNVSDASLG 417

Query: 409 TGENQM--KRILPTRSCLFDLYKSLSQGKTVKDWYKQNFEIIRDNRIDVRKLIMFGITRR 466
             E     K    ++SCLFD+Y+SLSQG+TVK+WYK +FE IR  RIDVR+ I FG+   
Sbjct: 418 NSEGGFNNKVFFTSKSCLFDMYRSLSQGQTVKEWYKTHFEKIRAARIDVRRFITFGVIHG 477

Query: 467 LIYRVNSYPIVKNVGTWDILKSL------VSKEPKTHYG-SGSSKNIFSAADIKV----- 514
           L+YR  S+PI+KNVG  +++K+L       S E K   G S  + N+ SAA+I++     
Sbjct: 478 LLYRCYSFPIMKNVGYLEVVKALGLSDGDSSTEGKWLSGNSEPTNNVLSAAEIRIGLESS 537

Query: 515 --------------VDTKEEGNQSDKLDAADEXXXXXXXXXXXXXDVPNTMSKFARYYDD 560
                          DT E     D L+                    N M +      D
Sbjct: 538 SSKLRERRFNHFSNADTAE-----DILNDVYRKLALNENKVEQSSQSGNPMMRMFGNCSD 592

Query: 561 SPSNNAFTEXXXXXXXXXXXXXXXFDFGTAGQQKTVTEVPDLGDGXXXXXXXXXXXXXLI 620
             S     +               FD        T     D   G             L+
Sbjct: 593 DSSGETSVKDVVSTAGSDTRNTVAFDVRRLVNSATAE---DRKKGEVMRLEEDKRKDELL 649

Query: 621 LLESLSNAETFDKVCTKLKKSRHEVELLLKDLGHYNIVN 659
           LL+S+ + E FDK+CT+L + R EVE +L+DLG YN+V+
Sbjct: 650 LLKSVRDVENFDKICTRLGRDREEVEKMLEDLGPYNVVH 688

>ACR009W Chr3 (371964..374006) [2043 bp, 680 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL062W (NPR2)
          Length = 680

 Score =  575 bits (1483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/674 (45%), Positives = 426/674 (63%), Gaps = 15/674 (2%)

Query: 1   MTSTFDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFDTIKNYIIPKPQLCNKL 60
           M + FDGFVPIH +FY LFHPTEG+KVRFQFP +SLE   I FDTIKNY+IPK QLCNKL
Sbjct: 8   MPNKFDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLEKSGIRFDTIKNYVIPKSQLCNKL 67

Query: 61  LTFKYGEYRIVCYPVNVNARYYARNSXXXXXXXXXPYDCATSPYEPAIARLGKMFKVLEE 120
           +TFK+G YR+VCYPVN+ A YYARNS         PYD ATSPYEPAIARL KM +VLEE
Sbjct: 68  VTFKFGSYRLVCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEPAIARLAKMLRVLEE 127

Query: 121 QSQILSKSEQNPVYFQLKSNDSNAADQSTEMGSITISEHT-DIKSTGDDGE--KYLEIIK 177
           QSQ+LSK E++PVY+QLK+ ++ AA+Q TE        H  D KS        KY EI+K
Sbjct: 128 QSQMLSKVERDPVYYQLKTGETKAAEQKTEESDSKAKTHNLDKKSRAQHNATTKYHEIMK 187

Query: 178 ELAKNQKSLIIEDLLMKLFLDLNNYSECLIPIDEGNSIDIKLFPVRTPPSSNISVEDVPI 237
            +  ++K+L IEDL+ KL+ DLNNYSECLIP+D GN+IDIKLFP+ TPP+S +S EDVPI
Sbjct: 188 HINSDEKNLYIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLTPPNSCLSFEDVPI 247

Query: 238 AVVNLSDIIDVNWDPTMVKIVPYINGINSVAQIAVSARSDVELVQECIKHLMYYNCVILS 297
           A VNL +++DVNWDPTM+KIVP+INGINS+A+I+  + S VELV ECIKHL+YY+CV L 
Sbjct: 248 AKVNLMNLVDVNWDPTMLKIVPFINGINSIAKISKCSDSAVELVMECIKHLVYYDCVALV 307

Query: 298 DIFQFSNIYAPTSEIHNFLTNPAVAKACQLF-VQGDSLKQSLLPFEGRPNNIYPTGRKQA 356
           D+FQFSNIYAPT+ + +FL +  + + CQ++ V  +  +   LPFE RPN  + +  + A
Sbjct: 308 DMFQFSNIYAPTNLLRDFLFDFILPRECQVYVVSSEDCEIHRLPFESRPNGGH-SRNQTA 366

Query: 357 STSTVHSRRRDSNDTATTGSTSSVRDTHRNYLXXXXXXXYFRAHASENTSLATG-ENQMK 415
           ST+TV++ RR ++       +S+   + ++         + +++     + +   E+  K
Sbjct: 367 STNTVYTLRRTTSTNRADSFSSNAEFSQKSSGISSLAQSFTQSNKDYYYNRSRNLESNCK 426

Query: 416 RILPTRSCLFDLYKSLSQGKTVKDWYKQNFEIIRDNRIDVRKLIMFGITRRLIYRVNSYP 475
           R LPTR  LFDLY+SL+QG+T+K+WYK N+  IR+N+IDVR+LI+FG+  RLIYR  SYP
Sbjct: 427 RTLPTRRVLFDLYRSLTQGQTLKEWYKANYSAIRENQIDVRRLIIFGVFHRLIYRCYSYP 486

Query: 476 IVKNVGTWDILKSLVSKEPKTHY---GSGSSKNIFSAADIKVVDTKEEGNQS-----DKL 527
           + K++GT ++LK         ++   G+ +  N+FS +DI+V       +++     +  
Sbjct: 487 VAKSIGTLELLKRFDYVSTTDNFIPTGTSAGNNVFSTSDIRVDFDGSSRSRNIPPFLNSS 546

Query: 528 DAADEXXXXXXXXXXXXXDVPNTMSKFARYYDDSPSNNAFTEXXXXXXXXXXXXXXXFDF 587
           D A+E              + +++   A+ Y     N A  +                 F
Sbjct: 547 DVAEEVLRETYQKLSIKDILNDSIDPIAKGYQAPSDNEAAMKGTSRKQSMSTLNTTRITF 606

Query: 588 GTAGQQKTV-TEVPDLGDGXXXXXXXXXXXXXLILLESLSNAETFDKVCTKLKKSRHEVE 646
               +  +   E  +  +               +LL+S+ + ++FDK+  +L+ ++HEVE
Sbjct: 607 DIRNRHVSKDNEHREQQNEDIPLLLKKKRLQEFLLLQSVKSVDSFDKIAVRLEMNKHEVE 666

Query: 647 LLLKDLGHYNIVNS 660
            LLK  G YNIVNS
Sbjct: 667 RLLKGTGEYNIVNS 680

>ZYRO0C07876g Chr3 (598500..600545) [2046 bp, 681 aa] {ON} similar
           to uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
           Regulator of nitrogen permeases transcription is induced
           in response to proline and urea contains two PEST
           sequences
          Length = 681

 Score =  545 bits (1404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/695 (44%), Positives = 417/695 (60%), Gaps = 63/695 (9%)

Query: 1   MTSTFDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFDTIKNYIIPKPQLCNKL 60
           MT  F+GFVPIHT+FY +FHPT+G++VR+++PP +LE   I+FD IKNYIIPKPQLC+KL
Sbjct: 15  MTDQFEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNINFDAIKNYIIPKPQLCHKL 74

Query: 61  LTFKYGEYRIVCYPVNVNARYYARNSXXXXXXXXXPYDCATSPYEPAIARLGKMFKVLEE 120
           LT KY  YRIVCYPV VN+ YYARN          PYDC TS YEPAIARLGKMF+VLEE
Sbjct: 75  LTLKYKGYRIVCYPVTVNSPYYARNFFSFNFVFVFPYDCETSSYEPAIARLGKMFRVLEE 134

Query: 121 QSQILSKSEQNPVYFQLKSNDSNAADQSTEMGSITISEHTD---IKSTGDDGEKYLEIIK 177
           Q+QILSK+E +P+YF  K      AD +TE      +E +     KS G    KY EI+K
Sbjct: 135 QNQILSKAENDPIYFDFK-----LADNTTEQDGKLNAEKSFKGLTKSQGMALAKYNEIMK 189

Query: 178 ELAKNQKSLIIEDLLMKLFLDLNNYSECLIPIDEGNSIDIKLFPVRTPPSSNISVEDVPI 237
           +L   +    ++DL+M++F DLNNYSECLIPIDEGN++DIK+FP++TPP+S IS+EDVPI
Sbjct: 190 DLESEKSDFSVQDLVMRIFQDLNNYSECLIPIDEGNAVDIKIFPLKTPPNSCISIEDVPI 249

Query: 238 AVVNLSDIIDVNWDPTMVKIVPYINGINSVAQIAVSARSDVELVQECIKHLMYYNCVILS 297
           + VNL  IIDVNWDPTM+KIVPYI+G+NS+++IA  + SDV LV EC+KHL+YYNCVIL+
Sbjct: 250 STVNLKTIIDVNWDPTMLKIVPYIDGLNSISKIAKLSDSDVSLVLECVKHLVYYNCVILA 309

Query: 298 DIFQFSNIYAPTSEIHNFLTNPAVAKACQLFV--QGDSLKQSLLPFEGRPNNIYPTGRKQ 355
           DIFQFSNIYAPTS I  FLT+P +A  CQ  V   G S   S +PFE          RK 
Sbjct: 310 DIFQFSNIYAPTSLIRQFLTDPTLASECQSHVTLAGHS-SLSEMPFERL--------RKF 360

