Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D01045g6.16ON96596546750.0
Ecym_30206.16ON94491125640.0
ACR010C6.16ON94594424700.0
KLTH0C11330g6.16ON94192224650.0
Kwal_56.224036.16ON94392224450.0
TDEL0G045306.16ON95891222230.0
SAKL0E01078g6.16ON94865617910.0
ZYRO0C07898g6.16ON97466115560.0
YEL061C (CIN8)6.16ON100065615410.0
Smik_5.266.16ON100262415320.0
Skud_5.286.16ON99865615110.0
Suva_5.66.16ON99965614660.0
Kpol_1032.66.16ON100461514091e-179
NCAS0H008806.16ON100454314061e-178
NDAI0D008706.16ON106966313791e-173
KAFR0L003706.16ON96362213351e-168
CAGL0B03641g6.16ON98852412861e-161
KNAG0M011306.16ON95065712151e-151
TPHA0M002406.16ON93959012061e-149
TBLA0A072306.16ON109753911891e-145
Kpol_1045.736.16ON9626579991e-119
TPHA0J003006.16ON9826357181e-79
SAKL0F12298g7.387ON11123226498e-70
Smik_2.537.387ON11133216434e-69
YBL063W (KIP1)7.387ON11113486392e-68
ACR228C7.387ON11293206312e-67
NCAS0E026407.387ON11024596222e-66
Skud_2.417.387ON11103116222e-66
Suva_2.547.387ON11102636214e-66
TPHA0E008907.387ON12326356207e-66
Ecym_46887.387ON11342496171e-65
TDEL0C016007.387ON11053216081e-64
NDAI0E043007.387ON11862166021e-63
ZYRO0B03234g7.387ON11382715974e-63
KAFR0L017107.387ON11512205959e-63
TBLA0D006407.387ON11422914632e-46
SAKL0G05016g5.531ON5041753656e-36
KLTH0G03850g5.531ON4731733522e-34
SAKL0G18920g2.633ON6491743484e-33
KLLA0B00759g5.531ON4562763371e-32
Kwal_47.186085.531ON4791753301e-31
Ecym_34152.633ON6621703244e-30
Ecym_40665.531ON4781743141e-29
ADR145C2.633ON6351693154e-29
KAFR0F042103.528ON6722123093e-28
Kpol_1004.255.531ON5061922955e-27
Skud_7.533.528ON8051752952e-26
Smik_7.483.528ON8051772943e-26
Kwal_47.190933.528ON8191742943e-26
Suva_7.443.528ON8051752934e-26
NCAS0E005503.528ON7841772917e-26
KNAG0B005203.528ON7234152908e-26
ZYRO0D12650g5.531ON4781802841e-25
KLTH0G01606g3.528ON8191742882e-25
CAGL0I07029g3.528ON7051752862e-25
ZYRO0E08668g3.528ON7781752872e-25
TDEL0D059603.528ON7331572862e-25
YGL216W (KIP3)3.528ON8051752862e-25
TBLA0C039403.479ON7391822844e-25
NDAI0I029603.528ON8681852845e-25
SAKL0F01760g3.528ON8091562829e-25
Ecym_12003.528ON8333072801e-24
Kpol_423.83.528ON8061762792e-24
TPHA0D034803.528ON8471762792e-24
TBLA0C049603.528ON8011782773e-24
AER441C3.528ON8181662765e-24
Kpol_505.393.479ON6921492721e-23
KNAG0A078803.479ON7641532721e-23
KLLA0A01606g3.528ON7691762721e-23
NCAS0C013508.678ON6551782711e-23
KLTH0F14498g3.479ON7021502675e-23
SAKL0F03168g3.479ON7061702657e-23
CAGL0D04994g3.479ON6921492631e-22
Kpol_1050.1033.479ON6971532603e-22
TBLA0C053103.479ON6761752603e-22
Kpol_1013.78.678ON6201742567e-22
AGR253W3.479ON7091722568e-22
KAFR0B065903.479ON7061492551e-21
TDEL0F036403.479ON7041522542e-21
ZYRO0B04290g3.479ON7311492532e-21
Suva_16.4693.479ON7311462523e-21
Kwal_26.88068.678ON7152032514e-21
TPHA0D032003.479ON7241492505e-21
NCAS0F034703.479ON6981502505e-21
KAFR0H024108.678ON6582232486e-21
KLLA0B10956g3.479ON6901392488e-21
YPR141C (KAR3)3.479ON7291442489e-21
KLLA0D05951g8.678ON6681722479e-21
Skud_16.4353.479ON7291452471e-20
Ecym_44073.479ON7111692461e-20
Smik_16.3883.479ON7291442452e-20
KLTH0D11286g8.678ON6781812407e-20
ZYRO0F07414g8.678ON6541902407e-20
NDAI0B057703.479ON7631542408e-20
Skud_16.1278.678ON7061952372e-19
YPL155C (KIP2)8.678ON7061952372e-19
SAKL0H06490g8.678ON6572142362e-19
KNAG0J017208.678ON6251802343e-19
ACR145W8.678ON6852022343e-19
CAGL0M02189g8.678ON6721892326e-19
TDEL0A062408.678ON6372142326e-19
TPHA0D012708.678ON6961832318e-19
TBLA0C018808.678ON4681492271e-18
NDAI0E02090singletonON6851912282e-18
Ecym_23958.678ON6872062272e-18
TDEL0B072702.633ON6442572245e-18
TPHA0D041903.479ON6721642221e-17
Smik_6.3528.678ON7152012211e-17
Suva_16.1558.678ON7041952051e-15
Kpol_1019.112.633ON6471741852e-13
YKL079W (SMY1)2.633ON6561291763e-12
TPHA0N016502.633ON6822151763e-12
Suva_11.1452.633ON6571241721e-11
Kwal_55.21164singletonOFF5881861683e-11
Kwal_YGOB_55.211643.479ON6571861673e-11
Skud_11.1482.633ON6561091585e-10
Smik_11.1602.633ON6561091495e-09
KNAG0M025402.633ON5221161486e-09
KAFR0C040202.633ON6673061433e-08
CAGL0L05104g2.633ON6752851433e-08
TBLA0A008202.633ON8031671344e-07
NCAS0H031802.633ON6601231317e-07
ZYRO0E01078g2.633ON6683351272e-06
TBLA0C008002.633ON6931341263e-06
NDAI0C004802.633ON5981251219e-06
KNAG0H003602.633ON6811141076e-04
NCAS0C052002.633ON572126940.015
NCAS0C028308.401ON874132910.047
Skud_4.528.456ON32769810.47
Skud_4.1964.238ON1792314800.99
Ecym_52913.211ON248761791.1
KLTH0H14806g5.349ON34685752.5
KNAG0A030508.653ON232117742.8
KAFR0F030204.46ON824268752.9
ZYRO0C01716g8.259ON1413125762.9
Suva_4.438.456ON32769743.0
TPHA0K022204.23ON82041753.3
SAKL0G18458g4.365ON764145753.6
TPHA0B008404.237ON1119104744.7
NDAI0J025404.301ON706142735.7
Skud_9.195.702ON1680156735.9
Kpol_1037.473.220ON150768727.1
NCAS0A059604.46ON920284728.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D01045g
         (965 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar ...  1805   0.0  
Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to ...   992   0.0  
ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON} S...   956   0.0  
KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {...   954   0.0  
Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061...   946   0.0  
TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {O...   860   0.0  
SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar ...   694   0.0  
ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {...   603   0.0  
YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}  C...   598   0.0  
Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON} ...   594   0.0  
Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON} Y...   586   0.0  
Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON} YE...   569   0.0  
Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON} (9109..1...   547   e-179
NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {...   546   e-178
NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {...   535   e-173
KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16...   518   e-168
CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} simila...   499   e-161
KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6....   472   e-151
TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16...   469   e-149
TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON} Anc_...   462   e-145
Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa] ...   389   e-119
TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16...   281   1e-79
SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa] ...   254   8e-70
Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W (R...   252   4e-69
YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}  KIP1Kines...   250   2e-68
ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON} ...   247   2e-67
NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7....   244   2e-66
Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W (R...   244   2e-66
Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W (...   243   4e-66
TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7....   243   7e-66
Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} simila...   242   1e-65
TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7....   238   1e-64
NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {...   236   1e-63
ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa] ...   234   4e-63
KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa] ...   233   9e-63
TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7....   182   2e-46
SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly...   145   6e-36
KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some s...   140   2e-34
SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]...   138   4e-33
KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some sim...   134   1e-32
Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {...   131   1e-31
Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar t...   129   4e-30
Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar t...   125   1e-29
ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON} S...   125   4e-29
KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {O...   123   3e-28
Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON} (54983....   118   5e-27
Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)   118   2e-26
Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)   117   3e-26
Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]...   117   3e-26
Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)   117   4e-26
NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}...   116   7e-26
KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528...   116   8e-26
ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some...   114   1e-25
KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} simila...   115   2e-25
CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} simila...   114   2e-25
ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {...   115   2e-25
TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa] ...   114   2e-25
YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}  KIP3Kinesin-...   114   2e-25
TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {O...   114   4e-25
NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {O...   114   5e-25
SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} simila...   113   9e-25
Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar t...   112   1e-24
Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON} (11134..13...   112   2e-24
TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {O...   112   2e-24
TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa] ...   111   3e-24
AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}...   110   5e-24
Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}...   109   1e-23
KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa] ...   109   1e-23
KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} simila...   109   1e-23
NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {O...   108   1e-23
KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]...   107   5e-23
SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} simila...   106   7e-23
CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {...   105   1e-22
Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]...   104   3e-22
TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON} Anc_3...   104   3e-22
Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON} (11880.....   103   7e-22
AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic ...   103   8e-22
KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa] ...   102   1e-21
TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {O...   102   2e-21
ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} simila...   102   2e-21
Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {...   101   3e-21
Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C...   101   4e-21
TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {O...   100   5e-21
NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {O...   100   5e-21
KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {O...   100   6e-21
KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} simila...   100   8e-21
YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON} ...   100   9e-21
KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} simila...   100   9e-21
Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {...   100   1e-20
Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar t...    99   1e-20
Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {...    99   2e-20
KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} simila...    97   7e-20
ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} simila...    97   7e-20
NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa] ...    97   8e-20
Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {...    96   2e-19
YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON} ...    96   2e-19
SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {...    96   2e-19
KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8....    95   3e-19
ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic ho...    95   3e-19
CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa] ...    94   6e-19
TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON} Anc_8...    94   6e-19
TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.6...    94   8e-19
TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.6...    92   1e-18
NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {O...    92   2e-18
Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}...    92   2e-18
TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa] ...    91   5e-18
TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {O...    90   1e-17
Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C ...    90   1e-17
Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {...    84   1e-15
Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {O...    76   2e-13
YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Prote...    72   3e-12
TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {...    72   3e-12
Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079...    71   1e-11
Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa] {...    69   3e-11
Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)...    69   3e-11
Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079...    65   5e-10
Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079...    62   5e-09
KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2....    62   6e-09
KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.6...    60   3e-08
CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa] ...    60   3e-08
TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.6...    56   4e-07
NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633     55   7e-07
ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar ...    54   2e-06
TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {O...    53   3e-06
NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}...    51   9e-06
KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633...    46   6e-04
NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON} Anc_2...    41   0.015
NCAS0C02830 Chr3 (534302..536926) [2625 bp, 874 aa] {ON} Anc_8.401     40   0.047
Skud_4.52 Chr4 complement(90001..90984) [984 bp, 327 aa] {ON} YD...    36   0.47 
Skud_4.196 Chr4 (341072..346450) [5379 bp, 1792 aa] {ON} YDL058W...    35   0.99 
Ecym_5291 Chr5 (586479..593942) [7464 bp, 2487 aa] {ON} similar ...    35   1.1  
KLTH0H14806g Chr8 (1285442..1285493,1285556..1286544) [1041 bp, ...    33   2.5  
KNAG0A03050 Chr1 complement(374568..375266) [699 bp, 232 aa] {ON...    33   2.8  
KAFR0F03020 Chr6 (595158..597632) [2475 bp, 824 aa] {ON} Anc_4.4...    33   2.9  
ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] ...    34   2.9  
Suva_4.43 Chr4 complement(81094..82077) [984 bp, 327 aa] {ON} YD...    33   3.0  
TPHA0K02220 Chr11 (473969..476431) [2463 bp, 820 aa] {ON} Anc_4....    33   3.3  
SAKL0G18458g Chr7 (1591284..1593578) [2295 bp, 764 aa] {ON} simi...    33   3.6  
TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {...    33   4.7  
NDAI0J02540 Chr10 complement(627186..629306) [2121 bp, 706 aa] {...    33   5.7  
Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON} ...    33   5.9  
Kpol_1037.47 s1037 (114295..118818) [4524 bp, 1507 aa] {ON} (114...    32   7.1  
NCAS0A05960 Chr1 complement(1173851..1176613) [2763 bp, 920 aa] ...    32   8.5  

>KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar to
           uniprot|Q8J1G7 Ashbya gossypii ACR010C CIN8 Kinesin-like
           protein CIN8 and some similarites with YEL061C
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 965

 Score = 1805 bits (4675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 899/965 (93%), Positives = 899/965 (93%)

Query: 1   MSATNGSPEGDELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITA 60
           MSATNGSPEGDELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITA
Sbjct: 1   MSATNGSPEGDELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITA 60

Query: 61  RMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDE 120
           RMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDE
Sbjct: 61  RMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDE 120

Query: 121 KLYDGELSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNN 180
           KLYDGELSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNN
Sbjct: 121 KLYDGELSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNN 180

Query: 181 SRKLRIYDXXXXXXXXXXXXXXXXXXXXXXXXXXEAKRRIRAGALYKPKPKLPXXXXXXX 240
           SRKLRIYD                          EAKRRIRAGALYKPKPKLP       
Sbjct: 181 SRKLRIYDSLNSSNNVTNVNSRSSSRSNSPTVNLEAKRRIRAGALYKPKPKLPTQSQSNG 240

Query: 241 XXXXXXXXXXXXXXXXXXXXXVNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVAS 300
                                VNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVAS
Sbjct: 241 QQQQQQQQQQQQQQQQQTQGQVNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVAS 300

Query: 301 TKMNDVSSRSHTIFTLTLYKNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSIN 360
           TKMNDVSSRSHTIFTLTLYKNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSIN
Sbjct: 301 TKMNDVSSRSHTIFTLTLYKNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSIN 360

Query: 361 QSLLTLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSST 420
           QSLLTLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSST
Sbjct: 361 QSLLTLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSST 420

Query: 421 LEYATKAKNIKNKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVM 480
           LEYATKAKNIKNKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVM
Sbjct: 421 LEYATKAKNIKNKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVM 480

Query: 481 NDIENYKTEIQESRREIEKLSSQNQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKID 540
           NDIENYKTEIQESRREIEKLSSQNQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKID
Sbjct: 481 NDIENYKTEIQESRREIEKLSSQNQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKID 540

Query: 541 LKHKNEIELTNMIMKLKDAVRNMQGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKL 600
           LKHKNEIELTNMIMKLKDAVRNMQGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKL
Sbjct: 541 LKHKNEIELTNMIMKLKDAVRNMQGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKL 600

Query: 601 DNLKQQALEQSFTIDDDINNVKDSLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLS 660
           DNLKQQALEQSFTIDDDINNVKDSLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLS
Sbjct: 601 DNLKQQALEQSFTIDDDINNVKDSLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLS 660

Query: 661 ELNDMFSKVDEHTDRLKEGLSQITAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNL 720
           ELNDMFSKVDEHTDRLKEGLSQITAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNL
Sbjct: 661 ELNDMFSKVDEHTDRLKEGLSQITAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNL 720

Query: 721 SSKHLMSKITNIISDHVEQNRTLLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVC 780
           SSKHLMSKITNIISDHVEQNRTLLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVC
Sbjct: 721 SSKHLMSKITNIISDHVEQNRTLLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVC 780

Query: 781 DSLSNKFKDDTTESLNSLKSHMESTVRESSLIADKIKDNLCHFQDRNDIANMTTNINGTV 840
           DSLSNKFKDDTTESLNSLKSHMESTVRESSLIADKIKDNLCHFQDRNDIANMTTNINGTV
Sbjct: 781 DSLSNKFKDDTTESLNSLKSHMESTVRESSLIADKIKDNLCHFQDRNDIANMTTNINGTV 840

Query: 841 DDIKNKHSVLRDELEKNVSFIHASSEGFKAIDSSLKRIMNFRMPEGKTETLADDLIKHID 900
           DDIKNKHSVLRDELEKNVSFIHASSEGFKAIDSSLKRIMNFRMPEGKTETLADDLIKHID
Sbjct: 841 DDIKNKHSVLRDELEKNVSFIHASSEGFKAIDSSLKRIMNFRMPEGKTETLADDLIKHID 900

Query: 901 SSSVAPVASSGKTPLRPLLKSETKQRXXXXXXXXXXXXHATIINSPLKRKSSDSRIFPGN 960
           SSSVAPVASSGKTPLRPLLKSETKQR            HATIINSPLKRKSSDSRIFPGN
Sbjct: 901 SSSVAPVASSGKTPLRPLLKSETKQRSLSKSVSPAKSSHATIINSPLKRKSSDSRIFPGN 960

Query: 961 SKKQR 965
           SKKQR
Sbjct: 961 SKKQR 965

>Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to
           Ashbya gossypii ACR010C
          Length = 944

 Score =  992 bits (2564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/911 (54%), Positives = 667/911 (73%), Gaps = 32/911 (3%)

Query: 11  DELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVD 70
           +ELNITVAVRCRGRNE+EIKAKS+VVV  PDV G+NEVSINT+GDIGI  +MNS+TYTVD
Sbjct: 19  EELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTYTVD 78

Query: 71  KVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSEA 130
           +VFGPSADQ L+FK IA+P+F DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLYDGELS++
Sbjct: 79  QVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSDS 138

Query: 131 AGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKLRIYDXX 190
           AGIIPRVLF+LFDTLE  ESD++VKCS+IELYNEELKDLLDD  D     S++LRI+D  
Sbjct: 139 AGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTPDY----SKRLRIFDSN 194

Query: 191 XXXXXXXXXXXXXXXXXXXXXXXXEAKRRIRAGALYKPKPKLPXXXXXXXXXXXXXXXXX 250
                                    AKRR         KPK P                 
Sbjct: 195 TITNSRAGSQNNSPKEQDGTSSSM-AKRRY---THIPTKPKRPSLNKQL----------- 239

Query: 251 XXXXXXXXXXXVNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRS 310
                      + EQSSAIYIQ+LQEFHIT+A+EG+ +LQKGL HRQVASTKMND SSRS
Sbjct: 240 -----------LYEQSSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRS 288

Query: 311 HTIFTLTLYKNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVI 370
           HTIFT+ LYK++ GE FR+SK+NLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVI
Sbjct: 289 HTIFTIMLYKSYEGELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVI 348

Query: 371 NSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNI 430
           NSLADK+ HIPFRESKLTRLLQDSLGGNTKTALIATISPAKIN++ETSSTLEYATKAKNI
Sbjct: 349 NSLADKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNI 408

Query: 431 KNKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEI 490
           KN+PQLGSFMMKDILVK+IS EL+KLKSDFLSTK+KEGIYMSH HY E++ND+ENY+TEI
Sbjct: 409 KNRPQLGSFMMKDILVKSISSELSKLKSDFLSTKAKEGIYMSHEHYQEMVNDLENYQTEI 468

Query: 491 QESRREIEKLSSQNQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELT 550
           QES+R++E  SSQN LL KDKK+SQ   E Q ++I  LQ++++YL +KI+ +H+NEI+L 
Sbjct: 469 QESKRQVESFSSQNSLLLKDKKASQQLNELQDMKITRLQNTIEYLCDKIERQHRNEIDLV 528

Query: 551 NMIMKLKDAVRNMQGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQALEQ 610
           + I KLK+A+  M+G+L+ +E HE RLQ+DI+++LY  I  YR  ++  L+ +K + L++
Sbjct: 529 STIHKLKEALHTMKGSLQNYETHELRLQNDIKEVLYQGITSYRESMDQHLETVKTRMLDK 588

Query: 611 SFTIDDDINNVKDSLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSE-LNDMFSKV 669
           + +I+ +++ ++      L++V+     MC N+  K+V DQP        E L D+ +KV
Sbjct: 589 NLSINHNMDEIRTIFHETLDSVRSAGSDMCTNIV-KIVKDQPSTSYQQFKEALGDLDTKV 647

Query: 670 DEHTDRLKEGLSQITAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKHLMSKI 729
             ++  L   L+++T ENNN+K YLD HF +NN+QE+L++  +K YH+   +S  L+S +
Sbjct: 648 QTYSVTLTNKLTEMTEENNNMKEYLDEHFLKNNNQEMLDLRMEKAYHKSKTASDALISSV 707

Query: 730 TNIISDHVEQNRTLLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLSNKFKD 789
            +++  H+E++R L++ ++K A +E+I +E+  F+PV++ W  SF +IN CD+   +F++
Sbjct: 708 VSMMESHMEESRNLMLSSMKDAVSEMIDKELEMFQPVKERWVLSFENINECDAAHQQFEN 767

Query: 790 DTTESLNSLKSHMESTVRESSLIADKIKDNLCHFQDRNDIANMTTNINGTVDDIKNKHSV 849
            +T+ L +LK   +++V  +  +A ++++N+ +F+     A+   +I   ++DI +KH +
Sbjct: 768 KSTKLLTNLKELADNSVVAADDVAKQVQENVTNFEGIVRQASAKESIVKQMNDINDKHKM 827

Query: 850 LRDELEKNVSFIHASSEGFKAIDSSLKRIMNFRMPEGKTETLADDLIKHIDSSSVAPVAS 909
           L D  E N+ +   SS+GF+ +D S+K+I+    PE       + L++ ++S S  P+AS
Sbjct: 828 LEDHFENNIKYFKESSKGFEEMDCSIKKIIREMSPEVGDIKQIEALLERVNSRSFGPIAS 887

Query: 910 SGKTPLRPLLK 920
           +GKTP+RP LK
Sbjct: 888 TGKTPMRPELK 898

>ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL061C
           (CIN8)
          Length = 945

 Score =  956 bits (2470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/944 (52%), Positives = 658/944 (69%), Gaps = 38/944 (4%)

Query: 11  DELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVD 70
           +ELNITVAVRCRGRNE+EIKAKSSVVV  PDV G+NEVSINT+ ++GI A+MNS+TYTVD
Sbjct: 19  EELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTVD 78

Query: 71  KVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSEA 130
           KVFGPSADQSL+FKEIA+P+F DF+KGYNCT+LVYGMTSTGKTYTMTGDEKLYDG+LS++
Sbjct: 79  KVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSDS 138

Query: 131 AGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKLRIYDXX 190
           AGIIPR++FKLFD LE  +SD++VKCS+IELYNEELKDLLD+  DS    S++LRI+D  
Sbjct: 139 AGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHDS----SKRLRIFDSS 194

Query: 191 XXXXXXXXXXXXXXXXXXXXXXXXEAKRRIRAGALYKPKPKLPXXXXXXXXXXXXXXXXX 250
                                    ++RR R      P P                    
Sbjct: 195 SMNHSSRASSQSNSPREPEVAHNGFSRRRQR------PPP-------------------V 229

Query: 251 XXXXXXXXXXXVNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRS 310
                      ++E  S IY+Q++QEFHI +A+EG+ +LQKGL HRQVASTKMND SSRS
Sbjct: 230 KANRMSATKQQLSESGSGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRS 289

Query: 311 HTIFTLTLYKNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVI 370
           HTIFT+ LYKN +GE FRVSK+NLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVI
Sbjct: 290 HTIFTIMLYKNCDGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVI 349

Query: 371 NSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNI 430
           NSLADK+ HIPFRESKLTRLLQDSLGGNTKTALIATISPAKIN++ETSSTLEYA KAKNI
Sbjct: 350 NSLADKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNI 409

Query: 431 KNKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEI 490
           KN+PQLG+ MMKDILVKNIS ELAK+KSDFLSTKSK+GIYMSH HY E++ND+EN +TEI
Sbjct: 410 KNRPQLGALMMKDILVKNISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQTEI 469

Query: 491 QESRREIEKLSSQNQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELT 550
           QES+R+IE L+SQN LL KDKK+SQ+  E Q  +I+ LQS+++YLY+KI+ +H NE EL 
Sbjct: 470 QESKRQIESLTSQNNLLLKDKKASQEVTELQNSKIKKLQSTIEYLYDKIERQHHNETELA 529

Query: 551 NMIMKLKDAVRNMQGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQALEQ 610
             I KLK+A+  MQG+LK++E HE RLQ+DI+++LY  I  YR  +   L+ +K   L++
Sbjct: 530 TTIHKLKEALHTMQGSLKSYETHELRLQNDIKEVLYQGITSYRESMNQHLEKVKVSMLDK 589