Query: 356 ASTSTVHSRRRDSNDTATTGSTSSVRDTHRNYLXXXXXXXYFRAHASENTSLATGEN--- 412
                  S+ ++S    T+ S+ S   + R +        Y     S+++  +T  N   
Sbjct: 361 DLDDMDQSKNQESGSRTTSMSSKSDSKSKRPFFYSAPRNPYRFNQRSQSSFSSTNTNVTH 420

Query: 413 QMKRILPTRSCLFDLYKSLSQGKTVKDWYKQNFEIIRDNRIDVRKLIMFGITRRLIYRVN 472
            + R LPT++CLFDLY++LSQG TV++WY  N++ I+ N IDVR+ I FG+ + LIYR  
Sbjct: 421 DLARHLPTKACLFDLYRTLSQGVTVREWYNLNYQTIKKNDIDVRRFITFGVIKGLIYRCF 480

Query: 473 SYPIVKNVGTWDILKSL--------VSKEPKTHYGSGSSKNIFSAADIKVVDTKEEGNQS 524
           S+P++K +  +D+   L        V+K+ K       SK +FS +D+K+ +   + +Q+
Sbjct: 481 SFPVMKKMSIFDLAHKLHTAGNLNQVTKKGKGQKNLAESKYVFSTSDMKLGEG-SKMHQN 539

Query: 525 DKLDAADEXXXXXXXXXXXXXDVPNTMSKFARYYDDSPSNNAFTEXXXXXXXXXX----- 579
             +D ADE              + NT    +R  DD P +  + E               
Sbjct: 540 FSVDIADEVLRNVYKK------LSNTNEPGSR--DDYPLSRIYREESHVSLSALSGDNVS 591

Query: 580 -------XXXXXFDFG-------TAGQQKTVTEVPDLGDGXXXXXXXXXXXXXLILLESL 625
                       FD         +  QQK   +     +              +ILLES+
Sbjct: 592 HPKKPERVSKVAFDMNKDDPVPYSLSQQKGKNK-----EREAAKLDRAKNNQKIILLESI 646

Query: 626 SNAETFDKVCTKLKKSRHEVELLLKDLGHYNIVNS 660
           + A+  DK+C KL+K RHEVE LL +LG Y I+NS
Sbjct: 647 AAADCLDKICVKLEKPRHEVEELLHELGDYKIINS 681

>KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} similar
           to uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
           Regulator of nitrogen permeases transcription is induced
           in response to proline and urea contains two PEST
           sequences
          Length = 690

 Score =  542 bits (1396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/704 (44%), Positives = 422/704 (59%), Gaps = 58/704 (8%)

Query: 1   MTSTFDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFDTIKNYIIPKPQLCNKL 60
           M+  FDGFVP+H +FY++FHPTEG+KVR QFP   LE   I FDTIKNY+IPKPQLCNKL
Sbjct: 1   MSGHFDGFVPVHGIFYSVFHPTEGTKVRHQFPSGCLELSDITFDTIKNYVIPKPQLCNKL 60

Query: 61  LTFKYGEYRIVCYPVNVNARYYARNSXXXXXXXXXPYDCATSPYEPAIARLGKMFKVLEE 120
           LTFKYG +R+VCYPVNV A YYARNS         PYDCATSPYEPAI RLGKMF VLEE
Sbjct: 61  LTFKYGPFRLVCYPVNVVAPYYARNSFSFDFVFVFPYDCATSPYEPAIERLGKMFTVLEE 120

Query: 121 QSQILSKSEQNPVYFQLKS------NDSNAADQSTEMGSITISEHTDIKSTGDDGEKYLE 174
           QSQILSK+E + VYFQLK+       ++  A  + +  S+ I E    ++ G    KY E
Sbjct: 121 QSQILSKAENSSVYFQLKARNTQKHGNTETAKGTEQPSSLDIGEIAQPENQGYASAKYYE 180

Query: 175 IIKELAKNQKSLIIEDLLMKLFLDLNNYSECLIPIDEGNSIDIKLFPVRTPPSSNISVED 234
           I+K+L    K + I DL+ K++ DLN+YSECLIPID GN++DIKLFP+ +PPSS  S+ED
Sbjct: 181 ILKDLEGPSKKIAIGDLITKIYRDLNDYSECLIPIDSGNAVDIKLFPLLSPPSSCFSIED 240

Query: 235 VPIAVVNLSDIIDVNWDPTMVKIVPYINGINSVAQIAVSARSDVELVQECIKHLMYYNCV 294
           VPI+ VNL+ +IDVNWDPTM+KIVP+INGINS+A++A  + SDV LV ECIKHL+YYNCV
Sbjct: 241 VPISTVNLAKLIDVNWDPTMLKIVPHINGINSIAKVAKFSDSDVNLVVECIKHLIYYNCV 300

Query: 295 ILSDIFQFSNIYAPTSEIHNFLTNPAVAKACQLFVQ-GDSLKQSLLPFEGRPN-----NI 348
           IL+DIFQFSNIYA T+E+  FLT P +A  CQ++V   +S     LPFE  P+     NI
Sbjct: 301 ILTDIFQFSNIYASTNELSRFLTEPTLAAECQIYVAYNESAHLPNLPFERGPSRSGQGNI 360

Query: 349 YPTGRKQASTSTVHSRRRDSNDTATTGSTSSVRD--THRNYLXXXXXXXYFRAHASENTS 406
               R ++S  T+   R+         S +S  D  ++++             H + + S
Sbjct: 361 ----RDRSSNGTLDILRKGKQTPLRENSFNSGMDFLSNKHQHTPQSRSSSIPYHNTSDAS 416

Query: 407 LATGENQMK-RILP--TRSCLFDLYKSLSQGKTVKDWYKQNFEIIRDNRIDVRKLIMFGI 463
               +  +K +++P  ++SCLFDLY+SL+QG+T+++WYK +FE IR  RIDVR+ I FG+
Sbjct: 417 FGNSDAGLKGKLMPFTSKSCLFDLYRSLTQGQTIREWYKTHFEKIRAARIDVRRFITFGV 476

Query: 464 TRRLIYRVNSYPIVKNVGTWDILKSLV----SKEPKTHYGSGSSK---NIFSAADIKV-- 514
              LIYR  SYP+++N+G  + +++L     S+  K  +   +++   N+ SAADI++  
Sbjct: 477 LHGLIYRSYSYPVLRNIGFAESVEALGATNHSRYAKYKHLLKTNQPLNNVLSAADIRIGL 536

Query: 515 -----VDTKEEGNQSDKLDAADE-------XXXXXXXXXXXXXDVPNTMSK-FARYYDDS 561
                    E+  Q    DAA+E                       N +SK F R  +D 
Sbjct: 537 ENAGFKARSEKLKQHSTADAAEEVLSDVYRKLALSDKKTDHVAQGNNPISKVFGRNSED- 595

Query: 562 PSNNAFTEXXXXXXXXXXXXXXXFDF-----GTAGQQKTVTEVPDLGDGXXXXXXXXXXX 616
            S +  T                FD       ++  ++  +E+                 
Sbjct: 596 -STDISTRESANSMGSDIKNKVAFDVRKTLATSSADERRRSEI--------LRSIEEKRN 646

Query: 617 XXLILLESLSNAETFDKVCTKLKKSRHEVELLLKDLGHYNIVNS 660
             LILL+S+ +   FDK+CT L K R  VE +L +LG YN+++S
Sbjct: 647 EELILLKSVRSVHNFDKICTLLGKDRERVESMLSELGPYNVLHS 690

>TDEL0G04520 Chr7 (822826..824865) [2040 bp, 679 aa] {ON} Anc_6.17
           YEL062W
          Length = 679

 Score =  539 bits (1389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/700 (43%), Positives = 413/700 (59%), Gaps = 61/700 (8%)

Query: 1   MTSTFDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFDTIKNYIIPKPQLCNKL 60
           M   F+GF+PIHT+FY +FHPTEG+KVR++FPP +LE+  I+FD IKNYIIPKPQLC+KL
Sbjct: 1   MGDQFEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFDAIKNYIIPKPQLCHKL 60

Query: 61  LTFKYGEYRIVCYPVNVNARYYARNSXXXXXXXXXPYDCATSPYEPAIARLGKMFKVLEE 120
           LT KY  YRI  YPV VN+  YARN          PYDC TSPYEPAIARLGKMFKVLEE
Sbjct: 61  LTLKYKNYRIASYPVTVNSPIYARNFFSFNFVFVFPYDCQTSPYEPAIARLGKMFKVLEE 120

Query: 121 QSQILSKSEQNPVYFQLKS---NDSNAADQSTEMGSITISEHTDIKSTGDDGEKYLEIIK 177
           Q+ ILSK+E++P+++  K     D   A    E GS  +S     KS     EKY +I+ 
Sbjct: 121 QNLILSKAEKDPIFYHFKQVEIKDDQDAKSKPEKGSHNLS-----KSQAYASEKYHKIMT 175

Query: 178 ELAKNQKSLIIEDLLMKLFLDLNNYSECLIPIDEGNSIDIKLFPVRTPPSSNISVEDVPI 237
           ++     +  ++DL+++++ DLNNYSECLIPIDEGN++DIK+FP+ TPP+SNIS+EDVP+
Sbjct: 176 DIESADSTFSLKDLVLRVYQDLNNYSECLIPIDEGNAVDIKIFPMMTPPNSNISIEDVPV 235

Query: 238 AVVNLSDIIDVNWDPTMVKIVPYINGINSVAQIAVSARSDVELVQECIKHLMYYNCVILS 297
           + VNL+ +IDVNWDPTM+KIVPYING+NS+++IA  + SD  LV ECIKHL+YYNCV+L+
Sbjct: 236 STVNLNKVIDVNWDPTMLKIVPYINGLNSISKIAKLSVSDPGLVIECIKHLIYYNCVLLA 295