Query: 611 SFTIDDDINNVKDSLETLLETVKKDAIIMCENLAQKVVGDQP----KFFNSMLSELNDMF 666
           + +I ++INN+    +  L++V+ +   MC+ L  K++ + P    K FN  +S L    
Sbjct: 590 NLSIKENINNITTIFDDTLKSVEANGSDMCDTLV-KLIKETPSMYLKEFNETVSSLK--- 645

Query: 667 SKVDEHTDRLKEGLSQITAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKHLM 726
           S++  +++ L   L++I+ ENN+L+ YLD H F+N+ QE+L++  +  Y ++   S  L+
Sbjct: 646 SELSSYSNALTNKLTEISEENNHLREYLDQHLFKNSTQEVLDLRMESVYQKVKNDSDQLL 705

Query: 727 SKITNIISDHVEQNRTLLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLSNK 786
           SK+ +++  HVE++RTL+++++K    E+I  E S F+P+R  W  S ++IN CD+    
Sbjct: 706 SKLVSMVGAHVEESRTLMVNSMKDTVNEIIDNERSLFQPIRDRWIASCDNINQCDASHQN 765

Query: 787 FKDDTTESLNSLKSHMESTVRESSLIADKIKDNLCHFQDRNDIANMTTNINGTVDDIKNK 846
           F+  +T  L+ LK   +++++ S    +K K     F D         ++   + DI +K
Sbjct: 766 FEAKSTSGLDKLKELSDASLKSSEDAVNKAKHRTDSFHDFVQKLCCDQSLKKQMHDISDK 825

Query: 847 HSVLRDELEKNVSFIHASSEGFKAIDSSLKRIMNFRMPEGKTETLADDLIKHIDSSSVAP 906
           H +L D  + NV +   SS+GF+ +D S+K+I++   PE       + L++ I++ + +P
Sbjct: 826 HRMLEDHFDDNVKYFKESSKGFEDMDCSIKKIIHEMSPEVGDIKSVETLMERINARTFSP 885

Query: 907 VASSGKTPLRPLLKSETKQRXXXXXXXXXXXXHATI-INSPLKR 949
           V  +GKTP R +LK+    +               + I SP+KR
Sbjct: 886 VRPTGKTPSRQVLKNAITSKASSRSMSPIKTLDTNVRIISPVKR 929

>KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {ON}
           similar to uniprot|P27895 Saccharomyces cerevisiae
           YEL061C CIN8 Kinesin motor protein involved in mitotic
           spindle assembly and chromosome segregation
          Length = 941

 Score =  954 bits (2465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/922 (53%), Positives = 649/922 (70%), Gaps = 54/922 (5%)

Query: 9   EGDELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYT 68
           E +ELNITVAVRCRGRNEKE+KAKSSVVV  PDV G NEVSINT+GD GITA++NSKTYT
Sbjct: 3   EEEELNITVAVRCRGRNEKEVKAKSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYT 62

Query: 69  VDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELS 128
           VD+VFGPSADQ L+FK IA+P+F DFIKGYNCT+LVYGMTSTGKTYTMTGDE+LYDGELS
Sbjct: 63  VDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELS 122

Query: 129 EAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKLRIYD 188
           E AGIIPRVLFKLFD L+    DYM+KCSFIELYNEELKDLLD+  DS  +  RKLRI+D
Sbjct: 123 EGAGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETPDS--SMPRKLRIFD 180

Query: 189 XXXXXXXXXXXXXXXXXXXXXXXXXXEAKRRIRAGALYKP------KPKLPXXXXXXXXX 242
                                       KRRIR   +YKP      KP L          
Sbjct: 181 SVTNPNSSRSSSRNSSPKPPEGSTSG-TKRRIRPNTMYKPSRSPTVKPTLS--------- 230

Query: 243 XXXXXXXXXXXXXXXXXXXVNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTK 302
                               +E +SAI+IQ+LQEFHI DAKEG+RLLQ+GL HRQVASTK
Sbjct: 231 --------------------SELNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTK 270

Query: 303 MNDVSSRSHTIFTLTLYKNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQS 362
           MNDVSSRSHTIFT+ LY+  NGE+FRVSK+NLVDLAGSENISRSGAQNQRAKEAGSINQS
Sbjct: 271 MNDVSSRSHTIFTIMLYRKCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQS 330

Query: 363 LLTLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLE 422
           LLTLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLE
Sbjct: 331 LLTLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLE 390

Query: 423 YATKAKNIKNKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMND 482
           YATKAKNIKNKPQ+GSF+MKD+LVKN++ EL K++SD L+TKSK+GIYMS  +Y E+ N+
Sbjct: 391 YATKAKNIKNKPQVGSFIMKDVLVKNVTAELVKIRSDLLATKSKDGIYMSQENYKELTNE 450

Query: 483 IENYKTEIQESRREIEKLSSQNQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLK 542
           +ENYKTE+QE +R IE+LS+QN LL K+K+ + +  ESQRL+I+ L +++D+LY+KID +
Sbjct: 451 LENYKTEVQECKRAIERLSTQNGLLTKEKRITNEVNESQRLKIKKLSNNIDFLYDKIDRQ 510

Query: 543 HKNEIELTNMIMKLKDAVRNMQGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDN 602
           HKNE EL+N++ +L  A+R MQ +LK +ED   R Q++++++LY+NI  ++  +  +++ 
Sbjct: 511 HKNEQELSNVVQELMRALRTMQNSLKVYEDQGHRFQTEMERVLYENIGSFKHSLLNEIEK 570

Query: 603 LKQQALEQSFTIDDDINNVKDSLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSEL 662
           LK    E  F +D +I+ +   L  + + +    I +C     K+    P +   + +++
Sbjct: 571 LKGTE-EDGFDVDANIDTLTKELNRIYDFINTSTIEICRKFMNKITEQTPTYLQDIRNQV 629

Query: 663 NDMFSKVDEHTDRLKEGLSQITAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSS 722
             +   V  ++  L   LS I+ E N+LK YL+ HFF+NN Q+ L+VH D+TYHQL +S+
Sbjct: 630 ESITHVVGSYSSDLMMHLSSISEEYNHLKDYLNEHFFKNNFQDALDVHVDRTYHQLKVSA 689

Query: 723 KHLMSKITNIISDHVEQNRTLLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDS 782
             +  K+  ++++ +E N+ ++M +LK A +EV+ +EM   +PV++ WE S  +IN CD 
Sbjct: 690 NSIFLKLREMMNEELETNKEIMMQSLKNAASEVVAKEMGLLDPVKQAWESSLENINECDK 749

Query: 783 LSNKF-KD------DTTESLNSLKSHMESTVRESSLIADKIKDNLCHFQDRNDIANMTTN 835
           L++ F KD      D  E +N      ES V +++L       +L  FQD +        
Sbjct: 750 LNSGFEKDIGSVVRDVFEKINEGLQFSESAVGDANL-------DLSRFQDASRALRTDDV 802

Query: 836 INGTVDDIKNKHSVLRDELEKNVSFIHASSEGFKAIDSSLKRIMNFR-MPEGKTETLADD 894
           I G++++IK KH++L+ +++ + S++ A+++ F  ID S++ ++N + + +  +E   + 
Sbjct: 803 IPGSIEEIKKKHNMLKLKVQDSASYMEAATQKFGEIDDSIQGLLNSQAVSQPHSENRIEG 862

Query: 895 LIKHIDSSSVAPVASSGKTPLR 916
           L++ ++   + P+  SGKTP+R
Sbjct: 863 LLEQLNGKPLKPLGPSGKTPMR 884

>Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061C
           (CIN8) - 1:1 [contig 185] FULL
          Length = 943

 Score =  946 bits (2445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/922 (52%), Positives = 652/922 (70%), Gaps = 42/922 (4%)

Query: 11  DELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVD 70
           +ELNITVAVRCRGRNEKE+KA+SSVVV  PDV G NEVSINT+GD GITA++NSKTYTVD
Sbjct: 5   EELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTVD 64

Query: 71  KVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSEA 130
           KVFGPSADQ L+FK IA+P+F DFIKGYNCT+LVYGMTSTGKTYTMTGDE+LYDGELSE 
Sbjct: 65  KVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEG 124

Query: 131 AGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKLRIYDXX 190
           AGIIPRVLFKLFD L  Q  DYM+KCSFIELYNEELKDLLD+  DS     +KLRI+D  
Sbjct: 125 AGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETPDSSM--PKKLRIFDSV 182

Query: 191 XXXXXXXXXXXXXXXXXXXXXXXXEAKRRIRAGALYKP------KPKLPXXXXXXXXXXX 244
                                     +R+ RA ++++P      KP  P           
Sbjct: 183 SNVSSNSRASSRNNSPKPNEGSSFGTRRKTRAPSIHRPTKSPVSKPVSPC---------- 232

Query: 245 XXXXXXXXXXXXXXXXXVNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMN 304
                              E SSAI+IQ+LQEFHI DAKEG+RLLQ+GL HRQVASTKMN
Sbjct: 233 -------------------EPSSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMN 273

Query: 305 DVSSRSHTIFTLTLYKNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLL 364
           DVSSRSHTIFT+ LYK  NGE+FRVSK+NLVDLAGSENISRSGAQNQRAKEAGSINQSLL
Sbjct: 274 DVSSRSHTIFTIMLYKKCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLL 333

Query: 365 TLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYA 424
           TLGRVINSLADK+ HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYA
Sbjct: 334 TLGRVINSLADKSLHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYA 393

Query: 425 TKAKNIKNKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIE 484
           TKAKNIKNKPQ+GSF+MKD+L+K+++ EL K+KSD LSTKSK+GIYMS  +Y E+ N++E
Sbjct: 394 TKAKNIKNKPQVGSFIMKDVLLKSVTAELVKIKSDLLSTKSKDGIYMSQENYKELTNELE 453

Query: 485 NYKTEIQESRREIEKLSSQNQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHK 544
           NYKTE++E +R +EK+S+QN LL K+K+ S +  ESQ++++R L +++++LY+KID +HK
Sbjct: 454 NYKTEVEECKRAMEKVSAQNSLLIKEKRVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHK 513

Query: 545 NEIELTNMIMKLKDAVRNMQGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLK 604
           NE EL+N++ +L  A+  MQ +L+ +ED  QR  ++++++LYDNI  +++ +  +++ LK
Sbjct: 514 NEQELSNVVQELMRALHTMQQSLRIYEDQGQRFHTEMERVLYDNIGSFKKSLMDEIEKLK 573

Query: 605 QQALEQSFTIDDDINNVKDSLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSELND 664
               E    ++ +++ V   L  + + +    I +  N  +KV    P +F  + S++  
Sbjct: 574 INVDENGDDVEVNVDAVTTELTRIFDFMNSSNIEVFRNYIKKVNDQTPAYFKDIYSQVES 633

Query: 665 MFSKVDEHTDRLKEGLSQITAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKH 724
           + S V  ++  L   LS I+ E NNLK YL+ HFF+NN QE L+VH D+TYHQL +S+  
Sbjct: 634 ITSVVSSYSSNLMIHLSSISEEYNNLKDYLNEHFFKNNFQEALDVHVDRTYHQLKVSANS 693

Query: 725 LMSKITNIISDHVEQNRTLLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLS 784
           +  K+  ++++ ++ N+  +M +L+ A +EV+ +EM   +PV++ WE S  +IN CD L+
Sbjct: 694 IFLKLREMLNEELDTNKEFMMQSLRHAASEVVAKEMCLLDPVKQAWENSLENINECDKLN 753

Query: 785 NKFKDDTTESLNSLKSHMESTVRESSLIADKIKDNLCHFQDRNDIANMTTN--INGTVDD 842
           N F++    ++N +   ++   + S +  +  K  L     R   +++  N  I   VD 
Sbjct: 754 NVFENKIGVTVNEIFKTIDQGQKTSQVTTEDAKSELTRV--RAAFSSLQNNGIILQNVDS 811

Query: 843 IKNKHSVLRDELEKNVSFIHASSEGFKAIDSSLKRIMNFR-MPEGKTETLADDLIKHIDS 901
           IK KH++L+ +++ + +++ A+++ F  ID+S++ ++N + +P+ ++E   D L++ ++ 
Sbjct: 812 IKKKHNLLKSQVQDSANYMQAATQKFGEIDNSIQDLLNAQTIPQPQSENPIDGLLEQLND 871

Query: 902 SSVAPVASSGKTPLRPLLKSET 923
            S+ P+  SGKTP+R + +S T
Sbjct: 872 KSLKPLGPSGKTPMRTVQRSVT 893

>TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {ON}
           Anc_6.16 YEL061C
          Length = 958

 Score =  860 bits (2223), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/912 (50%), Positives = 623/912 (68%), Gaps = 33/912 (3%)

Query: 11  DELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVD 70
           +ELNITVAVRCRGRNE+EIKAKSSVVV+ PDV G+NEVSINT+GD+GITA++NSKTYTVD
Sbjct: 13  EELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTYTVD 72

Query: 71  KVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSEA 130
           +VFGPSA+QSLVF++IA+P+F DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLYDGELSE+
Sbjct: 73  EVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSES 132

Query: 131 AGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKLRIYDXX 190
           AGIIPR+LFKLF+TLE+Q+ DY+VKCSF+ELYNEELKDLL D Q+    +SRKLRI+D  
Sbjct: 133 AGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIA--SSRKLRIFDSN 190

Query: 191 XXXXXXXXXXXXXXXXXXXXXXXXEAKRRIRAGALYKPKPKLPXXXXXXXXXXXXXXXXX 250
                                    +     A  L K     P                 
Sbjct: 191 TMSAATNSMSTGNSTKNSRNNSPRSSSELPTATFLRKRWKTAPSVTQSHQNS-------- 242

Query: 251 XXXXXXXXXXXVNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRS 310
                        +Q++ IYIQ+LQ+FHIT+AKEG++LLQKGL HRQVA+TKMND SSRS
Sbjct: 243 ------------QDQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRS 290

Query: 311 HTIFTLTLYKNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVI 370
           HTIFT+TLYK +NGE FRVSK+NLVDLAGSENISRSGAQ+QRAKEAGSINQSLLTLGRVI
Sbjct: 291 HTIFTITLYKEYNGEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVI 350

Query: 371 NSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNI 430
           NSL DK+ H+PFRESKLTRLLQDSLGGNTKTALIATISPAKINSEET STL+YA KAKNI
Sbjct: 351 NSLTDKSLHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNI 410

Query: 431 KNKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEI 490
           KNKPQLGS +MKDILVKNI+ ELAK+K+D LSTKSKEGIYMS  +Y E+ ND+E+YKTE+
Sbjct: 411 KNKPQLGSVIMKDILVKNITGELAKIKADLLSTKSKEGIYMSQDNYKELTNDLESYKTEV 470

Query: 491 QESRREIEKLSSQNQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELT 550
           +E +R IE L+SQN LL KDKK+S +  + QR++++N++ +M  LY K + ++K E  L 
Sbjct: 471 KECKRAIETLTSQNTLLLKDKKASNEVNDLQRIKLQNMRDAMSDLYSKAEKQNKREQNLV 530

Query: 551 NMIMKLKDAVRNMQGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQALEQ 610
                LK  V  MQ  +K HE  E+ ++S +  +  +     ++ I + + +++QQ   +
Sbjct: 531 ATASTLKTTVGTMQSIIKEHERRERDIESKMGDLFNNEFARVKQTILSNIRDIEQQIDWE 590

Query: 611 SFTIDDDINNVKDSLETLLETVKKDAIIMCENLAQKVVGDQPKFFN---SMLSELNDMFS 667
           +  +  +I++++  +  LLE  ++    M ++  +K++ + P  F      +SE+  + +
Sbjct: 591 NIGVQGNIDSIRGEISKLLERAQQQTDDMYKDCVEKILDETPGHFQLAAEKVSEVEKLIA 650

Query: 668 KVDEHTDRLKEGLSQITAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKHLMS 727
               H D L E LS ++ E NNL+ YL+ HFF+NNH+EIL  H D+TYH +  S+  L  
Sbjct: 651 TC--HRD-LTENLSDVSEEFNNLRQYLNDHFFKNNHEEILVSHIDRTYHHIQTSADDLFQ 707

Query: 728 KITNIISDHVEQNRTLLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLSNKF 787
           +   ++ +H+E+N+ L++++LKTAT +VI +EM  FEP +K WE SF +IN CDS++  F
Sbjct: 708 QFKEMMDNHLEKNKDLMLESLKTATYDVIRKEMQLFEPQKKKWEDSFKYINKCDSINFAF 767

Query: 788 KDDTTESLNSLKSHMESTVRESSLIADKIKDNLCHFQDRNDIANMTTNINGTVDDIKNKH 847
           ++     L  +KS + S+    +    K+K+ +   +    + + +   +     I NK 
Sbjct: 768 QNGVKSPLLGIKSTLGSSQEAINKTITKVKEQMDEHESPASMLSNSRVFSEQFSGILNKQ 827

Query: 848 SVLRDELEKNVSFIHASSEGFKAIDSSLKRIMNFRMP--EGKTETLADDLIKHIDSSSVA 905
           S+L + L+K+V      ++    +  ++  +++ R    EG+     D +++ +D  ++ 
Sbjct: 828 SLLHESLKKSVIITSDHADAVDKLKEAIDHVVSERGSSMEGERVEHVDGILRRMDEQNLL 887

Query: 906 PVASSGKTPLRP 917
            +    ++PLRP
Sbjct: 888 YL---DRSPLRP 896

>SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar to
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 948

 Score =  694 bits (1791), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/656 (52%), Positives = 489/656 (74%), Gaps = 4/656 (0%)

Query: 262 VNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKN 321
           ++EQSSAIYIQ+LQEFHIT+AK+G+ LLQ+GL HRQVASTKMND SSRSHTIFT+ LYKN
Sbjct: 254 LSEQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKN 313

Query: 322 FNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIP 381
            NGE FRVSK+NLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIP
Sbjct: 314 HNGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIP 373

Query: 382 FRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMM 441
           FRESKLTRLLQDSLGGNTKTALIATISPAKIN+EETSSTLEYATKAKNIKNKPQLG+ +M
Sbjct: 374 FRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQLGTLVM 433

Query: 442 KDILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLS 501
           KDILVKNI+ ELAK+KSDFLSTKSK+GIYM+  HY E+ +D+ENYKTE+QE +REIEK++
Sbjct: 434 KDILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSDLENYKTEVQECKREIEKMN 493

Query: 502 SQNQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVR 561
           SQN LL KDK++S +  E QR++I++L   + +LY+K+D +HKNE +L   I  LKDA+ 
Sbjct: 494 SQNVLLLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDLVCTIHTLKDAIY 553

Query: 562 NMQGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQALEQSFTIDDDINNV 621
            +Q +LK  ED++ + +S+++ +LYD++  +++ I  +L  +K     +   ID +I+ +
Sbjct: 554 TVQNSLKNCEDYQLQCKSEMEDVLYDHVTSFKQSIHEQLAAMKASHSSRHLGIDGNIDII 613

Query: 622 KDSLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKEGLS 681
           ++ L  +LE++   ++ +C +  +K++   PK F S+  +L D+ + VD +++ L + L 
Sbjct: 614 QEELSQVLESICSTSVDVCRSCVEKILESNPKHFESIRRDLLDISTVVDSYSNELVKNLG 673

Query: 682 QITAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKHLMSKITNIISDHVEQNR 741
            I+ E NN + YL+ H F+NNH+E L++H DKTYH L  S+  L SK   ++  H+E+N+
Sbjct: 674 DISEEYNNFREYLNEHLFKNNHEETLSIHVDKTYHMLKKSAGELFSKFKEMMDSHLEENK 733

Query: 742 TLLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLSNKFKDDTTESLNSLKSH 801
           +L++ +LKTA+ EV+ +E+  F PV++ WE S  +IN CDSL+N F     ++L  L+ +
Sbjct: 734 SLMIKSLKTASDEVVAKEVKLFAPVKQKWESSLENINKCDSLNNTFDSTVKDALRRLEGN 793

Query: 802 MESTVRESSLIADKIKDNLCHFQDRNDIANMTTNINGTVDDIKNKHSVLRDELEKNVSFI 861
           +E ++  S   A  +KD+L  F   +++    T +   ++++K KH+ LRD++E+  S+I
Sbjct: 794 IEGSLEFSKNTAGDVKDSLKKFDGISEVLKNNTKVVNNINEVKEKHTFLRDQVERTSSYI 853

Query: 862 HASSEGFKAIDSSLKRIMNFRMPE---GKTETLADDLIKHIDSSSVAPVASSGKTP 914
            A++E F+ ID  +++I++ ++P    G  E L + +++ +  + + P+ S+ +TP
Sbjct: 854 EAANEKFEGIDQFIRQIIDKKLPTHLVGNGE-LVNVMLEQLGKTHLKPIGSASRTP 908

 Score =  315 bits (808), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 166/179 (92%), Gaps = 2/179 (1%)

Query: 10  GDELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTV 69
           G ELNITV+VRCRGRNE+EIKAKSSVVV  PDV G+NEVSINT+ ++GITA+MNSKTYTV
Sbjct: 14  GQELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTV 73

Query: 70  DKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSE 129
           DKVFGPSADQSL+FK+IA+P+F DFIKGYNCT+LVYGMTSTGKTYTMTGDE+LYDGELS+
Sbjct: 74  DKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSD 133

Query: 130 AAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKLRIYD 188
           AAGIIPR+LFKLFDTLE Q+ DY+VKCSFIELYNEELKDLL++ Q+SG    +KLRI+D
Sbjct: 134 AAGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNEPQESGV--IKKLRIFD 190

>ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {ON}
           some similarities with uniprot|P27895 Saccharomyces
           cerevisiae YEL061C CIN8 Kinesin motor protein involved
           in mitotic spindle assembly and chromosome segregation
          Length = 974

 Score =  603 bits (1556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/661 (50%), Positives = 457/661 (69%), Gaps = 22/661 (3%)

Query: 267 SAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGET 326
           S +YIQ+LQ+FHIT A++GL+LLQKGL +RQVA+TKMND SSRSHTIFT+TLY+   GE 
Sbjct: 275 SGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEM 334

Query: 327 FRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESK 386
           F+VSK+NLVDLAGSENISRSGAQ+QRAKEAGSINQSLLTLGRVINSLADK+AH+PFRESK
Sbjct: 335 FKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFRESK 394

Query: 387 LTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMKDILV 446
           LTRLLQDSLGGNTKTALIATISPAKINSEET STL+YA+KAKNIKN+PQL SF+MKDILV
Sbjct: 395 LTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKDILV 454

Query: 447 KNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSSQNQL 506
           KNI+ ELAK+KSD LSTK +EG+YMS  +Y E+ ND+E+YKTEIQES+R IE+LSSQN L
Sbjct: 455 KNITAELAKVKSDLLSTKLREGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQNSL 514

Query: 507 LHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRNMQGA 566
           L KDKK+S +  E QR++++N++  M  L EK++ +HK E EL +M   LK  +   Q  
Sbjct: 515 LLKDKKASNEVNELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSV 574

Query: 567 LKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQ--------QALEQSFTIDDDI 618
           +K +   E+++   +Q +L    L++R+ +   +++++            EQ+  I  ++
Sbjct: 575 IKEYGQREKQISERMQMILGQEFLQFRQMLVNNIEDIRTNHSGNDILHEGEQN-GIQQNL 633

Query: 619 NNVKDSLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKE 678
           N ++  +  LL   +K A  M ++  +K++ + P  F ++ ++++ +   V+ +  RL E
Sbjct: 634 NVLRQEVVELLGLAQKRAEKMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRLTE 693

Query: 679 GLSQITAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKHLMSKITNIISDHVE 738
            LS I+   NNLK Y + HFF+NNH+E+LN H DKTY QL  S+  L+ K   ++ DH++
Sbjct: 694 NLSDISEGYNNLKQYFNDHFFKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDHLK 753

Query: 739 QNRTLLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLSNKFKDDTTESLNSL 798
            N+TL+M +L++ATTE I +EM  FEP RK WE+SF+ IN CDS+SN F  D   +L+ +
Sbjct: 754 DNKTLMMKSLQSATTEAIDKEMQLFEPQRKKWEESFDLINNCDSISNGFNGDMRSALSDI 813

Query: 799 KSHMESTVRESSLIADKIKDNLCHFQDRNDIANMTTNINGTVDDIKNKHSVLRDELEKNV 858
           KS   S+    S    K+KD +  ++D + I +    +   + DI NK S LR+ L K++
Sbjct: 814 KSTFGSSTDVISRSVSKVKDEVKGYEDASTILDGNEVVKRQIADIINKDSSLRNGLYKSI 873