Query: 298 DIFQFSNIYAPTSEIHNFLTNPAVAKACQLFV---QGDSLKQSLLPFEGRPNNIYPTGRK 354
           DIFQFSNIYAPTS +  FLT+  ++  CQ +V   +  +L +  LPF+ R N+       
Sbjct: 296 DIFQFSNIYAPTSSLRTFLTDSVLSTECQSYVVCEEDSTLPR--LPFK-RVNHSATESVD 352

Query: 355 QASTSTVHSRRRDSNDTATTGSTSSVRDTHRNYL-XXXXXXXYFRAHASENTSLATG--- 410
                +  S+R   + T +  S      +  N +         +R      +S ++    
Sbjct: 353 HELADSHRSQRTSGSRTTSMSSNGKFFPSSNNEMPALISEESLYRTGKHSQSSFSSNNTN 412

Query: 411 -ENQMKRILPTRSCLFDLYKSLSQGKTVKDWYKQNFEIIRDNRIDVRKLIMFGITRRLIY 469
             N + R LPT+SCLFDLY+SLSQG ++++WY  ++  IR NRIDVR+ I FG+   LIY
Sbjct: 413 PSNMLARYLPTKSCLFDLYRSLSQGTSLREWYGVHYGTIRANRIDVRRFITFGVINGLIY 472

Query: 470 RVNSYPIVKNVGTWDILKSLVSKEPKTHY-----GSGSSKNIFSAADIKV-VDTKEEGNQ 523
           R  SYPI+KN+  +D+ K L  ++   H          SKNIFS +DIK  V+ + + N+
Sbjct: 473 RCYSYPIMKNLEIFDLAKRLHREDISNHTVKHNKAKNPSKNIFSTSDIKFGVEYERQRNK 532

Query: 524 SDK---LDAADEXXXXXXXXXXXXXDV---PNTMSKFARYYD--------DSPSNNAFTE 569
             K   LD ADE                  PN+    AR Y         D  +NN +  
Sbjct: 533 HHKALNLDIADEVLRNVYKKLSVTNSTDTRPNSADPIARLYRERSLGSLADGSTNNIY-- 590

Query: 570 XXXXXXXXXXXXXXXFDFGTAGQQKTVTEVPDLGDGXXXX---------XXXXXXXXXLI 620
                          FD     QQ    E+  +  G                      LI
Sbjct: 591 ---RLQNSDRPSKVSFD----KQQ----EIGHISKGMSSSNDKVKMDEEAKLERRERDLI 639

Query: 621 LLESLSNAETFDKVCTKLKKSRHEVELLLKDLGHYNIVNS 660
           LLES+  A++ D +C KL+ SR++VE L+++LG Y I+NS
Sbjct: 640 LLESVEAADSLDTICVKLEMSRYDVEALIQNLGEYKIINS 679

>Skud_5.27 Chr5 (33530..35377) [1848 bp, 615 aa] {ON} YEL062W (REAL)
          Length = 615

 Score =  493 bits (1269), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 249/497 (50%), Positives = 344/497 (69%), Gaps = 16/497 (3%)

Query: 1   MTSTFDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFDTIKNYIIPKPQLCNKL 60
           M S F GFVPIHT+FY++FHPTEGSK++++FPPN+L+N  I+F+TIKNYIIPKP LC+KL
Sbjct: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 60

Query: 61  LTFKYGEYRIVCYPVNVNARYYARNSXXXXXXXXXPYDCATSPYEPAIARLGKMFKVLEE 120
           +TFKYG YRIVCYPV +N+  YARN          PYDC TSPYEPAI RLGKMFKVLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QSQILSKSEQNPVYFQLKSNDSNAADQSTEMGSITISEHTDIKSTGDDGEK--------- 171
           Q+Q+LSKSE++ V+F LK+ +++    ST     T +  ++   T    +K         
Sbjct: 121 QNQLLSKSEKDAVFFDLKALENSTITPSTAGAPTTSNPSSNTTPTYPTSDKDAKDLRSSR 180

Query: 172 YLEIIKELAKNQKSLIIEDLLMKLFLDLNNYSECLIPIDEGNSIDIKLFPVRTPPSSNIS 231
           Y ++ K+L   + S  I+DLLM++F DLNNYSECLIPIDEGN++DIK+FP+  PP++ +S
Sbjct: 181 YNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240

Query: 232 VEDVPIAVVNLSDIIDVNWDPTMVKIVPYINGINSVAQIAVSARSDVELVQECIKHLMYY 291
           +EDVP++ VNL  IIDVNWDPTM+ IVPYI+G+NS+A+I+  +RSD  LV ECI+HL+YY
Sbjct: 241 LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLIYY 300

Query: 292 NCVILSDIFQFSNIYAPTSEIHNFLTNPAVAKACQLFVQGDSL-KQSLLPFEGRPNNI-- 348
            CV LSDIFQFSNIYAP+S I  FLT+  +A  CQ +V    + K S LP     ++   
Sbjct: 301 KCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSKNLDSADR 360

Query: 349 -YPT--GRKQASTSTVHSRRRDSNDTATTGSTSSVRDTHRNYLXXXXXXXYFRAHASENT 405
             P+   R+++ +S++ S   DS  T+ + ++   +++  N         + ++  S ++
Sbjct: 361 DSPSLFVRRKSKSSSIPS-NPDSRTTSFSSNSKVSQNSSLNSSFSSVCKDWRQSQTSLSS 419

Query: 406 SLATGENQMKRILPTRSCLFDLYKSLSQGKTVKDWYKQNFEIIRDNRIDVRKLIMFGITR 465
           S     +   R LPTRSCLFDLY+SLSQG+T+K WY+    I+++N IDVR+ I FG+ R
Sbjct: 420 SNLRANDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRFITFGLER 479

Query: 466 RLIYRVNSYPIVKNVGT 482
           R+IYR  S+P++ NV +
Sbjct: 480 RIIYRCYSFPVMLNVDS 496

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 28/41 (68%)

Query: 620 ILLESLSNAETFDKVCTKLKKSRHEVELLLKDLGHYNIVNS 660
           IL  S+ +AE+FD +C  L KS+ EVE  L +LG + ++NS
Sbjct: 575 ILENSIRSAESFDNICVLLSKSKLEVENYLNELGEFKVINS 615

>Suva_5.5 Chr5 (10147..12006) [1860 bp, 619 aa] {ON} YEL062W (REAL)
          Length = 619

 Score =  491 bits (1263), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 251/515 (48%), Positives = 355/515 (68%), Gaps = 21/515 (4%)

Query: 1   MTSTFDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFDTIKNYIIPKPQLCNKL 60
           M S F GFVPIHT+FY++FHPTEGSK++++FPPN+L++  I+F+TIKNYIIPKP LC+KL
Sbjct: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKSHGINFNTIKNYIIPKPILCHKL 60

Query: 61  LTFKYGEYRIVCYPVNVNARYYARNSXXXXXXXXXPYDCATSPYEPAIARLGKMFKVLEE 120
           +TFKYG YRIVCYPV +N+  YARN          PYDC TSPYEPAI RLGKMFKVLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QSQILSKSEQNPVYFQLKSND--------------SNAADQSTEMGSITISEHTDIKSTG 166
           Q+Q+LSKSE++PV+F LK+ +              SN +  +T     +  +  D++S  
Sbjct: 121 QNQLLSKSERDPVFFDLKAIENSLLTPSTAGPPATSNPSSNTTPTHPTSDKDAKDLRSNR 180

Query: 167 DDGEKYLEIIKELAKNQKSLIIEDLLMKLFLDLNNYSECLIPIDEGNSIDIKLFPVRTPP 226
            +GEKY +IIK+L   + +  I+DLLM++F DLNNYSECLIPID+GN++DIK+FP+  PP
Sbjct: 181 FNGEKYNDIIKDLGLPESTFSIQDLLMRIFQDLNNYSECLIPIDDGNAVDIKIFPLLRPP 240

Query: 227 SSNISVEDVPIAVVNLSDIIDVNWDPTMVKIVPYINGINSVAQIAVSARSDVELVQECIK 286
           ++ +S+EDVP++ VNL  IIDVNWDPTM+ IVPYI+G+NS+A+I+  + SD  LV ECI+
Sbjct: 241 TTCVSLEDVPLSSVNLKKIIDVNWDPTMMGIVPYIDGLNSIAKISKFSHSDPSLVIECIR 300

Query: 287 HLMYYNCVILSDIFQFSNIYAPTSEIHNFLTNPAVAKACQLFVQGDSL-KQSLLP----F 341
           HL+YY CV LSDIFQFSNIYAP+S I NFLT+P +A  CQ +V    + K S LP    F
Sbjct: 301 HLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMATDCQSYVTFPEISKLSNLPLNKNF 360

Query: 342 EGRPNNIYPTGRKQASTSTVHSRRRDSNDTATTGSTSSVRDTHRNYLXXXXXXXYFRAHA 401
           +    ++     ++ S S+      +S  T+ + ++   +++  N         + ++  
Sbjct: 361 DSVDQDLTSFSVRRKSKSSSVPSNPNSRTTSFSSTSKVSQNSSLNSSFSSVSKDWRQSQT 420

Query: 402 SENTSLATGENQMKRILPTRSCLFDLYKSLSQGKTVKDWYKQNFEIIRDNRIDVRKLIMF 461
           S +++     ++  + LPTRSCLFDLY+SLSQG+T+K WY+  F  +++N ID+R+ I F
Sbjct: 421 SCSSTNTHAISKRNQFLPTRSCLFDLYRSLSQGQTLKSWYELKFTTLKENNIDIRRFITF 480

Query: 462 GITRRLIYRVNSYPIVKNVGTWDI--LKSLVSKEP 494
           G+ R +IYR  S+P++ +VG+ D   +  + +KEP
Sbjct: 481 GLERSIIYRCYSFPVMIHVGSRDTKEMTPVATKEP 515

 Score =  112 bits (280), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 78/261 (29%), Positives = 113/261 (43%), Gaps = 65/261 (24%)