Query: 859 SFIHASSEG-FKAIDSSLKRIMNFRMPEGKTETLADDLIKHIDSSSVAPVA-SSGKTPLR 916
                SS+G   A D   +RI N    E    TL  + I     ++  P+  +S ++PL+
Sbjct: 874 K----SSQGHISAFDELKERIRNTIASE--NSTLHQNKI-----ATTPPLGQNSERSPLK 922

Query: 917 P 917
           P
Sbjct: 923 P 923

 Score =  289 bits (740), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 168/187 (89%), Gaps = 2/187 (1%)

Query: 2   SATNGSPEGDELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITAR 61
           S   G  + +ELNITVAVR RGRNE+EI+AKSSVVV+ PDV+G++EV+INT+ D+GITA+
Sbjct: 4   SPAGGGEDAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQ 63

Query: 62  MNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEK 121
           MNSKTY VDKVFGPSA+Q L+FKEIA+P+F DF+KGYNCT+LVYGMTSTGKTYTMTGDEK
Sbjct: 64  MNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEK 123

Query: 122 LYDGELSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNS 181
           LY+ ELS++AGIIPR+LFKLF+TL++++ DY+VKCSF+ELYNEELKDLLDD  ++  ++ 
Sbjct: 124 LYNDELSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVEN--SSM 181

Query: 182 RKLRIYD 188
           RKLRIYD
Sbjct: 182 RKLRIYD 188

>YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}
           CIN8Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 1000

 Score =  598 bits (1541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/656 (48%), Positives = 456/656 (69%), Gaps = 9/656 (1%)

Query: 263 NEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNF 322
           N+Q++ IYIQ+LQEFHIT+A EGL LLQKGL HRQVASTKMND SSRSHTIFT+TLYK  
Sbjct: 310 NDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 369

Query: 323 NGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPF 382
             E FR+SK+NLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L DK+ HIPF
Sbjct: 370 QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPF 429

Query: 383 RESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMK 442
           RESKLTRLLQDSLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQLGSF+MK
Sbjct: 430 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSFIMK 489

Query: 443 DILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSS 502
           DILVKNI+ ELAK+KSD LSTKSKEGIYMS  HY  + +D+E+YK E+QE +REIE L+S
Sbjct: 490 DILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKREIESLTS 549

Query: 503 QNQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRN 562
           +N LL KDK  S++TI+SQ  QI +L++++D+L  ++D +HK EIE+++   KL+     
Sbjct: 550 KNALLVKDKLKSKETIQSQNCQIESLKTTIDHLRAQLDKQHKTEIEISDFNNKLQKLTEV 609

Query: 563 MQGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQALEQSFTIDDDINNVK 622
           MQ AL  ++  E  L    +  +   I + +  +  +L+ ++Q+++ Q   I  +++ +K
Sbjct: 610 MQMALHDYKKRELDLNQKFEMHITKEIKKLKSTLFLQLNTMQQESILQETNIQPNLDMIK 669

Query: 623 DSLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKEGLSQ 682
           + + TL+ T+++ A +M ++  +K++ + PKFFN ++ +++ +     +    + E LS 
Sbjct: 670 NEVLTLMRTMQEKAELMYKDCVKKILNESPKFFNVVIEKIDIIRVDFQKFYKNIAENLSD 729

Query: 683 ITAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKHLMSKITNIISDHVEQNRT 742
           I+ ENNN+K YL  HFF+NNHQE+LN H D TY  +   +   +     +++DH+++N+ 
Sbjct: 730 ISEENNNMKQYLKNHFFKNNHQELLNRHVDSTYENIEKRTNEFVENFKKVLNDHLDENKK 789

Query: 743 LLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLSNKFKDDTTESLNSLKSHM 802
           L+M  L TAT+ VI QEM  FEP R  WE SF+ IN CDS++N+F +    +L+ +KS +
Sbjct: 790 LIMQNLTTATSAVIDQEMDLFEPKRVKWENSFDLINDCDSMNNEFYNSMAATLSQIKSTV 849

Query: 803 ESTVRESSLIADKIKDNLCHFQDRNDIANMTTNINGTVDDIKNKHSVLRDELEKNVSFIH 862
           +++    +     +K  +   ++   +    T  N   + + NKH++L+D ++ +++  H
Sbjct: 850 DTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFEQLINKHNMLKDNIKNSITSTH 909

Query: 863 ASSEGFKAIDSSLKRIM-NFRMPEGKTETLADDLIKHIDSSSVAPVAS-SGKTPLR 916
           +       I ++++ IM N+   E  T+   D++I++I    +  + + S K PLR
Sbjct: 910 SHITNVDDIYNTIENIMKNYGNKENATK---DEMIENI----LKEIPNLSKKMPLR 958

 Score =  299 bits (766), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 156/184 (84%), Gaps = 6/184 (3%)

Query: 11  DELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVD 70
           +ELNITVAVRCRGRNE+EI  KSSVVVN PD+ G+ E+SINT+GD GITA+MN+K YTVD
Sbjct: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVD 92

Query: 71  KVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSEA 130
           KVFGP A Q L+F E+A P+F DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLY+GELS+A
Sbjct: 93  KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 152

Query: 131 AGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNS------RKL 184
           AGIIPRVL KLFDTLE+Q++DY+VKCSFIELYNEELKDLLD   +   N        +KL
Sbjct: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDSNSNGSSNTGFDGQFMKKL 212

Query: 185 RIYD 188
           RI+D
Sbjct: 213 RIFD 216

>Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON}
           YEL061C (REAL)
          Length = 1002

 Score =  594 bits (1532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/624 (50%), Positives = 444/624 (71%), Gaps = 12/624 (1%)

Query: 263 NEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNF 322
           N+QS+ IYIQ+LQEFHIT+A EGL+LLQKGL HRQVASTKMND SSRSHTIFT+TLYK  
Sbjct: 312 NDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 371

Query: 323 NGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPF 382
             E FR+SK+NLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L DK+ HIPF
Sbjct: 372 QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPF 431

Query: 383 RESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMK 442
           RESKLTRLLQDSLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQLG+F+MK
Sbjct: 432 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMK 491

Query: 443 DILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSS 502
           DILVKNI+ ELAK+KSD LSTKSKEGIYM+  HY  + +D+E+YK E+QE +REIE L+S
Sbjct: 492 DILVKNITMELAKIKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNEVQECKREIESLTS 551

Query: 503 QNQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRN 562
           +N LL K+K  S++TI+SQ  QI +L++++D+L  ++D +HK E+E++    KL+     
Sbjct: 552 KNSLLVKEKLKSKETIQSQNSQIESLKATIDHLRTQLDKQHKTELEISGFNSKLQKLTEV 611

Query: 563 MQGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQALEQSFTIDDDINNVK 622
           MQ AL+ ++  E  L    +  +   I   +  + ++L  L+Q+ + Q   I  +++ +K
Sbjct: 612 MQMALQDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTLQQRNILQETDIQPNLDIIK 671

Query: 623 DSLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKEGLSQ 682
           + + TL+ET+++ A +M ++  +K++ + PKFFN+++ +++ +    +     + E LS 
Sbjct: 672 NEVLTLMETMQEKAELMYKDCVKKILNESPKFFNAIVEKIDIIGVDFERFYKNIAENLSD 731

Query: 683 ITAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKHLMSKITNIISDHVEQNRT 742
           I+ ENNNLK Y   HFFRNNHQE+L+ H D TY ++   +   +      ++DH+E+N+ 
Sbjct: 732 ISEENNNLKQYFTNHFFRNNHQELLSHHVDSTYEKIEKKTNQFVENFKKALNDHLEENKK 791

Query: 743 LLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLSNKFKDDTTESLNSLKSHM 802
           L+M  L T T+ VI QEMS FEP R  WE SF+ IN CDS++N+F +    +L+ +KS +
Sbjct: 792 LIMKNLTTTTSAVIDQEMSLFEPKRVKWEHSFDLINECDSMNNEFYNSMATTLSQIKSTV 851

Query: 803 ESTV----RESSLIADKIKDNLCHFQDRNDIANMTTNI--NGTVDDIKNKHSVLRDELEK 856
           +++     +  S++  +++++       N I+ +  NI  N     + NKH++L+D +E 
Sbjct: 852 DTSSNSMNKSISVMKGQVEES------ENAISLLKNNIKFNDQFKQLINKHTILKDNIES 905

Query: 857 NVSFIHASSEGFKAIDSSLKRIMN 880
           +++  ++       I +++++IMN
Sbjct: 906 SITSTNSHITNIDDIYNTIEKIMN 929

 Score =  295 bits (755), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 158/186 (84%), Gaps = 10/186 (5%)

Query: 11  DELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVD 70
           +ELNITVAVRCRGRNE+EI  KSSVVVN PD+ G+ E+SINT+GD GITA+MN+K YTVD
Sbjct: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVD 92

Query: 71  KVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSEA 130
           KVFGP A Q L+F E+A P+F DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLY+GELS++
Sbjct: 93  KVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDS 152

Query: 131 AGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLD--------DGQDSGGNNSR 182
           AGIIPRVL KLFDTLE+Q++DY+VKCSFIELYNEELKDLLD        +G D  G   +
Sbjct: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNSSSNNGFD--GQFMK 210

Query: 183 KLRIYD 188
           KLRI+D
Sbjct: 211 KLRIFD 216

>Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON}
           YEL061C (REAL)
          Length = 998

 Score =  586 bits (1511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/656 (48%), Positives = 449/656 (68%), Gaps = 9/656 (1%)

Query: 263 NEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNF 322
           N+QS+ IYIQ+LQEFHIT+A EGL LLQ+GL HRQVASTKMND SSRSHTIFT+TLYK  
Sbjct: 308 NDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 367

Query: 323 NGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPF 382
             E FR+SK+NLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L D++ HIPF
Sbjct: 368 QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPF 427

Query: 383 RESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMK 442
           RESKLTRLLQDSLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQLG+FMMK
Sbjct: 428 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMK 487

Query: 443 DILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSS 502
           DILVKNI+ ELAK+KSD LSTKSKEGIYMS  HY  + +D+E++K E+QE +REIE L+S
Sbjct: 488 DILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLAS 547

Query: 503 QNQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRN 562
           +N LL KDK  S++TI+SQ  Q+ +L++++++L  ++D +HK E+E++    KL+     
Sbjct: 548 KNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEV 607

Query: 563 MQGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQALEQSFTIDDDINNVK 622
           MQ AL+ ++  E  L    +  +   I   +  +  +LDN++Q+ + Q   I  +++ VK
Sbjct: 608 MQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVK 667

Query: 623 DSLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKEGLSQ 682
           + + TL+ET+++ A +M ++  +K++ + PKFFN ++ +++ +  +       + E LS 
Sbjct: 668 NEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSD 727

Query: 683 ITAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKHLMSKITNIISDHVEQNRT 742
           I+ ENNNLK YL  HFF+NNHQE+LN H D TY  +   +   +      ++DH+E+N+ 
Sbjct: 728 ISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKK 787

Query: 743 LLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLSNKFKDDTTESLNSLKSHM 802
           L+M  +  AT+ VI QEM  FEP R  WE SF+ IN CDS++N+F ++   +L+ +K  +
Sbjct: 788 LIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTV 847

Query: 803 ESTVRESSLIADKIKDNLCHFQDRNDIANMTTNINGTVDDIKNKHSVLRDELEKNVSFIH 862
           +++    +     +K  +   ++   +    T  N     + +KH +L+D +E +++  H
Sbjct: 848 DTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKDNIESSITSTH 907

Query: 863 ASSEGFKAIDSSLKRIM-NFRMPEGKT-ETLADDLIKHIDSSSVAPVASSGKTPLR 916
           +       I ++++ IM N    E  T + + D+++K I +        S + PLR
Sbjct: 908 SHITNVDDIYNTIEDIMTNHGNKENATKDEMIDNILKEIPN-------LSKRLPLR 956

 Score =  296 bits (759), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 137/188 (72%), Positives = 159/188 (84%), Gaps = 6/188 (3%)

Query: 7   SPEGDELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKT 66
           S   +ELNITVAVRCRGRNE+EI  KSSVVVN PD+ G+ EVSINT+GD GITA+MN+K 
Sbjct: 31  SVPNEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKR 90

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           YTVDKVFGP A Q L+F+E+A P+F DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLY+GE
Sbjct: 91  YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 150

Query: 127 LSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDS------GGNN 180
           L++AAGIIPRVL KLFDTLE+Q+SDY+VKCSFIELYNEELKDLLD+  +        G  
Sbjct: 151 LNDAAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEELKDLLDNNSNGSSNNGFDGQF 210

Query: 181 SRKLRIYD 188
            +KLRI+D
Sbjct: 211 MKKLRIFD 218

>Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON}
           YEL061C (REAL)
          Length = 999

 Score =  569 bits (1466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/656 (48%), Positives = 447/656 (68%), Gaps = 9/656 (1%)

Query: 263 NEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNF 322
           N+QS+ IYIQ+LQEFHIT+A EGL LLQ+GL HRQVASTKMND SSRSHTIFT+TLYK  
Sbjct: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 368

Query: 323 NGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPF 382
             E FR+SK+NLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+LADK+ HIPF
Sbjct: 369 QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPF 428

Query: 383 RESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMK 442
           RESKLTRLLQDSLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQLG+F+MK
Sbjct: 429 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMK 488

Query: 443 DILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSS 502
           DILVKNI+ ELAK+KSD LSTKSKEGIYMS  HY  + +D+E+YK E+QE +R+IE LSS
Sbjct: 489 DILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIESLSS 548

Query: 503 QNQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRN 562
           +N LL KDK  S+DTI+SQ  Q+ +L+ +++ L  ++D +HK E+E++    KL+     
Sbjct: 549 KNSLLLKDKLKSKDTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEI 608

Query: 563 MQGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQALEQSFTIDDDINNVK 622
           MQ AL+ ++  E  L    +  +   I   +  + ++L  ++Q  + Q   I  +++ +K
Sbjct: 609 MQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIK 668

Query: 623 DSLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKEGLSQ 682
           + + TL+ET+++ A +M ++  +K++ + PKFFN ++ +++ +        + + E LS 
Sbjct: 669 NEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSD 728

Query: 683 ITAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKHLMSKITNIISDHVEQNRT 742
           I+ ENNNLK YL  HFF+NNHQE+LN H D TY  +   +   +    N ++DH+E+N+ 
Sbjct: 729 ISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKK 788

Query: 743 LLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLSNKFKDDTTESLNSLKSHM 802
           L+M  L  AT+ VI QEM  FEP R  WE SF+ IN CDS++N+F ++   +L+ +K+ +
Sbjct: 789 LIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTV 848

Query: 803 ESTVRESSLIADKIKDNLCHFQDRNDIANMTTNINGTVDDIKNKHSVLRDELEKNVSFIH 862
           +++    +     +K  +   ++   +       N     + NKH++L+D +E +++  H
Sbjct: 849 DTSSNSMNKSISVMKGQVEESENAVSLLKNNKKFNDQFKQLVNKHTILKDNIENSITSTH 908

Query: 863 ASSEGFKAIDSSLKRIM-NFRMPEGKTET-LADDLIKHIDSSSVAPVASSGKTPLR 916
           +       I  +++ IM N+   E   +  + D+++K I S        S + PLR
Sbjct: 909 SHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIPS-------LSKRVPLR 957

 Score =  296 bits (757), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 138/192 (71%), Positives = 161/192 (83%), Gaps = 7/192 (3%)

Query: 3   ATNGSPEGDELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARM 62
             +G P  +ELNITVAVRCRGRNE+EI  KSSVVVN PD+ G+ EVSINT+GD GITA+M
Sbjct: 26  GCHGVP-NEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQM 84

Query: 63  NSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKL 122
           N+K YTVDKVFGP A Q L+F E+A P+F DFIKGYNCT+LVYGMTSTGKTYTMTGDEKL
Sbjct: 85  NAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKL 144

Query: 123 YDGELSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSG----- 177
           Y+GELS+AAGIIPRVL KLFDTLE+Q++DY+VKCSFIELYNEELKDLLD+  ++      
Sbjct: 145 YNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNNSSNNGF 204

Query: 178 -GNNSRKLRIYD 188
            G   +KLRI+D
Sbjct: 205 EGPFMKKLRIFD 216

>Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON}
           (9109..12123) [3015 nt, 1005 aa]
          Length = 1004

 Score =  547 bits (1409), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 284/615 (46%), Positives = 432/615 (70%), Gaps = 6/615 (0%)

Query: 264 EQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFN 323
           ++ + IYIQ+L+EFHIT AKEG+ LLQ+GL +RQVASTKMND SSRSHTIFT+ LYK  +
Sbjct: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHD 357

Query: 324 GETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFR 383
           G+ FR+SK+NLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKN HIPFR
Sbjct: 358 GKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFR 417

Query: 384 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMKD 443
           ESKLTRLLQDSLGGNTKTALIATISPAK+NSEET STLEYA KAK+IKNKPQLGS + KD
Sbjct: 418 ESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITKD 477

Query: 444 ILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSSQ 503
           ILVKNI+ ELAK+K+D LSTKS++G+YMS +HY E+ ND+E+YKTE+QE +R I+ L++Q
Sbjct: 478 ILVKNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLTTQ 537

Query: 504 NQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRNM 563
           N LL KDKK+S +    Q++++++++ S+ +L++ I+ +H+ E  L ++I+KLK     M
Sbjct: 538 NGLLLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSIEM 597

Query: 564 QGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQALEQSFTIDDDINNVKD 623
           Q  +K H + EQ  Q+ ++++  + +L  +  +   L+ + ++ +  +  +  +I  +KD
Sbjct: 598 QATIKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVINNTDLGMNIEKIKD 657

Query: 624 SLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKEGLSQI 683
            ++++++T + +A  + ++  ++++ + P    S+  ++  M    D + ++L   +S++
Sbjct: 658 EVKSIIDTTQAEANHVYKDCMEQLMKESPILLGSLNDDIIKMQKISDLYNEQLSISISEL 717

Query: 684 TAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKHLMSKITNIISDHVEQNRTL 743
             E+N+LK YL+  FF+++H+EILN H +KTY  +  +S  ++ ++   +  ++E++R +
Sbjct: 718 NIEHNDLKQYLNGSFFKSDHEEILNEHIEKTYDNIRRASTGIVEQLKTGLELYLEESRNI 777

Query: 744 LMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLSNKFKDDTTESLNSLKSHME 803
           ++D+LK  T++++  EM  F P +K WE SF  IN CDSL+NK+  D +  L+++K+ + 
Sbjct: 778 IIDSLKNTTSDIVKSEMELFAPKKKKWEDSFEMINKCDSLNNKYFGDISALLSNMKTSVT 837

Query: 804 STVRESSLIADKIKDNLCHFQDRNDIANMTTN---INGTVDDIKNKHSVLRDELEKNVSF 860
           ST   S L+ D +     +  + +    +T N   I     ++  K+S L   L ++++ 
Sbjct: 838 ST---SDLVDDHVSQMRKYTDNTSRSTKLTENSKRIGQQFTEMMEKNSKLESHLNESITM 894

Query: 861 IHASSEGFKAIDSSL 875
             +S   F  +  S+
Sbjct: 895 NESSINAFDKLSESI 909

 Score =  290 bits (741), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 132/179 (73%), Positives = 163/179 (91%), Gaps = 1/179 (0%)

Query: 10  GDELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTV 69
           GDELNI VAVRCRGRNE+EIKAKSSVVV+ PDV G++E++INT+ D+GI  +MNSKTYTV
Sbjct: 10  GDELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTV 69

Query: 70  DKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSE 129
           DKVFGPSA+Q L+F+E+A+P+F+DFI+GYNCT+LVYGMTSTGKTYTMTGDE+LY+GELS+
Sbjct: 70  DKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELSD 129

Query: 130 AAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKLRIYD 188
           +AGIIPRVLFKLFD +E Q  DY++KCSFIELYNEELKDLLD+ Q +  + ++KLRI+D
Sbjct: 130 SAGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQ-AINSTAKKLRIFD 187

>NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {ON}
           Anc_6.16
          Length = 1004

 Score =  546 bits (1406), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 281/543 (51%), Positives = 393/543 (72%), Gaps = 2/543 (0%)

Query: 263 NEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNF 322
           +E ++ IYIQ+LQEFHIT+AKEGL LLQKGL HRQVASTKMND SSRSHTIFT+TLYK  
Sbjct: 295 DENTNGIYIQNLQEFHITNAKEGLSLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKEH 354

Query: 323 NGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPF 382
               FR+SK+NLVDLAGSENI+RSGA NQRAKE GSINQSLLTLGRVINSLADK+ H+PF
Sbjct: 355 KDNLFRLSKMNLVDLAGSENINRSGAMNQRAKETGSINQSLLTLGRVINSLADKSPHVPF 414

Query: 383 RESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMK 442
           RESKLTRLLQDSLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQLGS ++K
Sbjct: 415 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSVILK 474

Query: 443 DILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSS 502
           DIL+KNI+ ELAK+KSD +STKSK+GIYMSH HY E++ ++E+ KTE+QES+R IEKLSS
Sbjct: 475 DILLKNITSELAKVKSDLMSTKSKDGIYMSHEHYQELIMELESSKTEVQESKRMIEKLSS 534

Query: 503 QNQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRN 562
           QN +L KDK+S+ +  E QR+++ NL+ SM  L EK+++++  E +L   I +L+ +   
Sbjct: 535 QNSMLLKDKRSANEVNELQRIKLNNLKDSMSNLNEKLEIQNGKETKLMEQIGQLEKSREK 594

Query: 563 MQGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQALEQSFTIDDDINNVK 622
           +   +K ++  + +L++ I  +L +N+ E ++ + +  D ++Q   E +F ++ ++  +K
Sbjct: 595 LNSLVKNYQTKQSQLKTQISNILNENLFELKKILNSHKDAIRQS--EGNFDVEMNLKVIK 652

Query: 623 DSLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKEGLSQ 682
           D + ++LE  +    +M +   ++ +   P     +   +  +   V  + + + E LS 
Sbjct: 653 DEITSMLEKTQHKTEMMYKEFIEEFLEQTPINLQKIFEHVTQVEFMVTGYYNEITENLSD 712

Query: 683 ITAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKHLMSKITNIISDHVEQNRT 742
           I+ E NNLK YLD  FF+NNH+++LN+H + T   L  SS  L +K   ++  H+ +N+ 
Sbjct: 713 ISEEYNNLKQYLDNDFFQNNHEDLLNIHINATSDILAQSSAELFNKFKIMMDAHLMENKK 772

Query: 743 LLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLSNKFKDDTTESLNSLKSHM 802
           L++D  +TAT +VIT+EM  F+P R  WE+S   IN CDS++N F  + T  ++ +K+++
Sbjct: 773 LMIDNFRTATNDVITKEMELFKPKRNKWEESIELINRCDSINNGFHHNMTGQVSKIKTNL 832

Query: 803 EST 805
            S+
Sbjct: 833 ASS 835

 Score =  279 bits (714), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 134/204 (65%), Positives = 161/204 (78%), Gaps = 16/204 (7%)

Query: 1   MSATNGSPEGD-ELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGIT 59
           ++ T   PE D ELNITVAVRCRGRNE+EI +KS VVV  PD+ GA E+SINT+G+ GIT
Sbjct: 16  LTTTREPPEEDTELNITVAVRCRGRNEREINSKSPVVVTVPDITGAQEISINTTGETGIT 75

Query: 60  ARMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGD 119
           A+MNSKTYTVDKVFGP+ADQ L+F+E+A+P+F DF+KGYNCT+LVYGMTSTGKTYTMTGD
Sbjct: 76  AQMNSKTYTVDKVFGPAADQDLIFQEVAEPLFRDFVKGYNCTVLVYGMTSTGKTYTMTGD 135

Query: 120 EKLYDGE--LSEAAGIIPRVLFKLFDTLEVQE--------SDYMVKCSFIELYNEELKDL 169
           EKLY     LS+AAGIIPR+LFKLFDTL+           +D++VKCSF+ELYNE+LKDL
Sbjct: 136 EKLYQNGTMLSDAAGIIPRILFKLFDTLDNHRHSDVTGSTTDFVVKCSFVELYNEDLKDL 195

Query: 170 LD-DGQDSGGN----NSRKLRIYD 188
           L+ D  D         SRKLRI+D
Sbjct: 196 LNYDSNDEQQQQQQLGSRKLRIFD 219

>NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {ON}
            Anc_6.16
          Length = 1069

 Score =  535 bits (1379), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 298/663 (44%), Positives = 438/663 (66%), Gaps = 13/663 (1%)

Query: 264  EQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFN 323
            + ++ IYIQ+LQEFHI++AKEGL LLQKGL +RQVASTKMND SSRSHTIFT+TLYK   
Sbjct: 342  DNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQ 401

Query: 324  GETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFR 383
            G  FR+SK+NLVDLAGSENI+RSGA NQRAKE GSINQSLLTLGRVINSLAD+N HIPFR
Sbjct: 402  GTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHIPFR 461

Query: 384  ESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMKD 443
            ESKLTRLLQDSLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQLGS + KD
Sbjct: 462  ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSIISKD 521

Query: 444  ILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSSQ 503
            IL+KNI+ EL+++KSD LSTKSKEGIYMS  HY ++MN+++N+KTE  ES+R IE+LSSQ
Sbjct: 522  ILLKNITTELSQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNHKTEADESKRIIERLSSQ 581

Query: 504  NQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRNM 563
            N LL KDK++S +  E QR+++   Q S++ L EKI++++  E  L + + KL+ +    
Sbjct: 582  NALLLKDKRTSNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQMLVSSVSKLQTSCDTF 641

Query: 564  QGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQALEQSFTIDDDINNVKD 623
            +  ++ +E  +  ++S I+++L D++L  R  ++   + +K       F I  +++ +++
Sbjct: 642  KKMIENYECQQIDVKSKIEQILEDDLLSLRNLLQDHQNKIKTLNSGTDFDIGSNLDMIQN 701

Query: 624  SLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKEGLSQI 683
             +  +L T ++ A    +   +  +   P+ F  +  ++ND+  K+  H   + + LS I
Sbjct: 702  EVIKMLGTTQEKAEKTYKQFIEGFLKQTPENFKKIGEDINDINIKIQNHHAAVAQNLSDI 761

Query: 684  TAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKHLMSKITNIISDHVEQNRTL 743
            + E NNLK YL+ + F+NNH++++N H + T   L  S+  L +   ++++ H+E NR L
Sbjct: 762  SEEYNNLKQYLNENLFQNNHEDLINAHINSTSQTLTNSADVLFNTFKDMMNKHLESNRNL 821

Query: 744  LMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLSNKFKDDTTESLNSLKSHME 803
            ++++ K AT EVI +EM  F P +K WE+S + IN CDSL+N F+ + T+ L+  +S + 
Sbjct: 822  MLNSFKAATDEVINKEMELFIPRKKKWEESIDLINQCDSLNNGFQKEVTDGLSYTRSKIT 881

Query: 804  STVRESSLIADKIKDNLCHFQDRNDIANMTTN--------INGTVDDIKNKHSVLRDELE 855
            +++ +    + ++K  +    D     ++ T         I    +++  K+S+ +D +E
Sbjct: 882  ASINQMYDNSTRLKTEMS--ADNGGYNSINTKNVVEDNQIIRTQFNELARKNSIFQDNVE 939

Query: 856  KNVSFIHASSEGFKAIDSSLK-RIMNFRMPEGKTETLADDLIKHIDSSSVAPVASSGKTP 914
             ++    AS      ++ S+K  + + R+  G TE       K  ++    P    G  P
Sbjct: 940  NSLKCAVASVNNLNHLEDSIKMAVRDTRIKGGPTEGEVGVPFKK-ENGKEGPTK-PGLQP 997

Query: 915  LRP 917
            L+P
Sbjct: 998  LQP 1000

 Score =  294 bits (752), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 129/160 (80%), Positives = 150/160 (93%)

Query: 13  LNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVDKV 72
           LNITVAVRCRGRNE+EIK KSSV+V  PD+ G+NEVSINT+ D+GITA+MNSKTYTVDKV
Sbjct: 52  LNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYTVDKV 111

Query: 73  FGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSEAAG 132
           FGPSA+Q L+F E+A+P+F DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLY+GELSE+AG
Sbjct: 112 FGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSESAG 171

Query: 133 IIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDD 172
           IIPR+LFKLFDTLE+ + DY+VKCSFIELYNE+LKDLL+D
Sbjct: 172 IIPRILFKLFDTLEMNQEDYVVKCSFIELYNEDLKDLLND 211

>KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16
           YEL061C
          Length = 963

 Score =  518 bits (1335), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 294/622 (47%), Positives = 408/622 (65%), Gaps = 18/622 (2%)

Query: 264 EQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFN 323
           +Q++ IYIQ+LQEFHIT AKEG++LLQKGL +RQVASTKMND SSRSHTIFT+TL+K   
Sbjct: 285 DQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVK 344

Query: 324 GETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFR 383
           GE FR+SK+NLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVINSLADKN H+PFR
Sbjct: 345 GEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFR 404

Query: 384 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMKD 443
           ESKLTRLLQDSLGGNTKTALIATISPAK+  EET STLEYA+KAKNIKNKPQLGSF+MKD
Sbjct: 405 ESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKD 464

Query: 444 ILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSSQ 503
           IL+KNI+ EL K+KSD LSTKSK+GIYM   HY E+  D++NYKTEIQE +R IE L+SQ
Sbjct: 465 ILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQ 524

Query: 504 NQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRNM 563
           N LL KDK++  +  E QR++I+ +  SM  LY KI+ +   E EL   I         +
Sbjct: 525 NALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKL 584

Query: 564 QGALKTHEDHEQRLQSDIQKMLYDNILEY-RRKIETKLDNLKQQALEQSFTIDDDINNVK 622
              +   ++ E  + S   K L D+ L Y  +K+  +++N K Q + Q+FT+D+++  +K
Sbjct: 585 TKIIDEMKNREALVNSKF-KTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIK 643

Query: 623 DSLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKEGLSQ 682
             +  LL T + +     +    K + D P  F+ +   + ++ +    +  ++ E LS 
Sbjct: 644 SEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSD 703

Query: 683 ITAENNNLKAYLDTHFF---RNNHQEILNVHADKTYHQLNLSSKHLMSKITNIISDHVEQ 739
           ++ E NN K ++   F+   + +  E+LN + + T   +  SS  +MS I N++++H+  
Sbjct: 704 LSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRA 763

Query: 740 NRTLLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLSNKFKDDTTESLNSLK 799
           N+ L++++L   TTE+++ E+   +P    WE+S   IN  D+L+N+F D+   S+ ++ 
Sbjct: 764 NKELIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMT 823

Query: 800 SHMESTVRESSLIADKIKDNLCHFQDRNDIANMTTNINGTVDD---IKNKHSVLRDELEK 856
             ++ T   +  I + IK    HF+  NDIA+     N  +DD   IKN    +    EK
Sbjct: 824 DKIKQT---NDSINNNIKKINEHFK-TNDIAHSN---NLMIDDNNIIKNNFKSIE---EK 873

Query: 857 NVSFIHASSEGFKAIDSSLKRI 878
           N        EG+   + S+K++
Sbjct: 874 NSRLHEFVKEGYLVTNESMKKL 895

 Score =  297 bits (760), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 134/186 (72%), Positives = 161/186 (86%)

Query: 3   ATNGSPEGDELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARM 62
           +++  P+ +ELNITVAVRCRGRN++EI AKSSVVV  PD++G+ EV+INTS DIG TA+M
Sbjct: 7   SSDKQPQEEELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQM 66

Query: 63  NSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKL 122
           NSKTYTVDKVFGPSA QSL+F EIA+P+F DFIKGYNCTMLVYGMTSTGKTYTMTGDEKL
Sbjct: 67  NSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKL 126

Query: 123 YDGELSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSR 182
           Y+ ELS++AGIIPR+LFKLF+TLE    D++VKCSF+ELYNEELKDLL    ++   N +
Sbjct: 127 YNEELSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGNFK 186

Query: 183 KLRIYD 188
           KLRI+D
Sbjct: 187 KLRIFD 192

>CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} similar
           to uniprot|P27895 Saccharomyces cerevisiae YEL061c CIN8
           Kinesin-like protein
          Length = 988

 Score =  499 bits (1286), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 263/524 (50%), Positives = 364/524 (69%)

Query: 264 EQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFN 323
           +QS++IYIQ+L+EFHIT A EGL+LLQKGL  RQVASTKMND SSRSH+IFT+TLYK  N
Sbjct: 304 DQSASIYIQNLEEFHITSAMEGLQLLQKGLKQRQVASTKMNDFSSRSHSIFTITLYKEQN 363

Query: 324 GETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFR 383
           GE FRVSK+NLVDLAGSENISRSGA NQRAKEAGSINQSLLTLGRVINSLADK+ HIPFR
Sbjct: 364 GELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIPFR 423

Query: 384 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMKD 443
           ESKLTRLLQDSLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQLG+F+MKD
Sbjct: 424 ESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 483

Query: 444 ILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSSQ 503
           ILV++I+ ELAK+KSD LSTKSKEG+YMSH HY ++  DIE YKTE++ES+R IE L++Q
Sbjct: 484 ILVRSITSELAKIKSDLLSTKSKEGVYMSHEHYKDLHYDIECYKTELEESKRAIESLTAQ 543

Query: 504 NQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRNM 563
           N +L +++ S +D     +  I +L+ ++  L   +  +   E  + +++  ++ A   M
Sbjct: 544 NAMLQQERLSLKDDNACYKANIASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGANEEM 603

Query: 564 QGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQALEQSFTIDDDINNVKD 623
           +  +   E  +Q LQ  I   + D I   R  ++  ++ L+     +   I  ++  ++ 
Sbjct: 604 KKTIHLFEFKQQELQQSISTFISDEISNIRDTLKKHIEYLQNNGDLKDTEISGNLMRLEK 663

Query: 624 SLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKEGLSQI 683
            +  +++  +++A        + ++ + P+ F S+   L+++    +E+  ++ E LS +
Sbjct: 664 EVVKVIKAAEEEASKSYGECVKMMLKETPRLFESVSGRLDNISKLAEENHSKIAETLSDV 723

Query: 684 TAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKHLMSKITNIISDHVEQNRTL 743
           + E NNLK YL  +FF+NNH+E+L+ H   TY QL  +S  LM   T ++  H+++N+  
Sbjct: 724 SEEYNNLKQYLTNNFFKNNHEELLSHHVQNTYAQLEENSAQLMQNFTMMLDKHIQENKRH 783

Query: 744 LMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLSNKF 787
           +++ +   T EVI  E+  F   R  WE+S   IN CDS+++ F
Sbjct: 784 MLENILGVTDEVINNELQMFGEQRAKWEKSSALINQCDSVNHSF 827

 Score =  295 bits (756), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 133/178 (74%), Positives = 157/178 (88%)

Query: 11  DELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVD 70
           +ELNI VAVRCRGRNE+EIKAKSSVVV+ PD    NEVSINT+ D+GI A+MNSKTYTVD
Sbjct: 30  EELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVD 89

Query: 71  KVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSEA 130
           KVFGPSA Q LV++EIA+P+F DFIKGYNCT+LVYGMTSTGKTYTMTGDEKL++GEL +A
Sbjct: 90  KVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGDA 149

Query: 131 AGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKLRIYD 188
           AGIIPRVLF+LFDTLE  + DY+VKCSF+ELYNEELKDLLD    +  ++++KLRI+D
Sbjct: 150 AGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTNTATNSDNKKLRIFD 207

>KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6.16
           YEL061C
          Length = 950

 Score =  472 bits (1215), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 270/657 (41%), Positives = 409/657 (62%), Gaps = 17/657 (2%)

Query: 267 SAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGET 326
           + IYIQ+L++FHI+ AKEGL+LLQ+GL  RQVA+TK+NDVSSRSHTIFT+TLYK F  + 
Sbjct: 268 TGIYIQNLKDFHISTAKEGLQLLQRGLQRRQVATTKLNDVSSRSHTIFTITLYKKFKDDL 327

Query: 327 FRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESK 386
           +R+SKINLVDLAGSEN++++GA N RAKE+GSINQSLLTLGRVINSLADK+AHIPFRESK
Sbjct: 328 YRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKSAHIPFRESK 387

Query: 387 LTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMKDILV 446
           LTRLLQDSLGGNTKT LIATISPAKI +EET STLEYA+KAKNIKNKPQLGSF++KDIL+
Sbjct: 388 LTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQLGSFIIKDILL 447

Query: 447 KNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSSQNQL 506
           K++S EL K+++D   TKSKEGIY+S  +Y E+++D++N+KTE+ E +R  + L  +N+L
Sbjct: 448 KDVSQELIKMRADLWCTKSKEGIYVSQKNYKEMVDDLDNFKTELTELKRTNDSLVQENEL 507

Query: 507 LHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRNMQGA 566
           L K+KKS  +  +S + ++ NL+S +  +  K+   +    +L+  +  +      ++  
Sbjct: 508 LGKEKKSGAERADSLKSELDNLRSQLKSVTNKLAQTNTQNTKLSEQVTDMNRIQTELKSL 567

Query: 567 LKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQALEQSFTIDDDINNVKDSLE 626
           ++ ++   +  +   Q++L D +     KI ++ D LK      ++ I   I++++  + 
Sbjct: 568 IEVYQQKHETSKHKFQRLLKDELATLTAKILSQWDTLK-NVNSGNYQIHTHIDSIRGEVM 626

Query: 627 TLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKEGLSQITAE 686
            LLET K++A  + ++    ++ + PK F  +   + D+    +EH   +    S ++ E
Sbjct: 627 NLLETTKENAETLYKSCIDDLLKETPKIFQLISDNVGDIRGMTEEHYTEMARNFSDLSEE 686

Query: 687 NNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKHLMSKITNIISDHVEQNRTLLMD 746
            N  K YLD  FF+NNH E++  H D     +   S  L+  + N I +++  N  ++ +
Sbjct: 687 FNTFKQYLDGQFFQNNHIEMIQTHQDIVASNMQKMSDDLLQSVQNSIQNYLSTNAQMVTN 746

Query: 747 TLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLSNKFKDDTTESLNSLKSHM---- 802
           ++     +VI +EM  F P +  WE+S + IN  DSLSNKF+++ T+S++ + S +    
Sbjct: 747 SINDVAMDVINKEMDLFAPKKSKWEESIDLINQSDSLSNKFRNNMTKSVDDIASVIRNSN 806

Query: 803 ESTVRESSLIADKIKDNLCHFQDRNDIANMTTNINGTVDDIKNK--HSVLRDELEKNVSF 860
           ES  R  S I   I +N  + Q++ +   + TN    + +  N   H V  D        
Sbjct: 807 ESMDRSISTIKKHIIENDINSQEQINSNELLTNSFKAIQEKSNNILHLVTGDL----TVT 862

Query: 861 IHASSEGFKAIDSSLKRIMNFRMPEGKTETLADDLIKHIDSSSVAPVASSGKTPLRP 917
              S +G + +D S++ +++       T+ +      HI   +  P   S   PL+P
Sbjct: 863 AQESMDGIQNLDRSIRTLIHGDQYIHSTKGV------HIPPQNRGPELHSTLIPLKP 913

 Score =  233 bits (593), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 117/194 (60%), Positives = 150/194 (77%), Gaps = 17/194 (8%)

Query: 9   EGDELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYT 68
           E D++NITVAVRCRGRN++EI+AKS +VV  PDV    EVSINTSG  GI A++ +KTYT
Sbjct: 21  EKDDINITVAVRCRGRNKREIEAKSPIVVTVPDVTTTPEVSINTSGGSGIEAQLQAKTYT 80

Query: 69  VDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKL-YDGEL 127
           VDKV+GP + Q LVF++ A+P+FHDF++GYNCTMLVYGMTSTGKTYTMTGD ++  +G++
Sbjct: 81  VDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEGDV 140

Query: 128 SEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQD--SGG------- 178
           +  AGI PR+L KLF+ L   + DY+VKCSF+ELYNE+L+DLL +GQD  S G       
Sbjct: 141 NGQAGIAPRILVKLFECL---QDDYVVKCSFVELYNEDLRDLLSEGQDDFSNGTENSSKQ 197

Query: 179 ----NNSRKLRIYD 188
               N S+KLRI+D
Sbjct: 198 PESLNASKKLRIFD 211

>TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16
           YEL061C
          Length = 939

 Score =  469 bits (1206), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 257/590 (43%), Positives = 382/590 (64%)

Query: 266 SSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGE 325
           +++IYIQ+L+EFHI +A+EG++LLQKGL +RQVASTKMNDVSSRSHTIFT+ LYK   GE
Sbjct: 235 NASIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGE 294

Query: 326 TFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRES 385
            F++SK+NLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINS+ADKN HIPFRES
Sbjct: 295 IFKISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRES 354

Query: 386 KLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMKDIL 445
           KLTRLLQDSLGGNTKTALIATISPAK+N+EET STLEYATKAK+IKNKPQLGS +MKD+ 
Sbjct: 355 KLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDVR 414

Query: 446 VKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSSQNQ 505
           +K++++ELAK+K D  STK K+G+YM+  HY ++ ND+E+YKTEIQE  R ++ L  QN 
Sbjct: 415 LKDLNNELAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDRIVKSLELQNA 474

Query: 506 LLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRNMQG 565
           LL KDKK+S +  + Q L +  + +++  +   ++++HK E  L   +   ++    M+ 
Sbjct: 475 LLLKDKKASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQILVEELAHSREKSLKMKT 534

Query: 566 ALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQALEQSFTIDDDINNVKDSL 625
            +K + + E+R+QS+++ +  D +++ +  +   L+ + ++ L     + D+I  +KD +
Sbjct: 535 VIKEYSEKEERIQSNMKSIFNDELIKLKELLIENLNGIAKENLIVQTNVKDNIKLIKDDV 594

Query: 626 ETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKEGLSQITA 685
            +++   ++ +  +    +Q+++ + P       S++       + +   L E L  I  
Sbjct: 595 ISIVTESQELSKKLFLEFSQQIIKETPLILEMFSSDVKKNQELNETYFANLFENLESIKQ 654

Query: 686 ENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKHLMSKITNIISDHVEQNRTLLM 745
           + + L  Y    FF++NH  I+N H + T   +  S   +  +    +    EQN  L++
Sbjct: 655 QYSKLNEYFSNDFFKSNHVTIVNDHVNTTKAIIEKSVSDIFKQFQQNMEAFAEQNEKLIL 714

Query: 746 DTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLSNKFKDDTTESLNSLKSHMEST 805
           + LKT ++++I  EM+ F+  +  W+ SF  IN CD L+N + D     L ++K  ++S+
Sbjct: 715 ENLKTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNSYHDQMHTYLRNMKGKLQSS 774

Query: 806 VRESSLIADKIKDNLCHFQDRNDIANMTTNINGTVDDIKNKHSVLRDELE 855
                   ++IK N+        + N    I    + I +K   L D L+
Sbjct: 775 DEIIKKHMNQIKSNVDSLNSTPKLLNTDRAIGDNYNQIISKRDKLHDHLQ 824

 Score =  288 bits (738), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 161/180 (89%), Gaps = 5/180 (2%)

Query: 11  DELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDI--GITARMNSKTYT 68
           DE+NI VAVRCRGRN++EIK+KSSV+V+ PDV+G+NE+SINTS DI  G+TA++NSKTYT
Sbjct: 13  DEMNIMVAVRCRGRNKREIKSKSSVIVSVPDVMGSNEISINTSDDIVSGLTAQLNSKTYT 72

Query: 69  VDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELS 128
           VDKVFGPSA+Q L+F+EIA+P+F+DF++GYNCT+LVYGMTSTGKTYTMTGDEKLY G+LS
Sbjct: 73  VDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGDLS 132

Query: 129 EAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKLRIYD 188
           ++AGIIPRVLFKLF+T+E Q  +Y++KCSFIELYNEELKDLL    DS     +KLRI+D
Sbjct: 133 DSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLL---IDSNNTKLKKLRIFD 189

>TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON}
           Anc_6.16 YEL061C
          Length = 1097

 Score =  462 bits (1189), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 255/539 (47%), Positives = 362/539 (67%), Gaps = 18/539 (3%)

Query: 269 IYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGETFR 328
           IYIQ+LQEF+I +A +G++LLQKGL HR+VASTKMNDVSSRSHTIFT+TLYK  NG  +R
Sbjct: 334 IYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHNGGLYR 393

Query: 329 VSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESKLT 388
           VSK+NLVDLAGSENI++SGAQ+QRAKEAGSINQSLLTLGRVINSLADK+ HIPFRESKLT
Sbjct: 394 VSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLT 453

Query: 389 RLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMKDILVKN 448
           RLLQDSLGGNTKT LI+TISPAKIN +ETSSTLEYA+KAKNIKNKP LGSF+MKD+L+KN
Sbjct: 454 RLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLGSFIMKDVLLKN 513

Query: 449 ISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSSQNQLLH 508
           I+ EL K+KSD +ST+ K+G+YMS  HY E+ ND+E+YKTE+QES+R  E+L SQN  L 
Sbjct: 514 ITTELNKIKSDLMSTRLKDGVYMSQQHYKELNNDLESYKTEVQESKRANERLISQNGSLL 573

Query: 509 KDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRNMQGALK 568
           KDKK+S +  E QR+QI      +  LYE +D  +K E  L  +I +LK+   +MQ  ++
Sbjct: 574 KDKKASNELNELQRIQIEKKNEKIKELYEILDEHYKREDILVELIRQLKNVGTSMQSTIE 633

Query: 569 THEDHEQRLQSDIQKMLYDNILEYRRKIETKL--------DNLK---------QQALEQS 611
            + + +  ++   +K+L +     + ++   L        DNLK          +A++ S
Sbjct: 634 NYRERDLEIEESTKKILENEFKFLKNELSQILSNINGNIIDNLKSSIISNNSSIEAIDSS 693

Query: 612 FTIDDDINNVKDSLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSELNDMFSKVDE 671
                +I+ ++++   +L+ V++ +  +  +  ++++ D P   N    E+N +  + ++
Sbjct: 694 -NFQKNIDIIENTTLKILKQVQEKSQHIYSSCIERILSDIPNILNKFKIEINSIDFQYND 752

Query: 672 HTDRLKEGLSQITAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKHLMSKITN 731
             +++ E LS ++ E NN K YL+  F +NN++ IL  H +    Q+   S +L+  I  
Sbjct: 753 QFNKITENLSDLSEEYNNFKEYLNNSFLQNNYELILKNHLESGQSQIESFSNNLLLNINK 812

Query: 732 IISDHVEQNRTLLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLSNKFKDD 790
            I++    N  L  + L     +++ +E    +P ++ W +S   IN  D ++N F +D
Sbjct: 813 QINEFKLHNSKLYEEKLNNIKNDIVKKETESIKPYKEKWVKSIEIINSTDKINNTFHND 871

 Score =  305 bits (782), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 136/179 (75%), Positives = 161/179 (89%), Gaps = 3/179 (1%)

Query: 10  GDELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTV 69
           G+ELNITVAVRCRGRNE+E++AKSSVVV+ PD++G+NEVSINTS ++GI A MNSKTYTV
Sbjct: 8   GEELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTV 67

Query: 70  DKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSE 129
           DKVFGPSA Q L+FKEIA+P+F DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLYDGELS+
Sbjct: 68  DKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSD 127

Query: 130 AAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKLRIYD 188
           +AGIIPRVLFKLF++ E+   DY++KCSF+ELYNE+LKDLLDD  D   N  +KLRI+D
Sbjct: 128 SAGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDSVD---NTYKKLRIFD 183

>Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa]
           {ON} complement(169349..172237) [2889 nt, 963 aa]
          Length = 962

 Score =  389 bits (999), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 219/657 (33%), Positives = 391/657 (59%), Gaps = 2/657 (0%)

Query: 262 VNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKN 321
           + E++ A YIQ+L+EFHIT+AKEG++LL +GL +RQ+AS+K    SSR+ TIFT+ LYK 
Sbjct: 250 IQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKE 309

Query: 322 FNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIP 381
             GE FRVSK N VDLAG+E+  +    NQR K+   INQ +  L +++NSL +K + IP
Sbjct: 310 EEGEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDINIINQGIQNLNKIVNSLHEKESVIP 369

Query: 382 FRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMM 441
           F++SKLT L++D+L GN+K+  I T+   K + +E   TLE+  K +++K  P LG  + 
Sbjct: 370 FKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGPSIN 429

Query: 442 KDILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLS 501
           K+ L+K+IS+ELAK+KSD LSTKSKEG+YMSH HY+ +  D++ +K EI + ++ I++L+
Sbjct: 430 KETLIKSISNELAKVKSDLLSTKSKEGVYMSHEHYDVLTKDLDKHKVEIMDLKKVIDELN 489