Query: 401 ASENTSLATGENQMKRILPTRSCLFDLYKSLSQGKTVKDWYKQNFEIIRDNRIDVRKLIM 460
           +S NT   +  NQ    LPTRSCLFDLY+SLSQG+T+K WY+  F  +++N ID+R+ I 
Sbjct: 423 SSTNTHAISKRNQF---LPTRSCLFDLYRSLSQGQTLKSWYELKFTTLKENNIDIRRFIT 479

Query: 461 FGITRRLIYRVNSYPIVKNVGTWDILKSLVSKEPKTHYGSGSSKNIFSAADIKVVDTKEE 520
           FG+ R +IYR  S+P++ +VG+ D                          ++  V TKE 
Sbjct: 480 FGLERSIIYRCYSFPVMIHVGSRD------------------------TKEMTPVATKEP 515

Query: 521 GNQSDKLDAADEXXXXXXXXXXXXXDVPNTMSKFARYYDDSPSNNAFTEXXXXXXXXXXX 580
            N+ + L   D                          Y+ S S                 
Sbjct: 516 SNEDNSLKKRD--------------------------YNHSLSVTGSKSTTQTNVKSERP 549

Query: 581 XXXXFDFGTAGQQKT-VTEVPDLGDGXXXXXXXXXXXXXLILLESLSNAETFDKVCTKLK 639
               F+   A    T   ++P L D               IL +S+ +AE FDK+C  L 
Sbjct: 550 SKVSFEMQRANSLATGKNKIPKLSDEEKK-----------ILEKSIRSAENFDKICVLLG 598

Query: 640 KSRHEVELLLKDLGHYNIVNS 660
           KS+ EVE  L +LG + ++NS
Sbjct: 599 KSKQEVENYLSELGEFKVINS 619

>Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON}
           YEL062W (REAL)
          Length = 615

 Score =  489 bits (1259), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 256/495 (51%), Positives = 334/495 (67%), Gaps = 14/495 (2%)

Query: 1   MTSTFDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFDTIKNYIIPKPQLCNKL 60
           M S F GFVPIHT+FY++FHPTEGSK++++FPPN+L+N  I+F+TIKNYIIPKP LC+KL
Sbjct: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPVLCHKL 60

Query: 61  LTFKYGEYRIVCYPVNVNARYYARNSXXXXXXXXXPYDCATSPYEPAIARLGKMFKVLEE 120
           +TFKYG YRIVCYPV +N+  YARN          PYDC TSPYEPAI RLGKMFKVLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QSQILSKSEQNPVYFQLKSNDSNAADQSTE---MGSITISEHTDIKSTGDDGEK------ 171
           Q+Q+LSKSE++PV+F LK+ +++    ST      S T S  T    T D   K      
Sbjct: 121 QNQLLSKSEKDPVFFDLKALENSTIAPSTACPPATSNTSSNTTPTHPTSDKDAKDLRNSR 180

Query: 172 YLEIIKELAKNQKSLIIEDLLMKLFLDLNNYSECLIPIDEGNSIDIKLFPVRTPPSSNIS 231
           Y +++K+    + +  I+DLLM++F DLNNYSECLIPIDEGN++DIK+FP+  PP++ +S
Sbjct: 181 YNDLVKDFELPESTFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240

Query: 232 VEDVPIAVVNLSDIIDVNWDPTMVKIVPYINGINSVAQIAVSARSDVELVQECIKHLMYY 291
           +EDVP++ VNL  IIDVNWDPTM+ IVPYI+G+NS+A+I+  + SD  LV ECI+HL+YY
Sbjct: 241 LEDVPLSSVNLEKIIDVNWDPTMMNIVPYIDGLNSIAKISKLSNSDPSLVIECIRHLIYY 300

Query: 292 NCVILSDIFQFSNIYAPTSEIHNFLTNPAVAKACQLFVQGDSL-KQSLLPFEGRPNNIYP 350
            CV LSDIFQFSNIYAP+S I NFLT+P +A  CQ +V    + K S LP      +   
Sbjct: 301 KCVTLSDIFQFSNIYAPSSSIRNFLTDPLMANDCQYYVTFPEVSKISSLPLNKNLTSGDL 360

Query: 351 TGRKQASTSTVHSRRRDSNDTATTGSTSSVRDTHRNYLXXXXXXXYFRAHASENTSLATG 410
                +      S    SN  + T S SS     +N          +R      TS ++ 
Sbjct: 361 DSPSFSVRRKSKSSSIPSNPGSRTTSFSSTSKVSQNSSINSSFSSAYRDWRQSQTSCSSS 420

Query: 411 ----ENQMKRILPTRSCLFDLYKSLSQGKTVKDWYKQNFEIIRDNRIDVRKLIMFGITRR 466
                N   R LPTRSCLFDLY+SLSQG+T+K WY+  + II+DN ID+R+ I FG+ +R
Sbjct: 421 NIHISNNRNRFLPTRSCLFDLYRSLSQGQTLKAWYESKYMIIKDNNIDIRRFITFGLEKR 480

Query: 467 LIYRVNSYPIVKNVG 481
           +IYR  SYP++ +VG
Sbjct: 481 IIYRSYSYPVMLSVG 495

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 28/41 (68%)

Query: 620 ILLESLSNAETFDKVCTKLKKSRHEVELLLKDLGHYNIVNS 660
           IL ES+ +AE FDK+C  L K + EVE  L +LG + I+NS
Sbjct: 575 ILEESVRSAENFDKICVLLGKPKLEVENYLNELGEFKIINS 615

>YEL062W Chr5 (34407..36254) [1848 bp, 615 aa] {ON}  NPR2Subunit of
           SEA (Seh1-associated), Npr2/3, and Iml1p complexes;
           Npr2/3 complex mediates downregulation of TORC1 activity
           upon amino acid limitation; SEA complex is a
           coatomer-related complex that associates dynamically
           with the vacuole; Iml1p complex (Iml1p-Npr2p-Npr3p) is
           required for non-nitrogen-starvation (NNS)-induced
           autophagy; Iml1p interacts primarily with phosphorylated
           Npr2p; homolog of human NPRL2; target of Grr1p; required
           for growth on urea and proline
          Length = 615

 Score =  488 bits (1256), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 258/513 (50%), Positives = 342/513 (66%), Gaps = 31/513 (6%)

Query: 1   MTSTFDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFDTIKNYIIPKPQLCNKL 60
           M S F GFVPIHT+FY++FHPTEGSK++++FPPN+L+N  I+F+T KNYIIPKP LC+KL
Sbjct: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTFKNYIIPKPILCHKL 60

Query: 61  LTFKYGEYRIVCYPVNVNARYYARNSXXXXXXXXXPYDCATSPYEPAIARLGKMFKVLEE 120
           +TFKYG YRIVCYPV +N+  YARN          PYDC TSPYEPAI RLGKMFKVLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QSQILSKSEQNPVYFQLKSNDSNAADQSTEMGSITISEHTDIKSTGDDGEK--------- 171
           Q+Q+LSKSE++PV+F LK  +++    ST   S T +  ++   T    EK         
Sbjct: 121 QNQLLSKSERDPVFFDLKVLENSTTTPSTAGPSSTPNPSSNTTPTHPTSEKDTKDMRSSR 180

Query: 172 YLEIIKELAKNQKSLIIEDLLMKLFLDLNNYSECLIPIDEGNSIDIKLFPVRTPPSSNIS 231
           Y ++IK+L   Q +  I+DLLM++F DLNNYSECLIPIDEGN++DIK+FP+  PP++ +S
Sbjct: 181 YSDLIKDLGLPQSAFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240

Query: 232 VEDVPIAVVNLSDIIDVNWDPTMVKIVPYINGINSVAQIAVSARSDVELVQECIKHLMYY 291
           +EDVP++ VNL  IIDVNWDPTM+ IVPYI+G+NS+A+I+  + SD  LV ECI+HL+YY
Sbjct: 241 LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSNSDPGLVIECIRHLIYY 300

Query: 292 NCVILSDIFQFSNIYAPTSEIHNFLTNPAVAKACQLFVQGDSL-KQSLLPFEGRPNNIYP 350
            CV LSDIFQFSNIYAP+S I NFLT+P +A  CQ +V    + K S LP     N    
Sbjct: 301 KCVTLSDIFQFSNIYAPSSLIRNFLTDPLMASDCQSYVTFPEVSKISNLPL----NKSLG 356

Query: 351 TGRKQAST----STVHSRRRDSNDTATTGSTSSVRDTHRNYLXXXXXXXYFRAHASENTS 406
           +G + + +        S    SN  + T S SS     +N          ++      TS
Sbjct: 357 SGDQDSPSFSVRRKSKSSSIPSNPDSRTTSFSSTSRVSQNSSLNSSFSSIYKDWRQSQTS 416

Query: 407 LATGE----NQMKRILPTRSCLFDLYKSLSQGKTVKDWYKQNFEIIRDNRIDVRKLIMFG 462
            ++      N   R LPTRSCLFDLY+SLSQG+T+K WY+  + I+++N ID+R+ I FG
Sbjct: 417 CSSSNIHVINNRNRFLPTRSCLFDLYRSLSQGQTLKTWYESKYMILKENNIDIRRFITFG 476

Query: 463 ITRRLIYRVNSYPIVKNVGTWDILKSLVSKEPK 495
           + +R+IYR  S+P++ N G         S+EPK
Sbjct: 477 LEKRIIYRCYSFPVMINAG---------SREPK 500

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/41 (53%), Positives = 29/41 (70%)

Query: 620 ILLESLSNAETFDKVCTKLKKSRHEVELLLKDLGHYNIVNS 660
           IL ES+ NAETFDK+C  L K + EVE  L +LG + ++NS
Sbjct: 575 ILEESIRNAETFDKICVLLSKPKLEVESYLNELGEFKVINS 615

>CAGL0L13288g Chr12 complement(1420781..1422721) [1941 bp, 646 aa]
           {ON} similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062w nitrogen permease regulator
          Length = 646