Query: 502 SQNQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVR 561
            Q+  L KDK++ ++  E QR+++++++ S+  +Y  I+ + + E +L N   KLK+ V 
Sbjct: 490 EQSTTLRKDKRAFEEVNEVQRIKLQSMRDSVSMMYTNIEKQQRREHDLINSTDKLKETVN 549

Query: 562 NMQGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQALEQSFTIDDDINNV 621
           NM   +  + D E  +Q+ ++ +  + + + +  +   L   ++  L  +  I++++N  
Sbjct: 550 NMNVTIARYTDRESSVQTQMKTLFNEELSKLKSMLLKNLRQFEKNELIDNLEIENNLNKA 609

Query: 622 KDSLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKEGLS 681
            + ++ +L+  + +   +  +  +K+  + PK F+S + +++ + +   E+ + L E LS
Sbjct: 610 HEEIKQILQISENEIDSLFLDCIKKMSEESPKLFSSFIQDVSRLENSTSENYNNLAELLS 669

Query: 682 QITAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKHLMSKITNIISDHVEQNR 741
            ++ E NNLK Y++  FF+NNH+E+L  + +KTYHQ+  SS   + K  +++  ++E N+
Sbjct: 670 DVSEEFNNLKQYINEKFFKNNHEELLKTYVNKTYHQVQKSSDDFLLKFNDLLESYLEGNK 729

Query: 742 TLLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLSNKFKDDTTESLNSLKSH 801
           ++L+  +K+AT+EVI  EM+HF P ++ WE+S   I      SN+FK      +  L+  
Sbjct: 730 SVLLQNIKSATSEVIENEMNHFIPQKEKWEKSIELIEKSKHSSNEFKTKNRVIVGKLQDT 789

Query: 802 MESTVRESSLIADKIKDNLCHFQDRNDIANMTTNINGTVDDIKNKHSVLRDELEKNVSFI 861
           ++ T         ++K  +   Q   +I      +      I  K+ +L+D L  N++  
Sbjct: 790 LKGTSESLFDTLSEMKSKINELQKAANIIENNEVVTEEFISIMKKNGILKDTLNINMTST 849

Query: 862 HASSEGFKAIDSSLKRIMNFRMPEGKT--ETLADDLIKHIDSSSVAPVASSGKTPLR 916
             S   F  +D S++ +    +    T  +++  ++   +D   + P   + K+P+R
Sbjct: 850 EESIVAFDKLDDSIRNVFKNEIDTNITGYQSILKEIFDQLDQQRLTPNMRNRKSPVR 906

 Score =  130 bits (327), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 110/193 (56%), Gaps = 16/193 (8%)

Query: 1   MSATNGSPEGDELNITVAVRCRGR--NEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGI 58
           MS ++G  +  E NI V  R +G+  NEK    +  +++  P +I           D  +
Sbjct: 1   MSLSDGVKDKVECNIKVVARFKGQIDNEKGDDVRDQIIIEEPGLIKF------KGKDDAV 54

Query: 59  TARMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTG 118
                 + + +D +F     Q  ++ +   PMF DFI GYNC+ LVYG T +GKTYT++G
Sbjct: 55  -----KREFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSG 109

Query: 119 DE-KLYDGELSE-AAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDS 176
           +E  L   E S  + G+IPRVL +LFD L     D++VKCS++E+YNEELKDLL D  +S
Sbjct: 110 EEDSLLHSEASRLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVDQHNS 169

Query: 177 GGNNS-RKLRIYD 188
             + S +KLRI D
Sbjct: 170 LLSASIKKLRIVD 182

>TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16
           YEL061C
          Length = 982

 Score =  281 bits (718), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 200/635 (31%), Positives = 365/635 (57%), Gaps = 23/635 (3%)

Query: 264 EQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVAST----KMNDVSSRSHTIFTLTLY 319
           E+ ++IYIQ+LQE  IT+ +EG+ +++KGL +R++AST      N+ S RSH+IF +TLY
Sbjct: 267 ERLNSIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLY 326

Query: 320 KNFN-GETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA 378
           K     E FR+SK++ V+ AGSE    + ++N      G+ N +L +  ++IN + + + 
Sbjct: 327 KEEEVNEVFRMSKLSFVNFAGSEYGDNNTSKN------GAFNSNLQSFNKMINGMVNNST 380

Query: 379 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGS 438
           +  F +SKLT+LLQ++  G T+T  IA I+P K   + T S L  ATK K IKN+P+ GS
Sbjct: 381 YASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPKKGS 440

Query: 439 FMMKDILVKNISHELAKLKSDFLSTKSKE-GIYMSHLHYNEVMNDIENYKTEIQESRREI 497
            + K+ L+K +S+EL K KSD LS KS + GIYM   HY+E+   +E+YK +IQ S+  I
Sbjct: 441 VITKESLIKILSNELVKTKSDLLSYKSNDNGIYMDEKHYSELTKTLESYKEKIQNSKNSI 500

Query: 498 EKLSSQNQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLK 557
            +L+ +   +  +K++ ++  E QR++++NL+ ++  L   ++ + K E EL N+ +KL 
Sbjct: 501 NELTKKGNEIRIEKRTFEEINERQRIKLQNLRETISNLNCALEKQSKRESELENIKIKLH 560

Query: 558 DAVRNMQGALKTHEDHEQRLQSDIQKMLYD-NILEYRRKIETKLDNLKQQALEQSFTIDD 616
             + NMQ +++ + D E  LQ+ + K+LYD  +++ +  +E+   ++K +  + +  ++ 
Sbjct: 561 SILGNMQKSVEKYSDKEIHLQNKL-KLLYDKELVKLKNSLESNFADIKNRMPDDNDNMNT 619

Query: 617 DINNVKDSLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRL 676
           +I+N+K  +  +    +     +  N A +V+   PK+F  + + L ++   V+ + ++ 
Sbjct: 620 NIDNIKAEILKIANQSQSKVKELLTNSANQVLDTSPKYFEQLDTNLKNLEESVEINHNKY 679

Query: 677 KEGLSQITAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKHLMSKITNIISDH 736
            E LS I+ E NNL  Y++ +F +++H+E+++ + ++TYH++   S         ++  +
Sbjct: 680 SELLSDISEEFNNLNNYINDNFLKSSHEELIDTYINRTYHEVQGISVEFTENFKKLLDIY 739

Query: 737 VEQNRTLLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHI--NVCDSLSNKFKDDTTES 794
           VE+N   L  ++ + T+E++  E++ F P +K WE + N I  N  +S++ K K+  +E 
Sbjct: 740 VEKNTKSLSKSITSLTSEIVENELTQFNPEKKKWELASNEIIENFNESIT-KNKNKNSEI 798

Query: 795 LNSLKSHMESTVRESSLIAD---KIKDNLCHFQDRNDIANMTTNINGTVDDIKNKHSVLR 851
           L  L S   ST   S L  +    IK N+   ++ ++I N    I     +I NK+  L+
Sbjct: 799 LAKLLSESTST---SELFINNMSSIKKNVEIVEEFSEIFNSNDLIKSEFLEIINKNKKLK 855

Query: 852 DELEKNVSFIHASSEGFKAIDSSLKRIMNFRMPEG 886
           D +  N +    S + F  +  +++ +    M E 
Sbjct: 856 DLITDNFNSSENSIDSFDNLKEAMQNVFKNEMKES 890

 Score =  121 bits (304), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 73/192 (38%), Positives = 108/192 (56%), Gaps = 26/192 (13%)

Query: 14  NITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGI----TARMNSKTYTV 69
           NITVAVRCR   ++E  + S  +++    IG NE    TS ++ +    T R   K YT+
Sbjct: 9   NITVAVRCREPIDEEKHSGSPTIIS----IGDNEDG--TSNEVIVLDESTGR--KKIYTL 60

Query: 70  DKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGD----EKLYDG 125
           D V+G   DQ  +F E   P +  F  GYN +++ YG   +GK YT+ G+    +   + 
Sbjct: 61  DAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNA 120

Query: 126 ELSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDD---------GQDS 176
           E SE  G++PRVL +LF  LE   +D+++KCSF+E+YN+EL+DLL D            +
Sbjct: 121 E-SENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLIDTGNNANGNNSNGA 179

Query: 177 GGNNSRKLRIYD 188
            G+  +KLRI D
Sbjct: 180 TGSTGKKLRIVD 191

>SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1112

 Score =  254 bits (649), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 148/322 (45%), Positives = 212/322 (65%), Gaps = 32/322 (9%)

Query: 266 SSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTL----YKN 321
           S +I ++ ++E +I  A+EGL+LL +G   RQVASTK ND+SSRSHT+FT+T        
Sbjct: 249 SHSIMVKGMEEIYIKSAQEGLKLLTEGSIKRQVASTKCNDLSSRSHTVFTITTNVTKVDP 308

Query: 322 FNGETF-RVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHI 380
            +GE + +  K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D + HI
Sbjct: 309 LSGEEYVKNGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSQHI 368

Query: 381 PFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFM 440
           P+RESKLTRLLQDSLGG TKT +IAT+SPAKI+ EET STLEYAT+AK+IKN PQ+   M
Sbjct: 369 PYRESKLTRLLQDSLGGKTKTCIIATVSPAKISMEETVSTLEYATRAKSIKNTPQINQSM 428

Query: 441 MKDILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYN----------EVMNDIENYKTEI 490
            KD  +    HE+ +L+ +  +T++K+GIY++   Y+          E    I+N + +I
Sbjct: 429 TKDSCITEYIHEIDRLRKELRATRTKDGIYITQEKYDLYESNCILVGEQKARIDNLEEQI 488

Query: 491 QESR----REIEKLSSQNQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKI------- 539
           +  +    +++       Q L K   S Q   E ++L    L+SS+DYL +K        
Sbjct: 489 KRFKEKYVQQVNITKETEQKLQKIDLSYQQVWEKKQL----LESSLDYLQQKCNSFEHEI 544

Query: 540 -DLKHKNEIELTNMIMKLKDAV 560
            ++ HKN +++ + I+  +D +
Sbjct: 545 TEIHHKN-LKILDSIVDERDTI 565

 Score =  161 bits (407), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 111/191 (58%), Gaps = 10/191 (5%)

Query: 8   PEGDELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTY 67
           P+    NI V VRCR RN++EI  KSSVV++     G + +  N S     +     KTY
Sbjct: 48  PDSPGYNIKVYVRCRSRNKREIGEKSSVVISTMGAQGRDVILSNPSSSSSGSLTNVKKTY 107

Query: 68  TVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE- 126
           T D+VFG  +DQ +VF  +A     + ++GYNCT+  YG T TGKTYTM+GD  +     
Sbjct: 108 TFDRVFGAESDQEVVFNSVAKNYISEMLQGYNCTVFAYGQTGTGKTYTMSGDINILGSTT 167

Query: 127 ---------LSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSG 177
                    LSE AGIIPRVL  LF  L+ + +DY VK SF+ELYNE LKDLL D     
Sbjct: 168 HNHDQSSILLSEHAGIIPRVLVDLFKDLKNESTDYSVKVSFLELYNERLKDLLADSNKED 227

Query: 178 GNNSRKLRIYD 188
            NN+  +RI+D
Sbjct: 228 DNNAESIRIFD 238

>Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W
           (REAL)
          Length = 1113

 Score =  252 bits (643), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 148/321 (46%), Positives = 204/321 (63%), Gaps = 37/321 (11%)

Query: 263 NEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLY--- 319
           N  +S+I ++ +QE  I  A EGL LL +G   R+VA+TK ND+SSRSHT+FT+T     
Sbjct: 235 NNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVE 294

Query: 320 ---------KNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVI 370
                    KNF     ++ K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVI
Sbjct: 295 QDSKDHGQNKNF----VKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVI 350

Query: 371 NSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNI 430
           N+L D + HIP+RESKLTRLLQDSLGG TKT +IAT+SPAKI+ EET+STLEYAT+AK+I
Sbjct: 351 NALVDHSNHIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSI 410

Query: 431 KNKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSH-----LHYNEVMNDIEN 485
           KN PQ+   + KD  +K+   E+ KLK+D  ++++K+GI+++         N ++ D +N
Sbjct: 411 KNTPQVNQSLSKDTCLKDYIQEIEKLKNDLKNSRNKQGIFITQDQLDLYESNSILIDEQN 470

Query: 486 YKTEIQESRREIEKLSSQ-------NQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEK 538
            K  I   R +I+K   +       N LL  +K       E     IR+      + Y K
Sbjct: 471 LK--IHNLREQIKKFKEKYLTQLDINNLLQSEK-------EKLVTVIRDFDIDYSHFYSK 521

Query: 539 IDLKHKNEIELTNMIMKLKDA 559
           I   H   +EL N + + +D+
Sbjct: 522 IQQIHYTNLELINQVTQQRDS 542

 Score =  132 bits (333), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 83/186 (44%), Positives = 104/186 (55%), Gaps = 15/186 (8%)

Query: 14  NITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVDKVF 73
           NI V VRCR RN++EI  KSSVV++    +G     I  S     +   + KTY  D+VF
Sbjct: 52  NIHVYVRCRSRNKREIDEKSSVVIS---TLGPQGKEIILSNGSHQSYSSSKKTYQFDQVF 108

Query: 74  GPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE------- 126
           G  +DQ  VF   A     + + GYNCT+  YG T TGKTYTM+GD  +  G+       
Sbjct: 109 GAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINIL-GDVQSTDKL 167

Query: 127 -LSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSG---GNNSR 182
            L E AGIIPRVL  LF  L     +Y VK SF+ELYNE LKDLL D  D      +  R
Sbjct: 168 LLGEHAGIIPRVLVDLFKELSTLNREYSVKISFLELYNENLKDLLSDSDDDDPVVNDTKR 227

Query: 183 KLRIYD 188
           ++RI+D
Sbjct: 228 QIRIFD 233

>YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}
           KIP1Kinesin-related motor protein required for mitotic
           spindle assembly, chromosome segregation, and 2 micron
           plasmid partitioning; functionally redundant with Cin8p
           for chromosomal but not plasmid functions
          Length = 1111

 Score =  250 bits (639), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 151/348 (43%), Positives = 216/348 (62%), Gaps = 38/348 (10%)

Query: 263 NEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLY--- 319
           N  +S+I ++ +QE  I  A EGL LL +G   R+VA+TK ND+SSRSHT+FT+T     
Sbjct: 235 NNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVE 294

Query: 320 ---------KNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVI 370
                    KNF     ++ K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVI
Sbjct: 295 QDSKDHGQNKNF----VKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVI 350

Query: 371 NSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNI 430
           N+L D + HIP+RESKLTRLLQDSLGG TKT +IATISPAKI+ EET+STLEYAT+AK+I
Sbjct: 351 NALVDHSNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSI 410

Query: 431 KNKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSH-----LHYNEVMNDIEN 485
           KN PQ+   + KD  +K+   E+ KL++D  ++++K+GI+++         N ++ D +N
Sbjct: 411 KNTPQVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQDQLDLYESNSILIDEQN 470

Query: 486 YKTEIQESRREIEKLSSQ-------NQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEK 538
            K  I   R +I+K           N LL  +K       E     I+N        Y +
Sbjct: 471 LK--IHNLREQIKKFKENYLNQLDINNLLQSEK-------EKLIAIIQNFNVDFSNFYSE 521

Query: 539 IDLKHKNEIELTNMIMKLKD-AVRNMQGALKTHEDHEQRLQSDIQKML 585
           I   H   +EL N +++ +D ++ N Q    T+++ + ++   + + L
Sbjct: 522 IQKIHHTNLELMNEVIQQRDFSLENSQKQYNTNQNMQLKISQQVLQTL 569

 Score =  134 bits (338), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 82/198 (41%), Positives = 108/198 (54%), Gaps = 16/198 (8%)

Query: 2   SATNGSPEGDELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITAR 61
           +  NG+   D  NI V VRCR RN++EI+ KSSVV++    +G     I  S     +  
Sbjct: 41  TCNNGAATSDS-NIHVYVRCRSRNKREIEEKSSVVIS---TLGPQGKEIILSNGSHQSYS 96

Query: 62  MNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEK 121
            + KTY  D+VFG  +DQ  VF   A     + + GYNCT+  YG T TGKTYTM+GD  
Sbjct: 97  SSKKTYQFDQVFGAESDQETVFNATAKNYIKEMLHGYNCTIFAYGQTGTGKTYTMSGDIN 156

Query: 122 LYDGE--------LSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELK---DLL 170
           +  G+        L E AGIIPRVL  LF  L     +Y VK SF+ELYNE LK      
Sbjct: 157 IL-GDVQSTDNLLLGEHAGIIPRVLVDLFKELSSLNKEYSVKISFLELYNENLKDLLSDS 215

Query: 171 DDGQDSGGNNSRKLRIYD 188
           +D   +  +  R++RI+D
Sbjct: 216 EDDDPAVNDPKRQIRIFD 233

>ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL063W
           (KIP1)
          Length = 1129

 Score =  247 bits (631), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 147/320 (45%), Positives = 216/320 (67%), Gaps = 17/320 (5%)

Query: 268 AIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTL----YKNFN 323
           +I+++ ++E +I  A+EGL+LL  G   R+VA+TK ND+SSRSHTIFT+T         +
Sbjct: 250 SIFVKGMEEMYIRSAQEGLKLLMDGSLKRKVAATKCNDLSSRSHTIFTITTNVTKIHPIS 309

Query: 324 GETF-RVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPF 382
           GE + +V K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D + HIP+
Sbjct: 310 GEQYVKVGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSQHIPY 369

Query: 383 RESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMK 442
           RESKLTRLLQDSLGG TKT +IATISPAKI+ EET STLEYAT+AK+IKN PQ+   M K
Sbjct: 370 RESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTLEYATRAKSIKNTPQVNQLMAK 429

Query: 443 DILVKNISHELAKLKSDFLSTKSKEGIYMSHLHY-----NEVMNDIENYKTE-IQES-RR 495
           +  +     E+ +L+ +  ++ SKEGIY++   +     N ++ + +  K + +QE  RR
Sbjct: 430 ESCIIEYIQEIERLRKELRASHSKEGIYITQEKFETYESNSILVEEQQAKIDNLQEQLRR 489

Query: 496 EIEKLSSQNQLL-HKDKKSSQDTIESQRL--QIRNLQSSMDYLYEKIDLKHKNEIELTNM 552
             EK   Q +L+  KD +  +  + +++   Q ++L   ++ ++ K++      I + N 
Sbjct: 490 LKEKFLEQTKLIKEKDGQIKELDVANRKYLEQSKDLTIYINGIHSKLEDYEHTMIGIHNN 549

Query: 553 IMKLKDAVRNMQGALKTHED 572
            MKL + + + +G +  HED
Sbjct: 550 NMKLLEDINDNRGNI--HED 567

 Score =  156 bits (394), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 91/203 (44%), Positives = 118/203 (58%), Gaps = 30/203 (14%)

Query: 4   TNGSPEGDELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGAN--EVSINTSGDIGITAR 61
           + G PE    NI V VRCR RNE+EI+ KSSVV++    +G N  EV +   G       
Sbjct: 47  SEGEPE---YNIKVYVRCRSRNEREIREKSSVVIS---TLGNNGREVILTNPGT------ 94

Query: 62  MNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEK 121
            ++KTYT D+VFG  +DQ  +F ++A    ++ I+GYNCT+  YG T TGKTYTM+GD  
Sbjct: 95  GSNKTYTFDRVFGVESDQESMFNQVARAYINEMIEGYNCTVFAYGQTGTGKTYTMSGDIT 154

Query: 122 LYDGE--------LSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDG 173
           +            LSE AGIIPRVL +LF  L     DY VK SF+ELYNE+L+DLL D 
Sbjct: 155 MMGSSEDDPNFVLLSEHAGIIPRVLVELFRELREVSEDYSVKVSFLELYNEKLRDLLVDD 214

Query: 174 QD--------SGGNNSRKLRIYD 188
           +D        +G      +RIYD
Sbjct: 215 KDVSLEDHNFNGMAPPESIRIYD 237

>NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7.387
          Length = 1102

 Score =  244 bits (622), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 172/459 (37%), Positives = 267/459 (58%), Gaps = 56/459 (12%)

Query: 266 SSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTL----YKN 321
           SS+I ++ ++E +I  A +GL+LL  G   R+VA+TK ND+SSRSHT+FT+T        
Sbjct: 239 SSSIMVKGMEEIYINSAHQGLQLLMDGSIKRKVAATKCNDLSSRSHTVFTITTNITKLDP 298

Query: 322 FNGETF-RVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHI 380
            +GE + +  K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D   HI
Sbjct: 299 VSGEQYVKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHTQHI 358

Query: 381 PFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFM 440
           P+RESKLTRLLQDSLGG TKT +IATISPAKI+ +ET STLEYAT+AK+IKN PQ+   M
Sbjct: 359 PYRESKLTRLLQDSLGGKTKTCIIATISPAKISMDETISTLEYATRAKSIKNTPQVNQSM 418

Query: 441 MKDILVKNISHELAKLKSDFLSTKSKEGIYMSHLHY-----NEVMND-----IENYKTEI 490
            KD  +    HE+ +L+ +  +++ K+GI ++   +     N ++ D     I+N + +I
Sbjct: 419 SKDSCINEYVHEIERLRQELKTSRQKDGISITQDQFDLYESNGILVDEQKTKIQNMEEQI 478

Query: 491 QESRREIEKLSSQNQ-LLHKDKKSSQDTIE--SQRLQ----IRNLQSSMDYLYEKIDLKH 543
           Q  + +  K +  N+ L  + K++   TI+  SQR Q    + N QS+ ++  E++   H
Sbjct: 479 QRFKDKYVKQTELNKNLESRLKQNELQTIQLKSQRTQLLSLLENFQSNSNHYIERVTKIH 538

Query: 544 KNEIELTNMIMKLKDAVRNMQGALKTHEDHEQRLQ--SDIQKMLYD--NILE-YRRK--- 595
            +   L   + + +  + N  G++   +   + +   SD QK L +  N+L+ Y  K   
Sbjct: 539 DSNTHLIQQLAQQRSELHN--GSITYVKSVTEAMSGISDQQKELSELRNVLQSYNDKFKH 596

Query: 596 --------IETKLDNLKQQALEQSFTID-----DDINNVKDSLETLLETVKKDAIIMCEN 642
                   +E K+ + ++  LE   +++     D I  ++D + T  E +KK        
Sbjct: 597 VITGIFTELEDKVKDTRKSTLEPLTSMNLRLILDMIGELRDDISTRFEMLKKPR------ 650

Query: 643 LAQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKEGLS 681
                  D  K F +    +   FS ++E+ D +++ L+
Sbjct: 651 -----TEDTTKIFKAHQDIIETCFSHINEYCDSMEKVLT 684

 Score =  151 bits (381), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 83/182 (45%), Positives = 108/182 (59%), Gaps = 16/182 (8%)

Query: 15  ITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVDKVFG 74
           I V VRCR RNE+EI+ KSSVV++    +GA + +     +  +      +TYT D+VFG
Sbjct: 61  IKVYVRCRSRNEREIQEKSSVVIS---TLGAPQSTQLLLSNPLLPLAYAKRTYTFDRVFG 117

Query: 75  PSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE-------- 126
             +DQ  VF + A    H+ ++GYNCT+  YG T TGKTYTM+GD  +  G+        
Sbjct: 118 AESDQESVFNDAAKNYIHEMLEGYNCTVFAYGQTGTGKTYTMSGDLNILGGDLDSNTMVL 177

Query: 127 LSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKLRI 186
           L E AGIIPRVL +LF  L+  E  Y VK SF+ELYNE LKDLL   Q    N    +RI
Sbjct: 178 LGEHAGIIPRVLVELFRWLDGNEG-YSVKVSFLELYNERLKDLLASEQSEEEN----IRI 232

Query: 187 YD 188
           +D
Sbjct: 233 FD 234

>Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  244 bits (622), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 144/311 (46%), Positives = 201/311 (64%), Gaps = 31/311 (9%)

Query: 263 NEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLY--- 319
           N  +S+I ++ +QE  I  A EGL LL +G   R+VA+TK ND+SSRSHT+FT+T     
Sbjct: 234 NNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVE 293

Query: 320 ---------KNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVI 370
                    KNF     ++ K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVI
Sbjct: 294 QDSKDHGQNKNF----VKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVI 349

Query: 371 NSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNI 430
           N+L D + HIP+RESKLTRLLQDSLGG TKT +IATISPAKI+ EET+STLEYAT+AK+I
Sbjct: 350 NALVDHSNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSI 409

Query: 431 KNKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSH-----LHYNEVMNDIEN 485
           KN PQ+   + KD  +K+   E+ KL++D  ++++K+GI+++         N ++ D +N
Sbjct: 410 KNTPQVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQDQLDLYESNSILIDEQN 469

Query: 486 YKTEIQESRREIEKLSSQ-------NQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEK 538
            K  I   R +I+K           N  L  +K+   + I +  +   N  S +  ++  
Sbjct: 470 LK--IHNLRGQIKKFKGNYLNQLDVNNFLQSEKEKLINVIRNFNVDFSNFNSEIQKIHH- 526

Query: 539 IDLKHKNEIEL 549
            +L+  NEI L
Sbjct: 527 TNLELMNEITL 537

 Score =  145 bits (366), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 107/186 (57%), Gaps = 15/186 (8%)

Query: 14  NITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVDKVF 73
           NI V VRCR RN++EI  KSSVV++    +G     I  S     +   + KTY  D+VF
Sbjct: 51  NIHVYVRCRSRNKREIDEKSSVVIS---TLGPQGKEIILSNGSHQSYSSSKKTYQFDQVF 107

Query: 74  GPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE------- 126
           G  +DQ  VF   A     + + GYNCT+  YG T TGKTYTM+GD  +  G+       
Sbjct: 108 GAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINIL-GDVQSTDNL 166

Query: 127 -LSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQD---SGGNNSR 182
            L E AGIIPRVL  LF  L     +Y VK +F+ELYNE LKDLL D +D   +  ++ R
Sbjct: 167 LLGEHAGIIPRVLVDLFKELSSLNKEYSVKVTFLELYNENLKDLLSDNEDDDPAVNDSKR 226

Query: 183 KLRIYD 188
           ++RI+D
Sbjct: 227 QIRIFD 232

>Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  243 bits (621), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 135/263 (51%), Positives = 184/263 (69%), Gaps = 25/263 (9%)

Query: 263 NEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLY--- 319
           N  +S+I ++ +QE  I  A EGL LL +G   R+VA+TK ND+SSRSHT+FT+T     
Sbjct: 235 NNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIIE 294

Query: 320 ---------KNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVI 370
                    KNF     ++ K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVI
Sbjct: 295 QDSKEHGQNKNF----VKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVI 350

Query: 371 NSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNI 430
           N+L D + HIP+RESKLTRLLQDSLGG TKT +IAT+SPAKI+ EET+STLEYAT+AK+I
Sbjct: 351 NALVDHSNHIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSI 410

Query: 431 KNKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSH-----LHYNEVMNDIEN 485
           KN PQ+   + KD  +K+   E+ KL++D  ++++K+GI+++         N ++ D +N
Sbjct: 411 KNSPQVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQDQLDLYESNSILIDEQN 470

Query: 486 YKTEIQESRREIEKLSSQ--NQL 506
            K  I   R +I+K   +  NQL
Sbjct: 471 LK--IHNLREQIKKFKEKYLNQL 491

 Score =  150 bits (379), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 88/195 (45%), Positives = 110/195 (56%), Gaps = 15/195 (7%)

Query: 5   NGSPEGDELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNS 64
           N S    E NI V VRCR RN +EI  KSSVV++    +G     I  S     +   + 
Sbjct: 43  NNSNATSESNIHVYVRCRSRNRREIDEKSSVVIS---TLGPQGKEIILSNGSHQSYSSSK 99

Query: 65  KTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYD 124
           KTY  D+VFG  +DQ +VF   A     + + GYNCT+  YG T TGKTYTM+GD  +  
Sbjct: 100 KTYQFDQVFGAESDQEMVFHATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINIL- 158

Query: 125 GE--------LSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQ-- 174
           G+        L E AGIIPRVL  LF  L     +Y VK SF+ELYNE LKDLL D +  
Sbjct: 159 GDVQSTDNLLLGEHAGIIPRVLVDLFKELSSLNKEYSVKVSFLELYNENLKDLLSDNEDD 218

Query: 175 DSGGNNSRK-LRIYD 188
           D   N+S+K +RI+D
Sbjct: 219 DPTANDSKKQIRIFD 233

>TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7.387
           YBL063W
          Length = 1232

 Score =  243 bits (620), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 207/635 (32%), Positives = 335/635 (52%), Gaps = 120/635 (18%)

Query: 263 NEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTL----TL 318
           N   S+I ++ ++E +I  A EGL+LL +G   R+VASTK+ND+SSRSHTIFT+    T 
Sbjct: 334 NCNGSSITVKGMEEIYIKSAHEGLQLLTEGSLKRKVASTKLNDLSSRSHTIFTIITNVTK 393

Query: 319 YKNFNGETF-RVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKN 377
                G+ F +  K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D++
Sbjct: 394 VDPVTGKHFVKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDRS 453

Query: 378 AHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLG 437
            HIP+RESKLTRLLQDSLGG TKT +IAT+SPAKI+ EET STLEYAT+AK+IKN PQ+ 
Sbjct: 454 HHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISLEETVSTLEYATRAKSIKNTPQIN 513

Query: 438 SFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSH----------LHYNEVMNDIENYK 487
             + KD  +    +E+ +L+++    ++KEGIY++           +   E    I+N +
Sbjct: 514 QSLSKDTFIHEYINEIDRLRNELKLARTKEGIYITQDQLDLYESNSILITEQKAKIDNME 573

Query: 488 TEIQ----------ESRR----EIEKLSSQNQLLHKDKK-----------------SSQD 516
            +I+          ES R    ++E+    NQ L +  K                 S+ +
Sbjct: 574 DQIKRFKAKYVEETESNRILLNKLEQSEDANQKLSEKTKVIISLFKRYQENFKIFNSNIN 633

Query: 517 TIESQRLQIRN-LQSSMDYLYEKIDLKHKNEIELTNMIM----KLKDAVRNMQGALKTHE 571
            I S  L++ + LQ+  D    K+DL  K  I+    I     K  + +  ++ +L ++ 
Sbjct: 634 QIHSSNLEVFDSLQNHKD----KLDLCSKKNIKTLKEIYIAEEKYTEQLNTLKASLSSYS 689

Query: 572 DHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQALEQSFTIDDDINNVKDSLETLLET 631
           D    + S +   + +N +E+ R +++KL +L             D+  V + ++ + ET
Sbjct: 690 DRFMLVFSSVFDEMENNSIEFERNVKSKLSSL-------------DLTMVVEEIKNMKET 736

Query: 632 VKKDAIIMCENLAQKVVGDQ-----PKFFNSMLSELNDMFSKVDEHTDRLKEGLSQITAE 686
           V+    ++C N+   +  D       + +NS L  L + F+ V+         ++Q+  E
Sbjct: 737 VE----MICNNIL--IASDTWDSSYKEVYNSHLMTLKNCFNMVEHKC----ANINQLMDE 786

Query: 687 N-----NNLKAYLDTHFFRNNHQEILNVHADKTYHQ-LNL------------SSKHLMSK 728
           N     N++K+    H ++N   +  N      Y Q L +            +SK + S+
Sbjct: 787 NFSKFQNDIKS--GVHNYKNVSSDHTNDMKHTIYEQSLEIEKLKEKIIIEQQNSKSVESR 844

Query: 729 ITNII---SDHVEQNR----TLLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCD 781
           +  +I    D + ++R    T L+DTLK +       E  H E  ++   ++ + +    
Sbjct: 845 LNKVIDYFEDEILKSRRKITTDLIDTLKQS-------EKDHLELDKQILNRTLSGLR--- 894

Query: 782 SLSNKFKDDTTESLNSLKSHMESTVRESSLIADKI 816
           +  N+ + D  +S+N+L S      +  SL+A+++
Sbjct: 895 NFENEKQSDLQKSINALTSKFSDVFKNVSLVAEQL 929

 Score =  121 bits (304), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 82/238 (34%), Positives = 115/238 (48%), Gaps = 71/238 (29%)

Query: 14  NITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSI-----------NTSGDIGIT--- 59
           NI V VRCR R ++EI  KSSVV++    +GAN   +           NT+ + G T   
Sbjct: 51  NIKVYVRCRSRTQREIDEKSSVVIST---LGANGNKVILSPNQSRKLYNTNAN-GSTRTK 106

Query: 60  -----------------ARMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTM 102
                               N +TYT DKVFG  +DQ  +F+ +A    ++ ++GYNCT+
Sbjct: 107 NNTNLNNNIKNATTNSNTGTNGRTYTFDKVFGVESDQETLFESVAKNYIYEMLQGYNCTV 166

Query: 103 LVYGMTSTGKTYTMTGDEKL---YDGE----LSEAAGIIPRVLFKLF------------- 142
             YG T TGKTYTM+GD  +    D +    L E AGIIPRVL  LF             
Sbjct: 167 FAYGQTGTGKTYTMSGDLNILGNLDSKDKILLGEHAGIIPRVLVYLFKELSKNDTITNTK 226

Query: 143 ----------------DTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKL 184
                           + + ++ ++Y VK SF+ELYNE+L DLL + +    N++ KL
Sbjct: 227 VNNNKNNNNNSNNKNEEQINLKNTEYSVKVSFLELYNEKLTDLLSNYKTDALNSNDKL 284

>Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} similar
           to Ashbya gossypii ACR228C
          Length = 1134

 Score =  242 bits (617), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 127/249 (51%), Positives = 177/249 (71%), Gaps = 15/249 (6%)

Query: 263 NEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTL---- 318
           N    +I ++ ++E +I  A+EGL+LL +G   R+VA+T+ ND+SSRSHTIFT+T     
Sbjct: 249 NSSGHSIMVKGMEEMYIRSAQEGLKLLMEGSLKRKVAATRCNDLSSRSHTIFTITTNVTK 308

Query: 319 YKNFNGETF-RVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKN 377
               +GE + ++ K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D +
Sbjct: 309 IHPISGEQYVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHS 368

Query: 378 AHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLG 437
            HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK + EET+STLEYAT+AK+IKN PQ+ 
Sbjct: 369 QHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKTSMEETASTLEYATRAKSIKNTPQIN 428

Query: 438 SFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTE---IQESR 494
             M K+  +     E+ KL+ +  +  +KEGIY++   Y       E Y++    ++E +
Sbjct: 429 QLMAKESCILGYIKEIEKLRKNLKANHAKEGIYITEEKY-------ETYESNCILVEEQQ 481

Query: 495 REIEKLSSQ 503
            +I+ L  Q
Sbjct: 482 AKIDNLQEQ 490

 Score =  156 bits (394), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 113/193 (58%), Gaps = 25/193 (12%)

Query: 14  NITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVDKVF 73
           NI V VRCR RN +EIK KSSVVV+     G   +  N S         N+KTYT D+VF
Sbjct: 56  NIKVYVRCRSRNVREIKEKSSVVVSTLGSQGREIILSNQSTG-------NNKTYTFDQVF 108

Query: 74  GPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE------- 126
           G  +DQ  +F ++A     + ++GYNCT+  YG T TGKTYTM+GD  +           
Sbjct: 109 GVESDQESLFDKVARAYITEMLEGYNCTVFAYGQTGTGKTYTMSGDISVVGASLEDPNYV 168

Query: 127 -LSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLL--------DDGQDSG 177
            LSE AGIIPRVL +LF  L+ +  DY VK SF+ELYNE+L+DLL        D+G   G
Sbjct: 169 LLSEHAGIIPRVLVELFQQLQRESEDYSVKVSFLELYNEKLRDLLVEDKEPLIDEGGIGG 228

Query: 178 G--NNSRKLRIYD 188
           G  N+   +RIYD
Sbjct: 229 GVANSPETIRIYD 241

>TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7.387
           YBL063W
          Length = 1105

 Score =  238 bits (608), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 146/321 (45%), Positives = 203/321 (63%), Gaps = 29/321 (9%)

Query: 269 IYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLY-----KNFN 323
           I ++ ++EF+I  A EGL LL  G   R+VA+TK ND+SSRSHT+FT+T          N
Sbjct: 248 IMVKGMEEFYIKSAHEGLELLMTGSLKRKVAATKCNDLSSRSHTVFTITTNVARTDPVSN 307

Query: 324 GETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFR 383
            +  ++ K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D + HIP+R
Sbjct: 308 EQYIKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDNSQHIPYR 367

Query: 384 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMKD 443
           ESKLTRLLQDSLGG TKT +IATISPAKI+ +ET STLEYAT+AK+IKN PQ+   M K+
Sbjct: 368 ESKLTRLLQDSLGGKTKTCIIATISPAKISMDETVSTLEYATRAKSIKNTPQVNQSMSKN 427

Query: 444 ILVKNISHELAKLKSDFLSTKSKEGIYMSHLHY-----NEVMNDIENYKTEIQESRREIE 498
             +    HE+ +L+ +  +++ KEG+Y++   +     N ++  +E  K  IQ    +I 
Sbjct: 428 SCLGEYIHEIERLRQELKASRQKEGMYITEDQFQLYESNSIL--VEEQKVRIQNMEDQIL 485

Query: 499 KLSS---QNQLLHKD--KKSSQDTIESQRLQI------RNLQSSMDYLYEKIDLK---HK 544
           K  +   +   L KD  K+  Q  +  ++L I       N QS      E +D     H+
Sbjct: 486 KFKAKYVEQTNLSKDAEKRLKQSQLLCKKLSIEKAEMSENFQSFRQTCTEYVDSVEDIHR 545

Query: 545 NEIELTNMIMKLKDAVRNMQG 565
           + +EL   I  LKD   ++ G
Sbjct: 546 SNLEL---IRSLKDERDDLFG 563

 Score =  152 bits (383), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 111/182 (60%), Gaps = 15/182 (8%)

Query: 14  NITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVDKVF 73
           N+ V VRCR RNE+EI+ KSSVV++     G   +  N +G +  + R    TYT D+VF
Sbjct: 41  NMRVYVRCRSRNEQEIEEKSSVVISTLGAKGREVILSNGAGSLSHSKR----TYTFDQVF 96

Query: 74  GPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKL---YDGE---- 126
           G  +DQ  VF E+A     + ++GYNCT+  YG T TGKTYTM+GD  +    D +    
Sbjct: 97  GAESDQETVFDEVAKDYISEMLEGYNCTVFTYGQTGTGKTYTMSGDISILGDLDSQDKIL 156

Query: 127 LSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKLRI 186
           L E +GIIPRVL  LF  L  + ++Y VK SF+ELYNE+LKDLL + +    N    +RI
Sbjct: 157 LGEHSGIIPRVLVDLFKQLSQETNEYTVKVSFLELYNEKLKDLLAESEQEEEN----IRI 212

Query: 187 YD 188
           +D
Sbjct: 213 FD 214

>NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {ON}
           Anc_7.387
          Length = 1186

 Score =  236 bits (602), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 122/216 (56%), Positives = 161/216 (74%), Gaps = 5/216 (2%)

Query: 263 NEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTL----TL 318
           N  SS+I ++ ++E +I  A EGL+LL  G   R+VASTK ND+SSRSHT+FT+    T 
Sbjct: 283 NNASSSIMVKGMEEIYIKSAHEGLQLLMDGSLKRKVASTKCNDLSSRSHTVFTIATNITK 342

Query: 319 YKNFNGETF-RVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKN 377
               +GE + +  K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D +
Sbjct: 343 IDPISGEQYIKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHS 402

Query: 378 AHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLG 437
            HIP+RESKLTRLLQDSLGG TKT +IATISPAKI+ EET STLEYA +AK+IKN PQ+ 
Sbjct: 403 QHIPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTLEYAIRAKSIKNTPQIN 462

Query: 438 SFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSH 473
             M KD  +     E+ +L+ +  +++ K+GI ++ 
Sbjct: 463 QSMSKDTCINEYVSEIERLRLELKTSRQKDGICITQ 498

 Score =  144 bits (362), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 80/182 (43%), Positives = 102/182 (56%), Gaps = 16/182 (8%)

Query: 14  NITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVDKVF 73
           NI V VRCR R+E+EIK KSSVV++     G   +  N S  +        K+Y+ D+VF
Sbjct: 108 NIKVYVRCRSRSEREIKEKSSVVISTLGPQGNQVILSNPSSPLSYPK----KSYSFDRVF 163

Query: 74  GPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDG-------E 126
           G  +DQ  VF + A     + + GYNCT+  YG T TGKTYTM+GD  +           
Sbjct: 164 GAESDQETVFNDAAKNYISEMLSGYNCTVFAYGQTGTGKTYTMSGDLNILGNLESKDMIL 223

Query: 127 LSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKLRI 186
           L E AGIIPRVL  LF  L + E+DY VK SF+ELYNE LKDL    +         +RI
Sbjct: 224 LGEHAGIIPRVLVNLFKMLAL-ENDYSVKISFLELYNERLKDLFAQNESE----EETIRI 278

Query: 187 YD 188
           +D
Sbjct: 279 FD 280

>ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1138

 Score =  234 bits (597), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 130/271 (47%), Positives = 187/271 (69%), Gaps = 15/271 (5%)

Query: 269 IYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLY----KNFNG 324
           I ++ ++E +I  A EGL+LL KG   R+VA+TK ND+SSRSHTIFT+  +       +G
Sbjct: 268 ITVKGMEERYIKSAYEGLQLLTKGSLKRKVAATKCNDLSSRSHTIFTIVTHVARTDPVSG 327

Query: 325 ETF-RVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFR 383
           E + ++ K+NLVDLAGSENI+RSGA+N RA+EAG IN+SLLTLGRVIN+L + ++HIP+R
Sbjct: 328 EQYVKIGKLNLVDLAGSENINRSGAENMRAQEAGLINKSLLTLGRVINALVEHSSHIPYR 387

Query: 384 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMKD 443
            SKLTRLLQDSLGG TKT +IATISPA+I+ +ET STLEYAT+AK+IKN PQ+   + KD
Sbjct: 388 GSKLTRLLQDSLGGKTKTCIIATISPARISMDETVSTLEYATRAKSIKNTPQVNQSLSKD 447

Query: 444 ILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMND---IENYKTEIQESRREI--- 497
             +    +E+ +L+ +  +++ +EG+Y++   Y+   ++   +E  K  IQ    +I   
Sbjct: 448 SCIMEYIYEIERLRQELKASRQREGMYITQEQYDLYESNSLLVEEQKVVIQNMGEQIKRF 507

Query: 498 -EKLSSQNQL---LHKDKKSSQDTIESQRLQ 524
            EK   Q +L    H+  + SQ   ++ R+Q
Sbjct: 508 KEKYVEQTKLSKEAHRQFQESQKVCDTLRIQ 538

 Score =  149 bits (377), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 110/182 (60%), Gaps = 15/182 (8%)

Query: 14  NITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVDKVF 73
           NI V VRCR RN++EI  KSSVVV+     G + +  N S  +        KTY  D+VF
Sbjct: 44  NIKVYVRCRSRNQREIDEKSSVVVSTMGRKGKSVILSNPSSPLS----HPKKTYMFDEVF 99

Query: 74  GPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLY---DGE---- 126
           G  +DQ  +F E+A     + ++GYNCT+  YG T TGKTYTM+GD  ++   D +    
Sbjct: 100 GADSDQESIFTEVAKNYIQEMLEGYNCTVFAYGQTGTGKTYTMSGDMSIWGDLDSQDKIL 159

Query: 127 LSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKLRI 186
           L E AGIIPRVL  LF  L  + +++ VK SF+ELYNE LKDLL D  DS  +N   +RI
Sbjct: 160 LGEHAGIIPRVLVNLFKQLSKETTEHSVKISFLELYNERLKDLLADN-DSDEDN---IRI 215

Query: 187 YD 188
           +D
Sbjct: 216 FD 217

>KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa]
           {ON} Anc_7.387 YBL063W
          Length = 1151

 Score =  233 bits (595), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 123/220 (55%), Positives = 166/220 (75%), Gaps = 5/220 (2%)

Query: 263 NEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKN- 321
           N   S+I ++ ++E +I  A EGL+LL +G   R+VASTK ND+SSRSHTIFT+T     
Sbjct: 248 NNTYSSIMVKGMEEIYIKSAHEGLQLLTEGSLKRKVASTKCNDLSSRSHTIFTITTNITK 307

Query: 322 ---FNGETF-RVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKN 377
               +GE + ++ K+NLVDLAGSENISRSGA+N RA+EAG IN+SLLTLGRVIN+L D +
Sbjct: 308 IDPVSGEQYVKIGKLNLVDLAGSENISRSGAENMRAQEAGLINKSLLTLGRVINALVDHS 367

Query: 378 AHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLG 437
            HIP+RESKLTRLLQDSLGG TKT +IAT+SPAKI+ EET STLEYAT+AK+IKN PQ+ 
Sbjct: 368 QHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISMEETISTLEYATRAKSIKNTPQIN 427

Query: 438 SFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYN 477
             M KD+ +     E+ +L+ +  +++ K+G+Y++   ++
Sbjct: 428 QSMSKDVCINEYVQEIERLRQELKASRQKDGVYITQEQFD 467

 Score =  150 bits (379), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 108/182 (59%), Gaps = 15/182 (8%)

Query: 14  NITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVDKVF 73
           NI V VRCR RN++EI+ KSSVV++     G   V  + S  +  T     KTY  D+VF
Sbjct: 59  NIQVYVRCRSRNQREIEEKSSVVISTMGAQGKEVVLSDPSSVLSHTK----KTYIFDQVF 114

Query: 74  GPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGD-EKLYDGE------ 126
           G  +DQ +VF   A    H+ ++GYNCT+  YG T TGKTYTM+GD   L D E      
Sbjct: 115 GVESDQEVVFNATAQNYIHEMLQGYNCTIFAYGQTGTGKTYTMSGDINILGDLESQDKIL 174

Query: 127 LSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKLRI 186
           L E AGIIPRVL  LF  L  + ++Y VK SF+ELYNE LKDLL   +++       +RI
Sbjct: 175 LGEHAGIIPRVLVNLFQYLTRESTEYSVKISFLELYNERLKDLLSQSKET----EESIRI 230

Query: 187 YD 188
           +D
Sbjct: 231 FD 232

>TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7.387
           YBL063W
          Length = 1142

 Score =  182 bits (463), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 129/291 (44%), Positives = 174/291 (59%), Gaps = 46/291 (15%)

Query: 267 SAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLT-----LYKN 321
           S+I ++ +QE  I +A EGL LL KG   R+V STK+ND+SSRSHTIFT+T     L   
Sbjct: 206 SSIIVKGMQEIFIKNAMEGLNLLMKGSLQRKVKSTKLNDLSSRSHTIFTITTNIIKLDNQ 265

Query: 322 FNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK--NAH 379
            N E  ++ K+NLVDLAGSENI++SG +  R++E G IN+SLLTLGRVIN+L+DK  N H
Sbjct: 266 TNKEYIKIGKLNLVDLAGSENITKSGLK--RSQETGLINKSLLTLGRVINALSDKTNNTH 323

Query: 380 ----------------------IPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEET 417
                                 IP+RESKLTRLLQDSLGG TKT +IATISPAK   +ET
Sbjct: 324 GSNNDNNNSSSSSSISNSHHSHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKTCLDET 383

Query: 418 SSTLEYATKAKNIKNKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEG---IYMSHL 474
            STLEYAT+A +IKN P++         + +  +++ +LK +  ++  K G   I +  L
Sbjct: 384 ISTLEYATRAMSIKNNPKINKSQNPSNFINDYINQIDRLKLELQTSTDKIGGIFIPLEKL 443

Query: 475 HY---NEVMNDIENYKTEIQESRREIEKLSSQ-------NQLLHKDKKSSQ 515
           +Y   NE++  IE    +I     +I K   +       N+ L+ D K SQ
Sbjct: 444 NYYKSNEIL--IEEQNAKINNMTNQIAKFKKKFVEQIQINKQLNTDMKKSQ 492

 Score =  140 bits (353), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 83/182 (45%), Positives = 100/182 (54%), Gaps = 26/182 (14%)

Query: 14  NITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVDKVF 73
           NI V VRCR RN+KEI  KSSVVV+    +G N         I I+   N   Y  D VF
Sbjct: 9   NIKVYVRCRSRNQKEIDEKSSVVVST---LGQN------GNQIIISNSTNKNKYIFDNVF 59

Query: 74  GPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELS----- 128
           G  +DQ  +F  +A     + I GYNCT+  YG T TGKTYTM+GD  +  G+L+     
Sbjct: 60  GVESDQESIFNSVAYNYIQEMIDGYNCTLFAYGQTGTGKTYTMSGDLNII-GDLNSTKNI 118

Query: 129 ---EAAGIIPRVLFKLFDTLEVQESD--------YMVKCSFIELYNEELKDLLDDGQDSG 177
              E AGIIPRVL +LF +LE   S+        Y VK SF+ELYNE LKDLL    D  
Sbjct: 119 LLGEHAGIIPRVLVQLFTSLEDSISNQKNTSVKGYTVKISFLELYNERLKDLLSADADLP 178