 Score =  478 bits (1229), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 276/685 (40%), Positives = 393/685 (57%), Gaps = 66/685 (9%)

Query: 1   MTSTFDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFDTIKNYIIPKPQLCNKL 60
           M S F+GFV IH++FY+ FHPTEGSKV+F FPP SLEN  I+FD+IKNY+IPK  LC++L
Sbjct: 1   MASQFEGFVDIHSIFYSTFHPTEGSKVKFDFPPRSLENSGINFDSIKNYVIPKRALCHRL 60

Query: 61  LTFKYGEYRIVCYPVNVNARYYARNSXXXXXXXXXPYDCATSPYEPAIARLGKMFKVLEE 120
           +TFKYG YRI CYPV VN+  YARN          P++C TSPYEPAI RLGKMF+VLE 
Sbjct: 61  ITFKYGNYRIACYPVTVNSSIYARNFFSFNFVFVFPFNCETSPYEPAIERLGKMFRVLEI 120

Query: 121 QSQILSKSEQNPVYFQLKSNDSNAADQSTEMGSITISEHTDIKST--GDDGEKYLEIIKE 178
           Q+QILSKSE + + F LKS D N    +     I   + + I +T   D  E+   II  
Sbjct: 121 QNQILSKSENDTIMFNLKSADKNFNIDNDSSNYILGDDISSIMTTQQKDKYERLNNIISN 180

Query: 179 LAKNQKSLIIEDLLMKLFLDLNNYSECLIPIDEGNSIDIKLFPVRTPPSSNISVEDVPIA 238
           + K   +  I DLLM+L+ DLN YSECLIPID+GN++DIKLFP+ TPP+  IS+E VPI+
Sbjct: 181 IKKKPSNFTISDLLMRLYQDLNTYSECLIPIDDGNAVDIKLFPLLTPPTPYISIEHVPIS 240

Query: 239 VVNLSDIIDVNWDPTMVKIVPYINGINSVAQIAVSARSDVELVQECIKHLMYYNCVILSD 298
           +VNL  I+DVNWDP M+ I+PYINGIN++ +I+  + ++  LV ECI+HL+YY C++L+D
Sbjct: 241 LVNLFKIVDVNWDPIMLTIIPYINGINNIYRISQLSHNEESLVIECIRHLVYYRCIVLTD 300

Query: 299 IFQFSNIYAPTSEIHNFLTNPAVAKACQLFVQGDSLKQSLLPFEGRPNNI--YPT-GRKQ 355
           IF+FSN+YAPTS +  FL +P +A  CQ +V        +LP   + N++  YP  G+  
Sbjct: 301 IFEFSNVYAPTSSLRLFLLDPNMATECQSYV--------MLPINSKMNDLSLYPHHGKHS 352

Query: 356 ASTSTVHSRRRDSNDTATTGSTSSVRDTHRNYLXXXXXXXYFRAHASENTSLATGENQ-- 413
           A    + SR    + +  + + +  R   R+         +++      +S++TG +   
Sbjct: 353 AFNGDIGSRNNSVSTSLYSFNGNDSRPQSRSSSVDQSQTNFYKNKKQSESSISTGNSNNG 412

Query: 414 --MKRILPTRSCLFDLYKSLSQGKTVKDWYKQNFEIIRDNRIDVRKLIMFGITRRLIYRV 471
             + + LPTRS LFDLY+SLSQG T+K+WY QN +IIRDNRIDVR+ I FG+ RR+IYR 
Sbjct: 413 QNIHKHLPTRSLLFDLYRSLSQGITLKEWYMQNHKIIRDNRIDVRRFITFGVLRRIIYRC 472

Query: 472 NSYPIVKNVGTWDILKSLVSKEPKTHYGSGSSKNIFSAADIKVVDTKEEGNQSDKLDAAD 531
            +Y +   + + D L++L        +     +N  S  +I    +K + N  D L AAD
Sbjct: 473 ETYSV---INSTDHLQNL--------WKLNELENPISMENI----SKLQSNHIDSL-AAD 516

Query: 532 EXXXXXXXXXXXXXDVPNTMSKFARYYDDSPSNNAF-TEXXXXXXXXXXXXXXXFDFGTA 590
           E                  M+ + +     PS  A  +                 +   A
Sbjct: 517 EA----------------LMNAYKKLSLKVPSKGALKSHNTSHSSFSLTPTAPEMENSQA 560

Query: 591 GQQKTVTEV-----PDLGDG-----------XXXXXXXXXXXXXLILLESLSNAETFDKV 634
            + K +++V     P+  +G                         I+L++L++AET DK+
Sbjct: 561 KRNKRLSKVSFEALPEDRNGFRWGSNIKTPIQETTWKKLSKMQRRIMLKALADAETLDKI 620

Query: 635 CTKLKKSRHEVELLLKDLGHYNIVN 659
           C  L+  R  V  +L +LG   ++N
Sbjct: 621 CVLLEMPRQNVVNILHELGELKLIN 645

>Kpol_1045.72 s1045 (167094..169181) [2088 bp, 695 aa] {ON}
           (167096..169183) [2088 nt, 696 aa]
          Length = 695

 Score =  475 bits (1222), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 257/566 (45%), Positives = 348/566 (61%), Gaps = 46/566 (8%)

Query: 5   FDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFDTIKNYIIPKPQLCNKLLTFK 64
           FDGF PIHT+FY++FHPTEG KV +QFPPN+L+N  I+FD+I++Y+IPKPQLCNKLLT K
Sbjct: 4   FDGFEPIHTIFYSVFHPTEGPKVCYQFPPNNLDNYSINFDSIRSYVIPKPQLCNKLLTLK 63

Query: 65  YGEYRIVCYPVNVNARYYARNSXXXXXXXXXPYDCATSPYEPAIARLGKMFKVLEEQSQI 124
           YG YRI+ YP+ +N   YARN+         PY+C TSPYE  I +LGKMF+VLEEQSQ 
Sbjct: 64  YGNYRIIGYPITINCSIYARNNFSFNLVFVFPYECKTSPYESVIVKLGKMFRVLEEQSQF 123

Query: 125 LSKSEQNPVYFQLKSNDSNAADQSTEMG-------------------SITISEHTDIKST 165
           LSK+E++  YF  K+   ++ DQ +++                        +  TD K  
Sbjct: 124 LSKAEKDLAYFDFKAILHSSLDQDSKLKPEKDSSGNNNGNSNNSNNDQSNSANATDSKKN 183

Query: 166 GDD-GEKYLEIIKELAKNQKSLIIEDLLMKLFLDLNNYSECLIPIDEGNSIDIKLFPVRT 224
                EKY EI + ++ ++    I+D +M+L+ DLNNYSECLIPID GN++DIKLFP+  
Sbjct: 184 SSYLFEKYKEIQEFVSNDESDFSIQDFIMRLYQDLNNYSECLIPIDAGNAVDIKLFPLLR 243

Query: 225 PPSSNISVEDVPIAVVNLSDIIDVNWDPTMVKIVPYINGINSVAQIAVSARSDVELVQEC 284
           PP + IS+EDVPI+ VNL +IIDVNWDPTM+KIVP+I+G+NS+A+IA  + SD  LV EC
Sbjct: 244 PPPATISIEDVPISRVNLKEIIDVNWDPTMLKIVPHIDGVNSIAKIAKLSDSDTVLVIEC 303

Query: 285 IKHLMYYNCVILSDIFQFSNIYAPTSEIHNFLTNPAVAKACQLFV---QGDSLKQSLLPF 341
           IKH +YY CV++SDIFQFSNIYAPTS + NFLT+P +A  CQ +V   +  +L Q  LP 
Sbjct: 304 IKHFIYYGCVVISDIFQFSNIYAPTSLLRNFLTDPLMATECQTYVTVPESSTLHQ--LPL 361

Query: 342 EGRPNNIYPTGRKQASTSTVHSRRRDSND----TATTGSTSSVRDTHRNYLXXXXXXXYF 397
           E          +  +  S   + R+  N      A+  S+      + N         Y 
Sbjct: 362 ES-----LSKLKLDSDGSDSQNLRKSKNGIDSRAASFVSSRGASSHNENSSLYSRSDLYL 416

Query: 398 RAHASENTSLATGENQMK---RILPTRSCLFDLYKSLSQGKTVKDWYKQNFEIIRDNRID 454
             H SE++  +   N +    + LPTRS LFDLY+SLSQG T+K+WYK+NF  IR+N ID
Sbjct: 417 NRHRSESSISSQNTNDLNGNVKQLPTRSTLFDLYRSLSQGVTLKEWYKENFFEIRNNGID 476

Query: 455 VRKLIMFGITRRLIYRVNSYPIVKNVGTWDILKSLV-----SKEPKTHYGSGSSKNIFSA 509
           +RK I+FGI   L+YR  S+P+  N    + +K         +  K       S++IFS 
Sbjct: 477 IRKFIIFGIINGLLYRCQSFPVTANFEEINKVKKFKDIQNRKETRKDKLQKQLSQDIFST 536

Query: 510 ADIKV----VDTKEEGNQSDKLDAAD 531
           +DIKV    +  +    Q+  LD AD
Sbjct: 537 SDIKVGEDLISGRNRRIQTLDLDIAD 562

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 28/41 (68%)

Query: 620 ILLESLSNAETFDKVCTKLKKSRHEVELLLKDLGHYNIVNS 660
           ILLE+L + E  DK+C  L+K R EVE +LK L  + ++NS
Sbjct: 655 ILLEALESTENLDKICVLLEKPRSEVEEMLKHLVDFKVINS 695

>KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {ON}
           Anc_6.17 YEL062W
          Length = 594

 Score =  453 bits (1165), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 250/528 (47%), Positives = 333/528 (63%), Gaps = 39/528 (7%)