Query: 178 GN 179
            N
Sbjct: 179 PN 180

>SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 504

 Score =  145 bits (365), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 82/175 (46%), Positives = 117/175 (66%), Gaps = 8/175 (4%)

Query: 270 YIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKN---FNGE- 325
           +++ L EF +   +E L  +++G   R V  T MN+ SSRSH IFT+++ ++     G+ 
Sbjct: 198 FVEGLNEFKVCKVEEILEYMKQGDRLRTVGVTNMNNSSSRSHAIFTISIKQSETTLAGDL 257

Query: 326 TFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAH--IPFR 383
           T R S I LVDLAGSE +S +GA+  R KE  +IN+SL TLGRV++ LA KN    IP+R
Sbjct: 258 TERRSSIKLVDLAGSERVSTTGARGDRLKEGSNINKSLTTLGRVVSVLAKKNRPKLIPYR 317

Query: 384 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGS 438
           +S LT +L+++LGGN+KT +IA +SP   + EET STL YAT AK +KN  ++ S
Sbjct: 318 DSALTWVLKENLGGNSKTVMIACVSPC--DYEETISTLRYATTAKEVKNTARVNS 370

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 84/182 (46%), Gaps = 23/182 (12%)

Query: 14  NITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVDKVF 73
           NI VAVR R    +E        V  P      +  I+TS  +        K +T D  F
Sbjct: 4   NIKVAVRLRSPLPREHGQPIITQVTSPTSFVIQQ-HISTSSLLATEEFTQGKIFTFDHCF 62

Query: 74  ----GPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDE--------- 120
                 S DQ +++  I        + GYN  +L YG T +GK++TM G E         
Sbjct: 63  KYSENASHDQEVIYDTIGREYLLHTLDGYNTCILAYGQTGSGKSFTMMGPEVSKHFHNNQ 122

Query: 121 KLYDGELSEAA-GIIPRVLFKLFDTLEVQESD-------YMVKCSFIELYNEELKDLL-D 171
              D  + ++A GIIPRV   LFD   +  S+       + + CS++E+YNE+++DLL +
Sbjct: 123 TALDRAIEDSAIGIIPRVCCDLFDICNMCNSEEDGIKTQFEIYCSYLEIYNEQVRDLLSE 182

Query: 172 DG 173
           DG
Sbjct: 183 DG 184

>KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W
          Length = 473

 Score =  140 bits (352), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 81/173 (46%), Positives = 111/173 (64%), Gaps = 8/173 (4%)

Query: 270 YIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFN---GET 326
           +++ LQEF +    E L  L++G   + V +T +N+ SSRSHTIFT+ + +  N   G  
Sbjct: 169 FVEGLQEFEVNSVDEILDYLRQGSERKTVGATLVNEQSSRSHTIFTINVEQKENSPLGHV 228

Query: 327 F-RVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAH--IPFR 383
             R S I L+DLAGSE  + SGA  +R KE  +IN+SL TLGRVI  LA K     IP+R
Sbjct: 229 LERRSSIRLIDLAGSERANASGATGERLKEGSNINKSLSTLGRVIAMLAKKKQPRLIPYR 288

Query: 384 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQL 436
           ++ LT +L++SLGGN+KT +IA +SP     EET STL YAT A+++K   QL
Sbjct: 289 DAALTWVLKESLGGNSKTCMIACVSPCDF--EETMSTLRYATLARSVKTFAQL 339

 Score = 73.9 bits (180), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 62/112 (55%), Gaps = 21/112 (18%)

Query: 78  DQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSEAAGIIPRV 137
           DQ+ +++++A       + GYN  +  YG T +GK++TMTG         +E  GI+PR+
Sbjct: 62  DQAQLYEQLARDYLLHALDGYNTCIFAYGQTGSGKSHTMTGS--------AELPGIVPRM 113

Query: 138 LFKLFDTLEVQES-------DYMVKCSFIELYNEELKDLLDDGQDSGGNNSR 182
             +LF+  E+ ES        + ++CS++E+YNE ++DLL      G N  R
Sbjct: 114 CQELFEVREMYESSDDQASTQFKIRCSYLEIYNETVRDLL------GANKCR 159

>SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]
           {ON} weakly similar to uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a
           kinesin, colocalizes with Myo2p; kinesin heavy chain
           homolog
          Length = 649

 Score =  138 bits (348), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 110/174 (63%), Gaps = 8/174 (4%)

Query: 267 SAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYK-NFNGE 325
           S IY++ L   ++T  +E L  +++G S R V+ST MN  SSRSH+I  + L K N   E
Sbjct: 195 SGIYVKGLNTNYVTSEQELLDYIKQGESQRNVSSTSMNLESSRSHSIVRINLEKRNALEE 254

Query: 326 TFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD-------KNA 378
             + S + LVDLAGSE + ++ A     +EA  IN SL  LG VIN+L          +A
Sbjct: 255 NIQHSFLYLVDLAGSEKVGKTNAAGVTLEEAKKINSSLSALGNVINALTQVESKSKRTSA 314

Query: 379 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKN 432
           HIP+R+SKLTRLLQDSLGGN+KT LI   S ++ N +ET STL + ++AK IKN
Sbjct: 315 HIPYRDSKLTRLLQDSLGGNSKTTLILNCSTSRFNEQETLSTLRFGSRAKKIKN 368

 Score = 80.9 bits (198), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 71/129 (55%), Gaps = 11/129 (8%)

Query: 63  NSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKL 122
           N + +T D+VF   + Q  V++ +A  M   F +GYN T+L YG T +GK++TM G +  
Sbjct: 71  NDRLFTFDRVFDTGSTQESVYEFVAGDMLKSFFQGYNGTILAYGQTGSGKSHTMFGPK-- 128

Query: 123 YDGELSEAAGIIPRV---LFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGN 179
                 E  G+IPR+   +FK  +T + ++  + V  SF+E+Y E++ DLL    +   +
Sbjct: 129 ------ENRGVIPRICHDIFKQIETPDYEDCIFTVSVSFMEVYLEKIYDLLAQSLEKPAD 182

Query: 180 NSRKLRIYD 188
               L ++D
Sbjct: 183 KRISLSLHD 191

>KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1 Kinesin-related motor protein
           required for mitotic spindle assembly and chromosome
           segregation; functionally redundant with Cin8p
          Length = 456

 Score =  134 bits (337), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 105/276 (38%), Positives = 157/276 (56%), Gaps = 23/276 (8%)

Query: 270 YIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGETFRV 329
           ++Q +  F +   +E L  L  G S R VAST+MN  SSRSH IFTL++ +     + R 
Sbjct: 149 FVQDITTFKVNRVEEVLEYLSIGDSKRSVASTRMNMESSRSHAIFTLSIKQQEPDGSIRE 208

Query: 330 SKINLVDLAGSENISRS-GAQN-QRAKEAGSINQSLLTLGRVINSLADKNAH-IPFRESK 386
           S + LVDLAGSE  + + G  N +R KE  +IN+SL TLGR I+ LA  + H IP+R+S 
Sbjct: 209 SDLKLVDLAGSERANATMGIDNGKRMKEGANINKSLSTLGRCISQLAKNSKHLIPYRDSL 268

Query: 387 LTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFM------ 440
           LT +L+++LGGN+KT +IA ISP  I+ EE+ STL YAT AK IK +  +   +      
Sbjct: 269 LTWVLKENLGGNSKTCMIACISP--IDLEESLSTLRYATTAKEIKLRATMNEIVPNINED 326

Query: 441 MKDILVKNISH--ELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEIQESRREIE 498
           MK  +    S   EL  LKS+  S +S+  I       +E +    N+ T++ +      
Sbjct: 327 MKAAVEAAASSRKELEMLKSEMSSLQSEYNIKSEQWKTHEKLLVRFNHITKLNDYL---- 382

Query: 499 KLSSQNQLLHKDKKSS--QDTIESQRLQIRNLQSSM 532
               +NQL ++  KS   Q+  +  RL++ N+Q+++
Sbjct: 383 ----ENQLTNEITKSQSLQNENKLSRLEMSNVQTAL 414

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 58/109 (53%), Gaps = 9/109 (8%)

Query: 65  KTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYD 124
           +++  D +F  S+ Q+ +  E+        ++GYN  +  YG T +GKTYTM G      
Sbjct: 35  RSFNFDHIFDTSSSQTDIPGELCSKYVLHALEGYNACIFAYGQTGSGKTYTMRGT----- 89

Query: 125 GELSEAAGIIPRVLFKLFDTLEVQESDY-MVKCSFIELYNEELKDLLDD 172
              +   GIIP +   LFD LE+ ++    V  ++ E+YNE+L DLL D
Sbjct: 90  ---NSNPGIIPLLCRDLFDALELDKTTVSSVSITYFEIYNEKLIDLLGD 135

>Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {ON}
           YGL216W (KIP3) - kinesin-related protein involved in
           mitosis [contig 192] FULL
          Length = 479

 Score =  131 bits (330), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 113/175 (64%), Gaps = 8/175 (4%)

Query: 270 YIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLY---KNFNGET 326
           +++ L+EF ++  ++ L  +++G   R + ST +N+ SSRSHTIFT+++    K+  G  
Sbjct: 169 FVEGLREFDVSSVEDILNYVKQGNEKRMMGSTLVNEYSSRSHTIFTISIKQKEKSALGHV 228

Query: 327 F-RVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAH--IPFR 383
             R S I L+DLAGSE    +     R KE  +IN+SL TLGRVI+ LA +     IP+R
Sbjct: 229 IERHSSIKLIDLAGSERAKAAKTSGDRLKEGSNINKSLSTLGRVISMLAKRKQPKLIPYR 288

Query: 384 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGS 438
           ++ LT +L++SLGGN+KT +IA +SP   + EET STL YAT A+N+K   QL +
Sbjct: 289 DAALTWVLKESLGGNSKTCMIACVSPC--DYEETLSTLRYATLARNVKTCAQLNA 341

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 87/172 (50%), Gaps = 29/172 (16%)

Query: 14  NITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVDKVF 73
           NI VAVR R   E+E+    S++    D    N + +          +  ++++  D+ F
Sbjct: 4   NIKVAVRLRRPLEREVD--ESIIARVED---GNVIQVKDRNQ-----KNETRSFHFDQCF 53

Query: 74  GPS----ADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSE 129
             S    ADQ  ++++++       + GY+  +  YG T +GK++TMTG          E
Sbjct: 54  AYSENIEADQLELYEQLSREYLLHALDGYHTCVFAYGQTGSGKSHTMTGS--------PE 105

Query: 130 AAGIIPRVLFKLFDTLEVQES-------DYMVKCSFIELYNEELKDLLDDGQ 174
           + GI+ R+  +LF+  E+ ES        + ++CS++E+YNE ++DLL  G+
Sbjct: 106 SPGIVSRMCQELFEVREIYESSDDQVNTQFKIRCSYLEIYNETVRDLLGTGR 157

>Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar to
           Ashbya gossypii ADR145C
          Length = 662

 Score =  129 bits (324), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 105/170 (61%), Gaps = 4/170 (2%)

Query: 268 AIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGE-T 326
            +Y+Q      ++D  E L  +  G S R  +ST MN  SSRSH I  + L K  N E +
Sbjct: 215 GVYVQSATVISVSDGDELLHCIHLGESQRCKSSTDMNFESSRSHAIVKINLLKRDNLEGS 274

Query: 327 FRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKN---AHIPFR 383
            + S + LVDLAGSE +S++ A     +EA  IN SL +LG VIN+L  K+    HIP+R
Sbjct: 275 IQKSDLFLVDLAGSEKVSKTNAVGATLEEAKKINLSLSSLGNVINALTQKDKKRTHIPYR 334

Query: 384 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 433
           +S+LTRLL+DSLGGN+KT LI   +  K N  ET +TL + ++AK I+NK
Sbjct: 335 DSQLTRLLRDSLGGNSKTTLILNCACDKSNEAETLTTLRFGSRAKQIENK 384

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 69/120 (57%), Gaps = 12/120 (10%)

Query: 57  GITARMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTM 116
           G+     S+++  D VFG ++ Q  V+  +A+ M   F  GYN T+L YG T +GK+YTM
Sbjct: 77  GVQGESPSRSFHFDYVFGTNSTQDDVYDFVAEEMLDQFFTGYNSTILAYGQTGSGKSYTM 136

Query: 117 TGDEKLYDGELSEAAGIIPRVLFKLFDTLEVQES----DYMVKCSFIELYNEELKDLLDD 172
            G          +  G+IPR+  ++F+ + + +S    +Y+V  SF+E+Y E++ DLL +
Sbjct: 137 FGP--------IDNRGLIPRICHEIFERIGLLKSSADIEYVVSVSFLEIYLEKVYDLLGE 188

>Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar to
           Ashbya gossypii ACR228C - AER441C - ADR145C
          Length = 478

 Score =  125 bits (314), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 112/174 (64%), Gaps = 7/174 (4%)

Query: 270 YIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYK----NFNGE 325
           YI+ L +  +   +E L+ +++G + R VA T +N+ SSRSH I T+ + +    +F   
Sbjct: 173 YIEGLSDRIVNSCEELLKCIEEGSARRSVAGTAVNENSSRSHAICTINIQQTEIDSFGDT 232

Query: 326 TFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-DKNAHIPFRE 384
             RVS I LVDLAGSE    S  +++R KE  +IN+SL+TL RV+  L+ +K   +P+RE
Sbjct: 233 VERVSSIKLVDLAGSERTKVSKTKDERFKEGTNINKSLMTLRRVVTMLSNNKVTGVPYRE 292

Query: 385 SKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGS 438
           S LTR+L+D+L GN+ T ++A ISP   + EE+ STL YA+ AK+++ +  L +
Sbjct: 293 SLLTRVLRDNLDGNSITCILACISPC--DYEESISTLRYASTAKHVRTEAHLNT 344

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 55/184 (29%), Positives = 89/184 (48%), Gaps = 34/184 (18%)

Query: 14  NITVAVRCRGRNEKEIKAKSSVVVNCPDVI---GANEVSINTSGDIGITARMNSKTYTVD 70
           NI VA+R R +  +E           P VI    +NE+++       +   +   T+  D
Sbjct: 4   NIKVAIRIRDKISRETSR--------PSVIKRKTSNEITLQKDNTANVITTVE-HTFYFD 54

Query: 71  KVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSEA 130
           +VF  S++Q  ++ E+A       ++GY+  ++ YG T  GKTYTM G E        + 
Sbjct: 55  QVFDESSNQKQIYHELAREYILKALEGYHTCVIAYGQTGAGKTYTMMGTE--------QE 106

Query: 131 AGIIPRV---LFKLFDTLEVQESD------YMVKCSFIELYNEELKDLLDDGQDSGGNNS 181
            GIIP V   LFK+ D  + +  D      + V  S+ ++YNE++ D+L     SGG N 
Sbjct: 107 PGIIPLVSHELFKIIDMCQDEGPDEDALVHFKVTVSYFQIYNEQIYDML-----SGGCNV 161

Query: 182 RKLR 185
            ++R
Sbjct: 162 LRVR 165

>ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL079W
           (SMY1)
          Length = 635

 Score =  125 bits (315), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 75/169 (44%), Positives = 104/169 (61%), Gaps = 3/169 (1%)

Query: 268 AIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGE-T 326
            +Y++      ++D  E L  +  G + R   ST MN  SSRSH I  + L K  N E  
Sbjct: 188 GVYVEGATIVSVSDGDELLNCIHLGEAQRYKGSTDMNLESSRSHAIVKINLLKRDNLEGN 247

Query: 327 FRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA--DKNAHIPFRE 384
            + S + LVDLAGSE ++++ A     +EA  IN SL +LG VIN+L   +K  HIP+R+
Sbjct: 248 IQKSDLFLVDLAGSEKVAKTNAVGATLEEAKKINLSLSSLGNVINALTQKEKRTHIPYRD 307

Query: 385 SKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 433
           S+LTRLL+DSLGGN+KT LI   +  K N  ET +TL + ++AK+IKNK
Sbjct: 308 SQLTRLLRDSLGGNSKTTLILNCACDKSNESETLTTLRFGSRAKHIKNK 356

 Score = 83.6 bits (205), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 53/173 (30%), Positives = 86/173 (49%), Gaps = 27/173 (15%)

Query: 4   TNGSPEGDELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMN 63
           ++ + EG +  + V VR R   E    A          V+ A+E ++  +G     A   
Sbjct: 12  SSAADEGADDKMKVVVRLRPLPEGGSAA----------VVAADEGTVEFAG-----AADE 56

Query: 64  SKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLY 123
           ++ +  D VFG  A Q  VF  +A+ M   F  GYN T+L YG T +GK+YTM G     
Sbjct: 57  ARAFRFDYVFGTDARQEEVFDYVAEEMLDQFFTGYNSTILAYGQTGSGKSYTMFGPPG-- 114

Query: 124 DGELSEAAGIIPRVLFKLFDTLEV----QESDYMVKCSFIELYNEELKDLLDD 172
                   G+IPR+  ++F+ + +     + +Y+V  SF+E+Y E++ DLL +
Sbjct: 115 ------HRGLIPRICQQIFERIGLLKNCADIEYVVSVSFLEIYLEKVYDLLGE 161

>KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {ON}
           Anc_3.528 YGL216W
          Length = 672

 Score =  123 bits (309), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 79/212 (37%), Positives = 128/212 (60%), Gaps = 20/212 (9%)

Query: 264 EQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTL---TLYK 320
           +Q+S I + +L      + ++ + L+ +G  +R  + T+ N+VSSRSH++  +    + K
Sbjct: 206 DQNSKISVTNLSYHRPENVQDVIDLVIRGNLNRSSSPTEANEVSSRSHSVLQIHVKQVLK 265

Query: 321 NFN--GETFRV-SKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA--D 375
           NF+  G T ++ S ++++DLAGSE    +  +  R  E  +IN+SLL LG  IN+L    
Sbjct: 266 NFDDIGSTNQIDSTLSIIDLAGSERAITTKNRGIRLYEGANINKSLLALGNCINALCINK 325

Query: 376 KNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKP- 434
           K+ HIP+R+SKLTRLL+ SLGGN KT +I  +SP+ ++ +ET +TL+YA +AK IK K  
Sbjct: 326 KSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSLHYDETLNTLKYANRAKEIKTKVI 385

Query: 435 --------QLGSFMMKDILVKNISHELAKLKS 458
                    +GS++    L+     E+ KLK+
Sbjct: 386 RNQTSLNRHVGSYLK---LITEQKQEIDKLKA 414

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 57/109 (52%), Gaps = 13/109 (11%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  DK+F   + Q  +F++   P+    + G+N T+  YG T  GKTYT+ G        
Sbjct: 92  FIFDKLFDDDSTQEQIFEDTTRPLLDSVLDGFNGTVFAYGATGCGKTYTING-------- 143

Query: 127 LSEAAGIIPRVLFKLFDTLEV-----QESDYMVKCSFIELYNEELKDLL 170
            SE  GII R + +LF  +E+       S   +  S++E+YNE ++DLL
Sbjct: 144 TSEDPGIIFRTMNELFGKIEILLQDSNRSKIEISLSYLEIYNETIRDLL 192

>Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON}
           (54983..56503) [1521 nt, 507 aa]
          Length = 506

 Score =  118 bits (295), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 73/192 (38%), Positives = 108/192 (56%), Gaps = 22/192 (11%)

Query: 268 AIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYK-----NF 322
           ++YI+++ E  +++  + ++ ++ G  +R   ST MN  SSRSH I ++T+ +     N 
Sbjct: 188 SMYIENITEIEVSNIDQMIKCVKMGFRNRTTRSTNMNVNSSRSHAIVSITIKRTDIDLNT 247

Query: 323 NGETFRVSKINLVDLAGSE-NISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK----- 376
           N      S    VDLAGSE + +     N R KE  SIN+SL TL RV+ SL  +     
Sbjct: 248 NSSIISDSICRFVDLAGSERSTATQNCHNDRLKEGNSINKSLSTLRRVLTSLKKREELKY 307

Query: 377 ---------NAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKA 427
                    N  +PFRES LT +L+D+LGGN+KT +IA ISP   N EE++STL YA  A
Sbjct: 308 NSNSNSSAHNIVVPFRESLLTWILKDNLGGNSKTCIIACISPT--NFEESASTLRYADIA 365

Query: 428 KNIKNKPQLGSF 439
           + IK    + ++
Sbjct: 366 QTIKTNSIINTY 377

 Score = 80.1 bits (196), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 59/112 (52%), Gaps = 16/112 (14%)

Query: 70  DKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSE 129
           D+ FG    QS  +K   +    D + GYNC +L YG T +GKTYTM G+ K      ++
Sbjct: 64  DEGFGKINSQSEFYKGSINHFVKDALNGYNCCILAYGQTGSGKTYTMMGESK------ND 117

Query: 130 AAGIIPRVLFKLFDTLE----------VQESDYMVKCSFIELYNEELKDLLD 171
             G+IPR    LF  +E           Q S+Y V CS  E+YNE++ DLL+
Sbjct: 118 TRGVIPRFCEDLFHEIESIKIKDSSDLSQRSEYKVVCSIFEIYNEQIIDLLE 169

>Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  118 bits (295), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 107/175 (61%), Gaps = 12/175 (6%)

Query: 269 IYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKN------F 322
           I + +L   H T  ++ + L+ +G  +R  + T+ N+VSSRSH++  + + +        
Sbjct: 269 IKVANLSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHSVLQIHIMQTNKLVDLT 328

Query: 323 NGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA----DKNA 378
           +  TF  + ++++DLAGSE  S +  +  R  E  +IN+SLL LG  IN+L      +  
Sbjct: 329 SQHTF--ATLSIIDLAGSERASATRNRGIRLHEGANINRSLLALGNCINALCLNDGSRTC 386

Query: 379 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 433
           HIP+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 387 HIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 67.8 bits (164), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 56/106 (52%), Gaps = 10/106 (9%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  DK+F  ++ Q  V+KE   P+    + G+N T+  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQVRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 205

Query: 127 LSEAAGIIPRVLFKLFDTLE--VQESDYMVKCSFIELYNEELKDLL 170
                GII   + +LF+ +     E ++ +  S++E+YNE + DLL
Sbjct: 206 -PSQPGIIFLAMEELFNKISDLKDEKNFEISLSYLEIYNERISDLL 250

>Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  117 bits (294), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 69/177 (38%), Positives = 108/177 (61%), Gaps = 12/177 (6%)

Query: 267 SAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKN----- 321
           S I + +L   H T  ++ + L+ +G  +R  + T+ N+VSSRSH +  + + +      
Sbjct: 267 SHIKVANLSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNKLVD 326

Query: 322 -FNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA----DK 376
             +  TF  + ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L      +
Sbjct: 327 LTSQHTF--ATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGSR 384

Query: 377 NAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 433
           + HIP+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 385 SCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 58/106 (54%), Gaps = 10/106 (9%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  DK+F  ++ QS V+KE   P+    + G+N T+  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQSRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 205

Query: 127 LSEAAGIIPRVLFKLFDTLE--VQESDYMVKCSFIELYNEELKDLL 170
                GII   + +LF+ +     E ++ +  S++E+YNE ++DLL
Sbjct: 206 -PSQPGIIFLAMEELFNKIADLRDEKNFEISLSYLEIYNERIRDLL 250

>Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]
           {ON} YGL216W (KIP3) - 1:1 [contig 188] FULL
          Length = 819

 Score =  117 bits (294), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 107/174 (61%), Gaps = 9/174 (5%)

Query: 269 IYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTL-YKNFNGET- 326
           I + +L    ++  ++ + L+ KG ++R  ++T  N+ SSRSH +  + +  +N   E  
Sbjct: 241 ITVANLSHHPLSTVEDVMDLVIKGNTNRTTSATDANETSSRSHAVLQVHITQRNRTAELT 300

Query: 327 --FRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-----DKNAH 379
              + + ++L+DLAGSE  S +  + +R  E  +IN+SLL LG  IN+L          H
Sbjct: 301 EDHKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCVSGRKRGGYH 360

Query: 380 IPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 433
           +P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YAT+AK IK K
Sbjct: 361 VPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSNHYDETLNTLKYATRAKEIKTK 414

 Score = 65.1 bits (157), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 61/113 (53%), Gaps = 10/113 (8%)

Query: 61  RMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDE 120
           R   + +  D+VF   + Q  V++    P+    + G+N T+  YG T  GKTYT++G  
Sbjct: 119 RSGEQKFVFDRVFDMDSSQIEVYEATTRPLLDSVLDGFNGTVFAYGATGCGKTYTVSG-- 176