Query: 1   MTSTFDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFDTIKNYIIPKPQLCNKL 60
           M S F+GFVPIHT+FYT+FHPTEGSKV +QFPP +L++  I+FD IKNYIIPKPQLC++L
Sbjct: 1   MMSKFEGFVPIHTLFYTIFHPTEGSKVCYQFPPGNLQHYDINFDAIKNYIIPKPQLCHRL 60

Query: 61  LTFKYGEYRIVCYPVNVNARYYARNSXXXXXXXXXPYDCATSPYEPAIARLGKMFKVLEE 120
           LT KYG YRIV YPV V +  YARN          PY+CATSPYEPAI RLGKMF+VLEE
Sbjct: 61  LTMKYGNYRIVSYPVAVQSSSYARNYFRFNFVFVFPYECATSPYEPAITRLGKMFRVLEE 120

Query: 121 QSQILSKSEQNPVYF---QLKSNDSNAADQST---EMGSITISEHTDIKSTGDDGEKYLE 174
           QSQ+LS++E++   F   +L  ++++A +Q+     + S T S   D K+ GD     + 
Sbjct: 121 QSQVLSRAERDDSLFKGDKLPFDNNSAKNQAPLTHALISKTKSFSPDKKTEGD-----IH 175

Query: 175 IIKELAKNQKSLIIEDLLMKLFLDLNNYSECLIPIDEGNSIDIKLFPVRTPPSS-NISVE 233
           +I           ++DL+M+++ DLNNYSECLIPIDEGN+IDIK+FP+  PP+S ++S+E
Sbjct: 176 LIS----------VQDLIMRIYQDLNNYSECLIPIDEGNAIDIKIFPLINPPTSVHLSIE 225

Query: 234 DVPIAVVNLSDIIDVNWDPTMVKIVPYINGINSVAQIAVSARSDVELVQECIKHLMYYNC 293
           DVP+ VV L  IID+NWDPTMV I+P+ING+NS+  IA  + SD ELV ECIKHL+YY C
Sbjct: 226 DVPMLVVKLKKIIDLNWDPTMVSILPFINGVNSILNIARLSDSDPELVIECIKHLIYYKC 285

Query: 294 VILSDIFQFSNIYAPTSEIHNFLTNPAVAKACQLFVQGDSLKQSLLPFEGRPNNIYPTGR 353
           VI++DIFQFSNIYAP+S I+ FLT+P +A  CQ +V         LP   R   +     
Sbjct: 286 VIITDIFQFSNIYAPSSLINEFLTDPTMAYDCQEYVT--------LPKSSR---LIHMPL 334

Query: 354 KQASTSTVHSRRRDSNDTATTGSTS-----SVRDTHRNYLXXXXXXXYFRAHASENTSLA 408
           + +   + +++ + SN  ++TG  S        +    +           + +SE T  A
Sbjct: 335 QTSVPGSRNNKHKKSNSLSSTGVLSWQSNSQYSNNSSEFYSMSNKKRSESSLSSEGTPGA 394

Query: 409 TGENQMKRILPTRSCLFDLYKSLSQGKTVKDWYKQNFEIIRDNRIDVRKLIMFGITRRLI 468
              +      PTR  LFDLY+SLSQG T++ WY  NF  IR N IDVRK I FG  +++I
Sbjct: 395 GRSDDHTIYYPTRMVLFDLYRSLSQGITLEKWYTTNFTTIRSNYIDVRKFIQFGTIKKII 454

Query: 469 YRVNSYPIVKNVGTWDILKSLVSKEPKTHYGSGSSKNIFSAADIKVVD 516
           YRV SYP+++      I K +  K         S    FS +DIK  D
Sbjct: 455 YRVLSYPVLEKRRNSIIAKQM-GKSKMAEKAPHSKNAFFSTSDIKFDD 501

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 29/41 (70%)

Query: 619 LILLESLSNAETFDKVCTKLKKSRHEVELLLKDLGHYNIVN 659
           L LL +L N E+FDK+C +L +SR E+  L+ D+G Y ++N
Sbjct: 553 LQLLGALDNLESFDKICVQLGRSRVEIANLIADIGEYRVIN 593

>TPHA0J00310 Chr10 complement(68890..70917) [2028 bp, 675 aa] {ON}
           Anc_6.17 YEL062W
          Length = 675

 Score =  454 bits (1167), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 297/702 (42%), Positives = 399/702 (56%), Gaps = 71/702 (10%)

Query: 1   MTSTFDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFDTIKNYIIPKPQLCNKL 60
           M ++FDGFVPIH +FY++FHPTEG+KV ++FPP++L    I+FD IKNY+IPKPQLC+KL
Sbjct: 1   MNNSFDGFVPIHGIFYSVFHPTEGTKVSYEFPPSNLVKSGINFDAIKNYVIPKPQLCHKL 60

Query: 61  LTFKYGEYRIVCYPVNVNARYYARNSXXXXXXXXXPYDCATSPYEPAIARLGKMFKVLEE 120
           LT KY  YRIV YP+ +N+  YARN+         PY+C TSPYEP + RLGKMF  LE 
Sbjct: 61  LTLKYNNYRIVGYPIIINSSLYARNNFSFNLVFVFPYECETSPYEPVVERLGKMFCELEG 120

Query: 121 QSQILSKSEQNPVYF----------QLKSN---DSNAADQSTEMGSITISE-HTDIKSTG 166
           Q Q LSK E++  YF          Q KSN   D+N   ++  M   TIS   T + ST 
Sbjct: 121 QCQFLSKCEKDMAYFDFKLISNLIDQDKSNTEPDNNILSKTNSMILPTISNIDTTVGSTN 180

Query: 167 DDGE------KYL----EIIKELAKNQK-SLIIEDLLMKLFLDLNNYSECLIPIDEGNSI 215
              +      +YL     +I+   KN K  L + D+LM++F DLN+YSEC IPID+GN+I
Sbjct: 181 TQDKANSKEVEYLFSKYNVIQNYIKNDKMQLSMNDILMRVFQDLNSYSECYIPIDDGNAI 240

Query: 216 DIKLFPVRTPPSSNISVEDVPIAVVNLSDIIDVNWDPTMVKIVPYINGINSVAQIAVSAR 275
           DIKLFP   PP  +ISVEDVPI  VNL+ IIDVNWDPTM+KIVPYI+G+NS+ +IA  + 
Sbjct: 241 DIKLFPTLMPPIDSISVEDVPIPTVNLNKIIDVNWDPTMLKIVPYIDGLNSIFKIANLSN 300

Query: 276 SDVELVQECIKHLMYYNCVILSDIFQFSNIYAPTSEIHNFLTNPAVAKACQLFVQG--DS 333
           SD  LV ECI+H +YY CVILSDIFQFSNIYAPTS I +FLT+P +A  CQ++V    DS
Sbjct: 301 SDAMLVIECIRHFVYYGCVILSDIFQFSNIYAPTSSITDFLTDPTLATECQIYVTSPEDS 360

Query: 334 LKQSLLPF-EGRPNNIYPTGRKQASTSTVHSRRRDSNDTATTGSTSSVRDT--HRNYLXX 390
           L  S LPF +GR        R+ AS ++  +          + ++S + D   H +    
Sbjct: 361 L-LSALPFKKGRK---MVKNRRSASIASHFTSSSSLRQNLNSKASSFISDEGHHNDDTAY 416

Query: 391 XXXXXYFRAHASENTSLATGEN----QMKRILPTRSCLFDLYKSLSQGKTVKDWYKQNFE 446
                 +       +S ++G N    Q +  LPT+S LFDLY+SLSQG  +++WY+ NF 
Sbjct: 417 PNHDSIYENRRRSESSFSSGNNDEMHQNRNYLPTKSTLFDLYRSLSQGVKLEEWYQINFN 476

Query: 447 IIRDNRIDVRKLIMFGITRRLIYRVNSYPIVKNVGTWDILKSL--VSKEPKTHYGSGSS- 503
            IRDN ID+R+ I+FGI +R+IYR +SYP+ KN   +  L  L  +   PK       S 
Sbjct: 477 SIRDNFIDIRRFIIFGIIKRIIYRCHSYPLPKNYEAFSKLNDLKNLQNGPKIVKNKSQSY 536

Query: 504 -KNIFSAADIKV-----VDTKEEGNQSDKLDAADEXXXXXXXXXXXXXDVPNTMSKFARY 557
             NIFS +DIK       DTK++ +  D +D AD                  +++   ++
Sbjct: 537 TYNIFSTSDIKFGVDLYTDTKKKLHTLD-VDVADRVLNNVYKKLSTNGRPTTSINGQGQH 595

Query: 558 YDDSPSNNAFTEXXXXXXXXXXXXXXXFDFGTAGQQKTVTEVPDLGDGXXXXXXXXXXXX 617
               PS  AF                 +D    G         +LG              
Sbjct: 596 ----PSKVAFKN-------------QSYDNDLPGLMN------NLGIEATKFSREININD 632

Query: 618 XLILLESLSNAETFDKVCTKLKKSRHEVELLLKDLGHYNIVN 659
            + LL++L +AE  D +C+ L+ SR EVE LL +L  Y I+N
Sbjct: 633 KIYLLDALQSAENLDNICSNLELSREEVETLLNELTEYRIIN 674

>TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {ON}
           Anc_6.17 YEL062W
          Length = 710

 Score =  448 bits (1152), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 250/545 (45%), Positives = 345/545 (63%), Gaps = 44/545 (8%)

Query: 1   MTSTFDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFDTIKNYIIPKPQLCNKL 60
           M   F+GFVPIHTVFY++FHPTEG+KVR++FPP +L+   I+FDTIKNYIIPKPQLC+KL
Sbjct: 1   MIDHFEGFVPIHTVFYSIFHPTEGTKVRYEFPPGNLQTYNINFDTIKNYIIPKPQLCHKL 60

Query: 61  LTFKYGEYRIVCYPVNVNARYYARNSXXXXXXXXXPYDCATSPYEPAIARLGKMFKVLEE 120
           LT KYG+YR+V YPV +N+  YARN          P +C TSPYEP IARLGKMF+VLEE
Sbjct: 61  LTLKYGDYRLVSYPVTINSSLYARNFFSFNFVFVFPINCETSPYEPIIARLGKMFRVLEE 120

Query: 121 QSQILSKSEQNPVYFQLKSNDSNAADQSTEMGSITISEHTDIKSTGDDG--EKYLEIIK- 177
           Q+Q+LS++E + VYF     D++ +  S+E  SI    H D K+T   G   K     K 
Sbjct: 121 QNQLLSRAENDSVYF-----DNSHSLLSSEQDSIM---HQD-KNTSILGFSRKRFSFSKR 171

Query: 178 -------ELAKNQK--SLIIEDLLMKLFLDLNNYSECLIPIDEGNSIDIKLFPVRTPPSS 228
                  E   N+   +  ++DL+M++F DLNNYSECLIPIDEGNS+DIK+FP   PPS 
Sbjct: 172 PTDLSLSEYPDNESGSNFSVQDLIMRIFQDLNNYSECLIPIDEGNSVDIKIFPSMVPPSI 231

Query: 229 NISVEDVPIAVVNLSDIIDVNWDPTMVKIVPYINGINSVAQIAVSARSDVELVQECIKHL 288
           +IS EDVP+A+V+LS ++DVNWDPTM+KIVP+I+ INS+++IA  + SDV+ V ECI+HL
Sbjct: 232 SISYEDVPVAMVDLSHVMDVNWDPTMLKIVPFIDSINSISRIAALSNSDVDFVVECIRHL 291

Query: 289 MYYNCVILSDIFQFSNIYAPTSEIHNFLTNPAVAKACQLFVQGDSLKQSLLPFEGRPNNI 348
           +YY  VILSDIFQF+NIYAPTS + +FLT+  +A  CQ +V                   
Sbjct: 292 VYYQLVILSDIFQFTNIYAPTSRLRDFLTDINLATDCQTYV------------------C 333

Query: 349 YPTGRKQASTSTVHSRRRDSNDTATTGSTSSVRDTHRNYLXXXXXXXYFRAH---ASENT 405
            P            S   D ++ + +GS     +             Y++     +S ++
Sbjct: 334 LPKNSNFGKLPLEKSINTDLDEYSNSGSAIYPNNEILENDDRLRWPMYYKPRNSQSSLSS 393

Query: 406 SLATGENQMKRILPTRSCLFDLYKSLSQGKTVKDWYKQNFEIIRDNRIDVRKLIMFGITR 465
            +++G  +    LPT+SCLFDLY+SLSQG  + DWY +++ +I  N+ID+R+ I FG+ R
Sbjct: 394 GISSGNERTSNYLPTKSCLFDLYRSLSQGTVLHDWYNEHYSLIHFNKIDIRRFITFGLVR 453

Query: 466 RLIYRVNSYPIVKNVGTWDILKSLVSKEPKTHYGS-GSSKN-IFSAADIKVVDTKEEGNQ 523
            L+YR  + PI+KN G +DIL SL + +    Y S G  KN   S A+I+ +++  + + 
Sbjct: 454 GLLYRCYAIPIMKNAGIFDILSSLTTSQSSNPYHSNGDDKNGTASTANIRFLNSITDSDI 513

Query: 524 SDKLD 528
            D  D
Sbjct: 514 HDLKD 518

 Score = 48.5 bits (114), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 29/40 (72%)

Query: 620 ILLESLSNAETFDKVCTKLKKSRHEVELLLKDLGHYNIVN 659
           +LLESL  A+  DK+C KL+K R EVE LL ++G Y I+N
Sbjct: 670 LLLESLREADNMDKICIKLQKPRKEVEELLSEIGDYVIIN 709

>NCAS0H00870 Chr8 (158877..160715) [1839 bp, 612 aa] {ON} Anc_6.17
           YEL062W
          Length = 612

 Score =  439 bits (1128), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 238/480 (49%), Positives = 321/480 (66%), Gaps = 27/480 (5%)

Query: 5   FDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFDTIKNYIIPKPQLCNKLLTFK 64
           F+GF+PIHT+FY++FHPTEG+KV ++FPP +L N  I+FDTIKNYIIPK QLCN+LLTFK
Sbjct: 12  FEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLTFK 71

Query: 65  YGEYRIVCYPVNVNARYYARNSXXXXXXXXXPYDCATSPYEPAIARLGKMFKVLEEQSQI 124
           Y  YRIV YP+ +NA YYARN          PY+C TSPYEP+IARLGKMFK+LEEQSQI
Sbjct: 72  YENYRIVSYPITINAPYYARNFFSFNFVFVFPYECETSPYEPSIARLGKMFKILEEQSQI 131

Query: 125 LSKSEQNPVYFQLKSNDSNAADQSTEMGSITISEHTD---IKSTGDDGEKY-LEIIKELA 180
           LSK+E +P+YF  KS+       +T +  I+ S         +  +DG ++  +   E  
Sbjct: 132 LSKAENDPIYF--KSDYVPTEPTTTIIPQISPSHRNKRNNDHNDNNDGSRFETDFFGEEE 189

Query: 181 KNQKSLIIEDLLMKLFLDLNNYSECLIPIDEGNSIDIKLFPVRTPPSSN-ISVEDVPIAV 239
                  ++DL+M+++ DLNNYSECLIPID+GN I+IK+FP+  PP ++ IS+EDVP+++
Sbjct: 190 DGVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDVPMSL 249

Query: 240 VNLSDIIDVNWDPTMVKIVPYINGINSVAQIAVSARSDVELVQECIKHLMYYNCVILSDI 299
           +NL+++IDVNWDPTM+ IVPYING+N +++IA   ++D  LV ECIKHL+YYNCVI++DI
Sbjct: 250 INLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDI 309

Query: 300 FQFSNIYAPTSEIHNFLTNPAVAKACQLFVQ---GDSLKQSLLPFEGRPNNIYPTGRKQA 356
           FQFSN+YAPTS I +FLT+  +A  CQ +V    G  L  S LPFE         G KQ 
Sbjct: 310 FQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKL--SHLPFEN-------NGNKQP 360

Query: 357 STSTVHSRRRDSNDTATTGSTSSVRDTHRNYLXXXXXXXYFRAHASENTSLATGENQMKR 416
           ST      +     + ++  + SV     +Y+          + +S + +    E     
Sbjct: 361 STP-----KHSRTTSLSSSMSGSVNSHEHSYMDTIQKSETSLSLSSTDPNNPHFELAH-- 413

Query: 417 ILPTRSCLFDLYKSLSQGKTVKDWYKQNFEIIRDNRIDVRKLIMFGITRRLIYRVNSYPI 476
            LPT++CLFDLY+SLS G T++ WY+ N  II +N +DVRK I FGI R LIYR +SYPI
Sbjct: 414 -LPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCHSYPI 472

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 28/39 (71%)

Query: 620 ILLESLSNAETFDKVCTKLKKSRHEVELLLKDLGHYNIV 658
           +LL+S+ + E  DK+C KL KSR +VE  L +LG+Y I+
Sbjct: 572 VLLKSIESLENLDKICVKLGKSRQQVERWLDELGNYKII 610

>KAFR0L00380 Chr12 complement(69525..71147) [1623 bp, 540 aa] {ON}
           Anc_6.17 YEL062W
          Length = 540

 Score =  424 bits (1090), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 225/490 (45%), Positives = 306/490 (62%), Gaps = 68/490 (13%)

Query: 1   MTSTFDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFDTIKNYIIPKPQLCNKL 60
           M + F+GF PIHT+F+++FHPTEGSKV +QFPP +L+   I+FD+IKN++IPKPQLC++L
Sbjct: 1   MNTQFEGFEPIHTIFFSIFHPTEGSKVCYQFPPENLQAYNINFDSIKNFVIPKPQLCHRL 60

Query: 61  LTFKYGEYRIVCYPVNVNARYYARNSXXXXXXXXXPYDCATSPYEPAIARLGKMFKVLEE 120
           LT +Y  YR+V YPVNV++  YARN           YDC T PYEPAI RLGKMFK LEE
Sbjct: 61  LTLEYKNYRLVSYPVNVSSSSYARNFFSFNFVFIFSYDCQTLPYEPAIERLGKMFKTLEE 120

Query: 121 QSQILSKSEQNPVYFQLKSNDSNAADQSTEMGSITISEHTDIKSTGDDGEKYLEIIKELA 180
           QSQILSKS++   +F+                               DGE    +  + +
Sbjct: 121 QSQILSKSQRTSAFFK-------------------------------DGEDVDFVDTKFS 149

Query: 181 KNQKSLIIEDLLMKLFLDLNNYSECLIPIDEGNSIDIKLFPVRTPPSS-NISVEDVPIAV 239
                  I+DLLM+L+ DLNNYSECLIPIDEGN I+IK+FPV  PP+S  IS+EDVP+++
Sbjct: 150 -------IQDLLMRLYQDLNNYSECLIPIDEGNEINIKIFPVLKPPTSVQISIEDVPLSI 202

Query: 240 VNLSDIIDVNWDPTMVKIVPYINGINSVAQIAVSARSDVELVQECIKHLMYYNCVILSDI 299
           VNL  I+D+NWDPTM+ I+P+I+G+NS+  I+  + SD  LV ECIKHL+YYNCVI++DI
Sbjct: 203 VNLDKIVDLNWDPTMLSILPFIDGVNSITNISHLSDSDPNLVIECIKHLIYYNCVIITDI 262

Query: 300 FQFSNIYAPTSEIHNFLTNPAVAKACQLFVQGDSLKQSLLPFEGRPNNIYPTGRKQASTS 359
           FQFSNIYAP+S I+NFL +P +A  CQ +V                  + P G K  +  
Sbjct: 263 FQFSNIYAPSSLINNFLRDPMIAFNCQSYV------------------VLPPGSK-INDL 303

Query: 360 TVHSRRRDSNDTATTGSTSSVRDTHRNYLXXXXXXXYFR----AHASENTS-LATGENQM 414
            + S + D  + +     +                 Y R    AH  ++TS L++ E Q 
Sbjct: 304 PLASEQDDEINNSDMTQKALSSSRSSFSSYFSHKSAYARVSETAHHHQSTSTLSSSEGQQ 363

Query: 415 K-----RILPTRSCLFDLYKSLSQGKTVKDWYKQNFEIIRDNRIDVRKLIMFGITRRLIY 469
                 ++LP++  LFDLY+SL+ G TV+ WYKQNF  I++N IDVRK I FG+  ++IY
Sbjct: 364 DNPRQGQVLPSKCTLFDLYRSLNYGCTVEAWYKQNFSTIKENHIDVRKFIKFGVINKIIY 423

Query: 470 RVNSYPIVKN 479
           RV+ YPI+++
Sbjct: 424 RVHQYPIMEH 433

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 30/41 (73%)

Query: 620 ILLESLSNAETFDKVCTKLKKSRHEVELLLKDLGHYNIVNS 660
           IL  +L   E+FD++C+KL KS++EVE ++ ++G Y  +NS
Sbjct: 500 ILFNALERHESFDRICSKLGKSKNEVESIISEIGEYMTINS 540

>NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.17
           YEL062W
          Length = 666

 Score =  427 bits (1097), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 230/522 (44%), Positives = 320/522 (61%), Gaps = 71/522 (13%)

Query: 5   FDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFDTIKNYIIPKPQLCNKLLTFK 64
           F+GF+PIHT+FY++FHPTEG+KVR++FPP++L    I FD IKNYIIPK QLCNKLLTFK
Sbjct: 13  FEGFMPIHTIFYSIFHPTEGTKVRYEFPPSNLAASDIHFDAIKNYIIPKKQLCNKLLTFK 72

Query: 65  YGEYRIVCYPVNVNARYYARNSXXXXXXXXXPYDCATSPYEPAIARLGKMFKVLEEQSQI 124
           Y  YRIV YP+ +N+ +YARN          PYDC TSPYEPAIARLGKMFKVLEEQ+QI
Sbjct: 73  YANYRIVSYPITINSDFYARNFFSFNFVFVFPYDCETSPYEPAIARLGKMFKVLEEQNQI 132

Query: 125 LSKSEQNPVYFQ-----------LKSNDSNAADQSTEMGSITISEHTDIKSTGDDGEKYL 173
           LSK+E +P+YF+           + +N+ N   ++ ++    + +   I ST        
Sbjct: 133 LSKAENDPIYFKSDYTPYQPTLIIPTNNDNDGKRNKKL----MKKENTIFSTRQQRSNSN 188

Query: 174 EI--------------------------IKELAKNQKSLIIEDLLMKLFLDLNNYSECLI 207
            I                          I++   N   + ++DL+M+++ DLNNYSECLI
Sbjct: 189 RILEENSNSNSNSNSNSNGNENDNNYNTIEQYLNNNSRISVQDLIMRIYQDLNNYSECLI 248

Query: 208 PIDEGNSIDIKLFPVRTPPSSN-ISVEDVPIAVVNLSDIIDVNWDPTMVKIVPYINGINS 266
           PID+GN++DIK+FP+  PP +N +S+EDVP+++V+L+ I DVNWDPTM+K++P+INGIN 
Sbjct: 249 PIDDGNNVDIKIFPLLKPPPANSLSIEDVPMSLVDLTKITDVNWDPTMLKLIPFINGIND 308

Query: 267 VAQIAVSARSDVELVQECIKHLMYYNCVILSDIFQFSNIYAPTSEIHNFLTNPAVAKACQ 326
           +++I+  + S   LV ECIKHL+YYNCVI++DIFQFSN Y+ TS I  FLT+P +A  CQ
Sbjct: 309 ISKISKLSNSSPMLVIECIKHLIYYNCVIITDIFQFSNTYSTTSLISTFLTDPNMATLCQ 368

Query: 327 LFVQGDSLKQSLLPFEGR----PNNIYPTGRKQASTSTVHSRRRD-------SNDTATTG 375
            +V        +LP   +    P +I      Q+S++  H   R        S+ T+  G
Sbjct: 369 NYV--------VLPLGSKLTRLPFHIETETSVQSSSAYRHHHNRHEKTPSFGSSITSNNG 420

Query: 376 STSSVRDTHRNYLXXXXXXXYFRAHASENTSLATGENQMKRILPTRSCLFDLYKSLSQGK 435
            +S   D  +                S +  ++T        LPT+  LF+LY+SL+Q  
Sbjct: 421 RSSFSADDRKQ----SETSLNSSNDPSNSNLISTAH------LPTKMSLFELYRSLNQRT 470

Query: 436 TVKDWYKQNFEIIRDNRIDVRKLIMFGITRRLIYRVNSYPIV 477
            +K+WYK N+  I +N ID+RK I FGI + LIYR +SYPIV
Sbjct: 471 DLKNWYKLNYTTIIENNIDIRKFIKFGIIKGLIYRCHSYPIV 512

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 27/40 (67%)

Query: 620 ILLESLSNAETFDKVCTKLKKSRHEVELLLKDLGHYNIVN 659
           ILL+S+SN +  DK+C KL + R ++E  L + G Y ++N
Sbjct: 626 ILLDSISNMDNMDKICVKLGRPRSQIEEWLSEFGDYKVIN 665

>SAKL0E12650g Chr5 complement(1042706..1047727) [5022 bp, 1673 aa]
          {ON} similar to uniprot|P53886 Saccharomyces cerevisiae
          YNL172W APC1 Largest subunit of the Anaphase-Promoting
          Complex/Cyclosome (APC/C) which is a ubiquitin-protein
          ligase required for degradation of anaphase inhibitors
          including mitotic cyclins during the metaphase/anaphase
          transition
          Length = 1673

 Score = 36.2 bits (82), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 1/57 (1%)

Query: 28 RFQFPPNSLENGKIDFDTIKNYIIPKPQLCNKLLTFKYGEYRIVCYPVNV-NARYYA 83
          R+ F    L+ G +DF+T KN +I   + C  +     G+   VC+P ++ NA +Y+
Sbjct: 40 RYSFADKVLKAGFVDFETAKNCLIIVLEDCAHVHYLSKGDSTAVCFPFSISNAFFYS 96

>KLLA0D02398g Chr4 complement(202446..206063) [3618 bp, 1205 aa]
           {ON} similar to uniprot|P06105 Saccharomyces cerevisiae
           YJL080C SCP160 May be required during cell division for
           faithful partitioning of the ER-nuclear envelope
           membranes involved in control of mitotic chromsome
           transmission,
          Length = 1205

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 37/74 (50%), Gaps = 4/74 (5%)

Query: 138 KSNDSNAADQSTEMGSITISEHTDIKSTGDDGEKYLEIIKELAKNQKSLI-IEDLLMKLF 196
           K  D    D   E  S+TIS H D +S      K L+++KE  KN K ++ +ED  +  F
Sbjct: 218 KEVDEGTYDSDLEDYSVTISLHGDAESVLVAKSKILDVVKEETKNAKIVLPVEDSKLVPF 277

Query: 197 LDLNNYSECLIPID 210
           +DL +     IP D
Sbjct: 278 IDLESVE---IPAD 288

>ZYRO0F14608g Chr6 complement(1203405..1204862) [1458 bp, 485 aa]
           {ON} highly similar to uniprot|P41921 Saccharomyces
           cerevisiae YPL091W GLR1 Cytosolic and mitochondrial
           glutathione oxidoreductase converts oxidized glutathione
           to reduced glutathione
          Length = 485

 Score = 31.2 bits (69), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 27/58 (46%), Gaps = 5/58 (8%)

Query: 31  FPPNSLENGKIDFDTIKNYIIPKPQ-----LCNKLLTFKYGEYRIVCYPVNVNARYYA 83
           F P+   N K+D++ + + I   P+     L  K    K+GE  +  Y  +  A YYA
Sbjct: 359 FGPSQFHNDKLDYNNVPSVIFSHPEAGAIGLTEKQAIDKFGEKNVKVYKSSFTAMYYA 416

>Kwal_33.14960 s33 (890402..892675) [2274 bp, 757 aa] {ON} YKL072W
           (STB6) - involved in transcription [contig 396] FULL
          Length = 757

 Score = 31.2 bits (69), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 64/153 (41%), Gaps = 25/153 (16%)

Query: 34  NSLENG-KIDFDTIKNYIIPKPQL--CNKLLTFKYGEYRIVCYPVNVNARYYARNSXXXX 90
           NS E+  KID D  ++ +  +P +    + +     EY+ + + VN N     R+S    
Sbjct: 494 NSREDAFKIDRDVYESELHRRPSIPYLPEDIGMMQMEYKNLPWKVNQNINQCRRHSYSIV 553

Query: 91  XXXXXPYDCATSPYEPAIARLGKMFKVLEEQSQILSKSEQN---------PVYFQLKSND 141
                P+   TSP+EP++ R+ +     E +      ++QN         P    L+ ND
Sbjct: 554 QDAMEPW---TSPFEPSLVRIARDALKFEREVARSRDNDQNEVSNHDPITPHLVNLREND 610

Query: 142 S----------NAADQSTEMGSITISEHTDIKS 164
           S             DQ  E  SI +S+ +++ S
Sbjct: 611 SELHSKLGELEQLRDQLVEKRSIVLSDISELDS 643

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 66,073,171
Number of extensions: 2771627
Number of successful extensions: 9166
Number of sequences better than 10.0: 53
Number of HSP's gapped: 9404
Number of HSP's successfully gapped: 75
Length of query: 660
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 544
Effective length of database: 40,180,143
Effective search space: 21857997792
Effective search space used: 21857997792
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)