Query: 121 KLYDGELSEAAGIIPRVLFKLFDTL-EVQESD-YMVKCSFIELYNEELKDLLD 171
                   E  GII   + +LF  + E+Q++  + +  S++E+YNE ++DLL+
Sbjct: 177 ------TPENPGIIFLTMQELFAKMEELQDTKRFELSASYLEIYNETIRDLLE 223

>Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  117 bits (293), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 68/175 (38%), Positives = 106/175 (60%), Gaps = 12/175 (6%)

Query: 269 IYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKN------F 322
           I + +L   H T  ++ + L+ +G  +R  + T+ N+VSSRSH +  + + +        
Sbjct: 269 IKVANLSYHHPTTVEDVMNLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNKLVDLT 328

Query: 323 NGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA----DKNA 378
           +  TF  + ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L      +  
Sbjct: 329 SQHTF--ATLSVIDLAGSERAAATRNRGLRLHEGANINRSLLALGNCINALCLNDGSRTC 386

Query: 379 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 433
           HIP+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 387 HIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 71.2 bits (173), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 59/106 (55%), Gaps = 10/106 (9%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  DK+F  ++ Q+ V+KE   P+    + GYN T+  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQTQVYKETTSPLLDSVLDGYNSTVFAYGATGCGKTYTVSGT------- 205

Query: 127 LSEAAGIIPRVLFKLFDTLE--VQESDYMVKCSFIELYNEELKDLL 170
                G+I   + +LF+ ++    E ++ +  S++E+YNE ++DLL
Sbjct: 206 -PSQPGVIFLAMEELFNKIDDLKDEKNFEISLSYLEIYNERIRDLL 250

>NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}
           Anc_3.528
          Length = 784

 Score =  116 bits (291), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 69/177 (38%), Positives = 109/177 (61%), Gaps = 14/177 (7%)

Query: 269 IYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYK-----NFN 323
           I + +L   +    +E + L+ KG  +R  + T+ N+VSSRSH +  + + +     +  
Sbjct: 267 ISVSNLSYHNPQTVQEVIDLVIKGNINRTTSPTEANEVSSRSHAVLQIHIMQTNRTADLT 326

Query: 324 GE-TFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA------DK 376
            E TF  + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L       ++
Sbjct: 327 SEHTF--ATLSIIDLAGSERAAATKNRGERLYEGANINRSLLALGNCINALCLTDGGTNR 384

Query: 377 NAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 433
           + HIP+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 385 SCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 56/106 (52%), Gaps = 10/106 (9%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  DK+F   A Q  V++     +    + G+N T+  YG T  GKTYT++G        
Sbjct: 151 FVFDKLFDQDASQETVYQSTTSGLLDSVLDGFNGTVFAYGATGCGKTYTVSGT------- 203

Query: 127 LSEAAGIIPRVLFKLFDTLE--VQESDYMVKCSFIELYNEELKDLL 170
             E  GII RV+ +LF+ +E       + +  S++E+YNE ++DLL
Sbjct: 204 -PEQPGIIFRVMQELFERMEDLKDTKRFELSLSYLEIYNETIRDLL 248

>KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528
           YGL216W
          Length = 723

 Score =  116 bits (290), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 114/415 (27%), Positives = 211/415 (50%), Gaps = 63/415 (15%)

Query: 286 LRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKN------FNGETFRVSKINLVDLAG 339
           L L+ +G  +R  + T+ N VSSRSH +  + + +          +TF    ++++DLAG
Sbjct: 276 LDLVIRGNDNRTTSPTEANSVSSRSHAVLQIHIMQRNKLVDLKEHQTF--GTLSIIDLAG 333

Query: 340 SENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD-----KNAHIPFRESKLTRLLQDS 394
           SE  + +  + +R  E  +IN+SLL LG  IN+L       +N H+P+R+SKLTRLL+ S
Sbjct: 334 SERAAATKNRGRRLHEGANINRSLLALGNCINALCSNDGSHRNQHVPYRDSKLTRLLKFS 393

Query: 395 LGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMKDILVKNISHELA 454
           LGGN KT +I  ISP+  + +ET +TL+YA +AK IK K           +++N    L 
Sbjct: 394 LGGNCKTVMIVCISPSSAHYDETLNTLKYANRAKEIKTK-----------VIRN-HQTLN 441

Query: 455 KLKSDFLSTKSKEGIYMSHLHYNE---VMNDIENYKTEIQESRREIEKLSSQNQLLHKDK 511
           +  + +L   +++   +  L   +   V   I NYK  I++  R IE++       +  K
Sbjct: 442 RHVASYLKMITEQKRTIDELEARQAQMVQVGITNYKLAIEKIERSIEEVVG-----NVCK 496

Query: 512 KSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTN------MIMKLKDAVRNMQG 565
           + S  + ++ +L ++ L  +   L + I ++ +N + + +      +I   +  +R MQ 
Sbjct: 497 QLSSKSFQNIKL-LKALTLTKRTLLQLIVIEVENVLAIVSEWTDQRIIETCERVIRQMQE 555

Query: 566 ALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQALEQSFTIDDDIN--NVKD 623
            +K  ED   R  +  +  L   ++E+ R+I+ K        L +    DD ++  + + 
Sbjct: 556 QVKLLED---RFDTATELNL---VVEHSREIDLK-------RLREMEHWDDTVHLRSFEA 602

Query: 624 SLETLLETVKKDAIIMCENLAQKVVGDQPKF---FN----SMLSELNDMFSKVDE 671
            L+ + E+++K  +I   N+ ++++ D P     FN     ++SE  D+ + ++E
Sbjct: 603 RLDLVYESLQKSILIESSNMTEELMND-PALRARFNFLSKVLVSEDQDIVAALEE 656

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 55/114 (48%), Gaps = 10/114 (8%)

Query: 59  TARMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTG 118
           T   +   +  DK+F     Q  V++     +    + G+N T+  YG T  GKTYT++G
Sbjct: 135 TGSADETKFVFDKLFDTDVSQEDVYRGTTSTLLDSVLDGFNGTVFAYGATGCGKTYTVSG 194

Query: 119 DEKLYDGELSEAAGIIPRVLFKLFDTLEVQES--DYMVKCSFIELYNEELKDLL 170
                     E  GII R + +LF  ++      D+ +  SF+E+YNE + DLL
Sbjct: 195 TR--------ENPGIIFRTMEELFVKMDALAGTKDFELTVSFLEIYNETIHDLL 240

>ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1
          Length = 478

 Score =  114 bits (284), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 108/180 (60%), Gaps = 11/180 (6%)

Query: 268 AIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTL-YKNFNGET 326
           + +++ L+E  + + +E +  + KG  +R V ST MN  SSRSH IF +++  K  + +T
Sbjct: 177 STFVEGLEEIAVHNVEELISCIHKGNENRTVRSTNMNQESSRSHAIFHISVNQKETHKKT 236

Query: 327 FRV----SKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD----KNA 378
             V    S   LVDLAGSE +  + A  +  +E  SIN+SL  LGRVI+ LA+    ++ 
Sbjct: 237 GTVVECHSTCKLVDLAGSERLGSAAADGKIRQEGTSINKSLSILGRVISLLAEGDRQRSQ 296

Query: 379 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGS 438
            IP+RES LT +L+++LGGN+ T L+A +SP   N  E+ STL YA+  K +K    + S
Sbjct: 297 MIPYRESALTWILKENLGGNSNTCLVACVSPE--NYYESLSTLRYASLTKKVKTNATINS 354

 Score = 77.8 bits (190), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 65/120 (54%), Gaps = 21/120 (17%)

Query: 64  SKTYTVDKVFGPS----ADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGD 119
           +K +  D  FG +     DQS++++ +        ++GYN  +L YG T +GKT+TM G+
Sbjct: 49  AKEFRYDHCFGSTDSVDRDQSIIYESLVRGYVLHTLEGYNSCILAYGQTGSGKTFTMMGE 108

Query: 120 EKLYDGELSEAAGIIPRVLFKLFDTLEV-----QES----DYMVKCSFIELYNEELKDLL 170
           +           GI+PR   +LF+   +     QES    D+ VKCSF E+YNE++ DLL
Sbjct: 109 KG--------NEGIVPRFCRELFEVFHMCHQDDQESDIITDFQVKCSFFEIYNEQVIDLL 160

>KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 819

 Score =  115 bits (288), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 69/174 (39%), Positives = 104/174 (59%), Gaps = 9/174 (5%)

Query: 269 IYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTL-YKNFNGET- 326
           I + +L    +   ++ + L+ KG  +R  ++T  N+ SSRSH +  + +  KN   E  
Sbjct: 241 ITVANLSHHPLFTVEDVMDLVVKGNINRTTSATDANETSSRSHAVLQVHITQKNRTAELT 300

Query: 327 --FRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-----DKNAH 379
              + + ++L+DLAGSE  S +  + +R  E  +IN+SLL LG  IN+L          H
Sbjct: 301 EDHKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCAGGKRGGGFH 360

Query: 380 IPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 433
           +P+R+SKLTRLL+ SLGGN KT +I  ISP   + +ET +TL+YAT+AK IK K
Sbjct: 361 VPYRDSKLTRLLKFSLGGNCKTVMIVCISPTSNHYDETLNTLKYATRAKEIKTK 414

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 60/114 (52%), Gaps = 12/114 (10%)

Query: 61  RMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDE 120
           R   + +  D+VF   A Q  V++    P+    + G+N T+  YG T  GKTYT++G  
Sbjct: 119 RSGEQKFVFDRVFDMHASQEEVYEATTRPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT- 177

Query: 121 KLYDGELSEAAGIIPRVLFKLFDTLEVQESD---YMVKCSFIELYNEELKDLLD 171
                  +E  GII   + +LF  +E Q  D   + +  S++E+YNE ++DLL+
Sbjct: 178 -------AENPGIIFLTMQELFAKME-QLKDTKKFELTASYLEIYNESIRDLLE 223

>CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216w KIP3
           kinesin-related protein required for nuclear migration
          Length = 705

 Score =  114 bits (286), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 68/175 (38%), Positives = 103/175 (58%), Gaps = 10/175 (5%)

Query: 269 IYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTL-TLYKNFNG--- 324
           I + +L +   T  +E + L+ +G  +R  + T+ N+VSSRSH +  +  + KN      
Sbjct: 272 ITVANLSQHFPTTVQEVMDLVIRGNFNRTTSPTEANEVSSRSHAVLQIHIVQKNRTPDIK 331

Query: 325 ETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA------DKNA 378
           E      ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L           
Sbjct: 332 EEHTFGTLSIIDLAGSERAAATKNRGARLHEGANINRSLLALGNCINALCINGNDERPRC 391

Query: 379 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 433
           H+P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 392 HVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 446

 Score = 64.7 bits (156), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 54/106 (50%), Gaps = 10/106 (9%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  DK+F   A Q  V++     +    + G+N T+  YG T  GKTYT++G        
Sbjct: 156 FVFDKLFDTDATQREVYQSTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSG-------- 207

Query: 127 LSEAAGIIPRVLFKLFDTLE--VQESDYMVKCSFIELYNEELKDLL 170
             E  GI+ + + +LF  +E       + +  SF+E+YNE ++DLL
Sbjct: 208 TPENPGIVFQAMEELFQKMEDLKDTKSFQISLSFLEIYNERIRDLL 253

>ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {ON}
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 778

 Score =  115 bits (287), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 106/175 (60%), Gaps = 9/175 (5%)

Query: 268 AIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGETF 327
           +I + +L  ++    ++ + L+ KG  +R  ++T  N+ SSRSH +  + + ++      
Sbjct: 243 SIRVSNLSHYNPQKVEDVMDLVIKGNMNRTTSATDANEASSRSHAVLQIHIMQHNRTADL 302

Query: 328 R----VSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-----DKNA 378
           +     + ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L       ++ 
Sbjct: 303 KSDHTFATLSIIDLAGSERAATTKNRGNRLYEGANINRSLLALGNCINALCLNDGTRRSC 362

Query: 379 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 433
           H+P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 363 HVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLKYANRAKEIKTK 417

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 60/106 (56%), Gaps = 10/106 (9%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  D++F   + Q  V++    P+    + G+N T+  YG T  GKTYT++G        
Sbjct: 128 FVFDRLFDVDSTQKDVYESTMIPLLDSVLDGFNGTVFAYGATGCGKTYTISGS------- 180

Query: 127 LSEAAGIIPRVLFKLFDTLE-VQESDYM-VKCSFIELYNEELKDLL 170
             E  GII + + +LF+ +E ++++ +  +  SF+E+YNE ++DLL
Sbjct: 181 -PENPGIIFQAMQELFNRIENLKDTKHFELSLSFLEIYNESIRDLL 225

>TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa]
           {ON} Anc_3.528 YGL216W
          Length = 733

 Score =  114 bits (286), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 100/157 (63%), Gaps = 13/157 (8%)

Query: 288 LLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKN------FNGETFRVSKINLVDLAGSE 341
           L+  G ++R  ++T  N+ SSRSH +  + + ++       +  TF  +K++++DLAGSE
Sbjct: 264 LVVLGNTNRTTSATDANETSSRSHAVLQINIVQSSRTAEITSDHTF--AKLSIIDLAGSE 321

Query: 342 NISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-----DKNAHIPFRESKLTRLLQDSLG 396
             + +  + +R +E  +IN+SLL LG  IN+L       +  H+P+R+SKLTRLL+ SLG
Sbjct: 322 RAASTKNRGERLQEGANINRSLLALGNCINALCISDGTRRTCHVPYRDSKLTRLLKFSLG 381

Query: 397 GNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 433
           GN KT +I  +SP+  + +ET +TL+YA +AK IK K
Sbjct: 382 GNCKTVMIVCVSPSSTHYDETLNTLKYANRAKEIKTK 418

 Score = 61.6 bits (148), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 54/106 (50%), Gaps = 10/106 (9%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  DK+F  +A Q  V+      +    + G+N T+  YG T  GKTYT++G        
Sbjct: 129 FVFDKLFDENATQEEVYSGTTSELLDAVLDGFNGTVFAYGATGCGKTYTVSGT------- 181

Query: 127 LSEAAGIIPRVLFKLFDTLEVQES--DYMVKCSFIELYNEELKDLL 170
             E  G+I   + +LF  +E  E    + +  S++E+YNE ++DLL
Sbjct: 182 -PERPGVIFLAMQELFARMEELEDTRKFEISVSYLEIYNETIRDLL 226

>YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}
           KIP3Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 805

 Score =  114 bits (286), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 67/175 (38%), Positives = 106/175 (60%), Gaps = 12/175 (6%)

Query: 269 IYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKN------F 322
           I + +L   H    ++ + L+ +G  +R  + T+ N+VSSRSH +  + + +        
Sbjct: 269 IKVANLSYHHPNTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNKLVDLT 328

Query: 323 NGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA----DKNA 378
           +  TF  + ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L      ++ 
Sbjct: 329 SQHTF--ATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGSRSC 386

Query: 379 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 433
           HIP+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 387 HIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 58/106 (54%), Gaps = 10/106 (9%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  DK+F  ++ Q+ V+KE   P+    + G+N T+  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDETSSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 205

Query: 127 LSEAAGIIPRVLFKLFDTLE--VQESDYMVKCSFIELYNEELKDLL 170
                GII   + +LF+ +     E D+ +  S++E+YNE ++DLL
Sbjct: 206 -PSQPGIIFLAMEELFNKITDLKDEKDFEISLSYLEIYNERIRDLL 250

>TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {ON}
           Anc_3.479 YPR141C
          Length = 739

 Score =  114 bits (284), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 74/182 (40%), Positives = 105/182 (57%), Gaps = 15/182 (8%)

Query: 264 EQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFN 323
           +QS   Y+ +++ F I +  + + L+ K    R  +ST +N  SSRSH IF + L + +N
Sbjct: 557 DQSKITYVTNIKRFKIENISDTIGLINKSKIKRMTSSTGLNSHSSRSHGIFIIYL-EGYN 615

Query: 324 GETFR--VSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL-------- 373
            +T    +SK+NLVDLAGSE I+ S  Q  R KE  SIN+SL  LG VI++L        
Sbjct: 616 HKTNEKCISKLNLVDLAGSERINFSKVQGDRLKETQSINKSLSCLGDVIHALNRGNKNHL 675

Query: 374 ----ADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKN 429
                 K  HIPFR SKLT LL+ SL G++KT +   +S  + +  ET ++L +ATK  N
Sbjct: 676 NSNDLQKTRHIPFRNSKLTYLLKYSLIGDSKTLMFVNVSSNEAHLNETINSLRFATKVNN 735

Query: 430 IK 431
            K
Sbjct: 736 TK 737

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 64/128 (50%), Gaps = 16/128 (12%)

Query: 63  NSKTYTV--DKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDE 120
           N+ TY+   D VF      S VF EI + +    + GYN  +  YG T +GKTYTM    
Sbjct: 438 NNATYSFEFDHVFKQDEGNSEVFNEI-EQLIQSALDGYNVCIFAYGQTGSGKTYTM---- 492

Query: 121 KLYDGELSEAAGIIP---RVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSG 177
                 L+   G+IP   + +F   D+L+    +Y V C FIELYNE + DL  D   + 
Sbjct: 493 ------LNPNDGVIPMTIKYIFNSMDSLKKNGWEYNVSCEFIELYNENIIDLFRDNGPTK 546

Query: 178 GNNSRKLR 185
            + S ++R
Sbjct: 547 DSISHEIR 554

>NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {ON}
           Anc_3.528
          Length = 868

 Score =  114 bits (284), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 69/185 (37%), Positives = 111/185 (60%), Gaps = 17/185 (9%)

Query: 264 EQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYK--- 320
           ++ S I + +L   +    ++ + L+ +G  +R  +ST+ N+VSSRSH +  + + +   
Sbjct: 302 DKDSKISVSNLSYHYPKSVQDVIDLVIRGNINRSTSSTEANEVSSRSHAVLQIHIMQTNT 361

Query: 321 --NFNGE-TFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA--- 374
             +   E TF  + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L    
Sbjct: 362 KIDLTSEHTF--ATLSIIDLAGSERAAATKNRGERLYEGANINKSLLALGNCINALCIPT 419

Query: 375 ------DKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAK 428
                 +   HIP+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK
Sbjct: 420 NNTRRRNIRYHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAK 479

Query: 429 NIKNK 433
            IK K
Sbjct: 480 EIKTK 484

 Score = 69.3 bits (168), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 37/113 (32%), Positives = 60/113 (53%), Gaps = 10/113 (8%)

Query: 60  ARMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGD 119
           A+ N   +  DK+F  ++ Q  V+      +    + G+N T+  YG T  GKTYT++G 
Sbjct: 184 AKKNEMKFVFDKIFDENSSQDEVYLGTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSGT 243

Query: 120 EKLYDGELSEAAGIIPRVLFKLFDTLE--VQESDYMVKCSFIELYNEELKDLL 170
           +        E  GII RV+ +LF+ +E    E  + +  S++E+YNE + DLL
Sbjct: 244 Q--------ENPGIIFRVMQELFERMEDLKDEKTFQLSISYLEIYNEMIYDLL 288

>SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 809

 Score =  113 bits (282), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 65/156 (41%), Positives = 96/156 (61%), Gaps = 12/156 (7%)

Query: 288 LLQKGLSHRQVASTKMNDVSSRSHTIFTL-TLYKNFNGE-----TFRVSKINLVDLAGSE 341
           L+ +G  +R  + T  N+ SSRSH +  +  + KN   E     TF  + ++++DLAGSE
Sbjct: 271 LVVRGNMNRTTSPTDANETSSRSHAVLQINVVQKNRTAELSEAHTF--ATLSIIDLAGSE 328

Query: 342 NISRSGAQNQRAKEAGSINQSLLTLGRVINSLA----DKNAHIPFRESKLTRLLQDSLGG 397
             S +  + +R  E  +IN+SLL LG  IN+L         H+P+R+SKLTRLL+ SLGG
Sbjct: 329 RASATKNRGERLHEGANINRSLLALGNCINALCVSGRRSTCHVPYRDSKLTRLLKFSLGG 388

Query: 398 NTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 433
           N KT +I  I+P+  + +ET +TL+YA +AK IK K
Sbjct: 389 NCKTVMIVCIAPSSAHYDETLNTLKYANRAKEIKTK 424

 Score = 64.7 bits (156), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 61/112 (54%), Gaps = 10/112 (8%)

Query: 61  RMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDE 120
           R   + +  DK+F   A Q+ V++    P+    + G+N T+  YG T  GKT+T++G  
Sbjct: 130 RSGEQKFVFDKLFDEDATQTEVYESTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISG-- 187

Query: 121 KLYDGELSEAAGIIPRVLFKLFDTLE-VQESDYM-VKCSFIELYNEELKDLL 170
                   E  G+I   + +LF  +E +++S +  +  S++E+YNE ++DLL
Sbjct: 188 ------TPEQPGVIFLTMQELFQRIEDLKDSKHFDLTLSYLEIYNESIRDLL 233

>Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar to
           Ashbya gossypii AER441C
          Length = 833

 Score =  112 bits (280), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 93/307 (30%), Positives = 163/307 (53%), Gaps = 36/307 (11%)

Query: 288 LLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGETFRVSK----INLVDLAGSENI 343
           L+ KG  +R  + T  N+ SSRSH +  + + ++      +  K    ++++DLAGSE  
Sbjct: 265 LVIKGNINRTTSPTDANETSSRSHAVLQIHVVQSSRSVDLKEDKTYATLSIIDLAGSERA 324

Query: 344 SRSGAQNQRAKEAGSINQSLLTLGRVINSLADKN----AHIPFRESKLTRLLQDSLGGNT 399
           S +  + +R  E  +IN+SLL LG  IN+L         H+P+R+SKLTRLL+ SLGGN 
Sbjct: 325 SATKNRGERLHEGSNINKSLLALGNCINALCMTGRRTYCHVPYRDSKLTRLLKFSLGGNC 384

Query: 400 KTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMKDILVKNISHELAKLKSD 459
           KT +I  +SP+  + +ET +TL+YA +AK+IK K           +++N  H L +    
Sbjct: 385 KTVMIVCVSPSSAHYDETLNTLKYANRAKDIKTK-----------VIRN-QHSLDRHVGS 432

Query: 460 FLSTKSKEGIYMSHLHYNEV-MND--IENYK---TEIQESRRE-IEKLSSQNQLLHKDKK 512
           +L   + +   +  L   E  M D  ++ YK    ++Q +  E + +L S  Q+L + ++
Sbjct: 433 YLKMITSQKQEIDELRNREAKMIDLRLQQYKLSRNKLQMAMWEAVNQLKSNYQVLERFQR 492

Query: 513 SSQDTIESQRLQIRN----LQSSMDYLYEKI---DLKHKNEIELTNMIMKLKDAVRNMQG 565
           +   TI+S  L  R+    +QS + +L + +   D++H   +    +  +LK  +R ++ 
Sbjct: 493 AK--TIKSLMLCKRHFLQLVQSEVSHLLQLMDSSDIEHPLILFCRTVSEQLKTKIRELED 550

Query: 566 ALKTHED 572
           +  T +D
Sbjct: 551 SFDTDDD 557

 Score = 64.7 bits (156), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 64/129 (49%), Gaps = 11/129 (8%)

Query: 46  NEVSINTSGDIGITARMNS-KTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLV 104
           N + + + G+I    R N  + +  DK+F   A Q  VF     P+    I G+N T+  
Sbjct: 108 NTMLVGSRGEIRRRMRRNGEQKFMFDKLFDVEATQQDVFLGTTRPLLDSIIDGFNGTVFA 167

Query: 105 YGMTSTGKTYTMTGDEKLYDGELSEAAGIIPRVLFKLFDTLE--VQESDYMVKCSFIELY 162
           YG T  GKT+T++G          E  GII   + +LF  +E       + +  S++E+Y
Sbjct: 168 YGATGCGKTFTISG--------TPENPGIIFLTMQELFQRIENLKDTKTFQLTVSYLEIY 219

Query: 163 NEELKDLLD 171
           NE ++DLL+
Sbjct: 220 NEMIRDLLE 228

>Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON}
           (11134..13554) [2421 nt, 807 aa]
          Length = 806

 Score =  112 bits (279), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 103/176 (58%), Gaps = 9/176 (5%)

Query: 267 SAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGET 326
           S I + +L        ++ + L+ KG  +R  ++T  N+ SSRSH +  + + +      
Sbjct: 260 SKISVANLSHHRPKTVQDVMDLIIKGNINRTTSATDANETSSRSHAVLQIHISQTNRTVD 319

Query: 327 FRVSKI----NLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-----DKN 377
              S +    +++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L       ++
Sbjct: 320 LTSSHVFATLSIIDLAGSERAASTKNRGERLYEGANINKSLLALGNCINALCLNDGTRRS 379

Query: 378 AHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 433
            H+P+R+SKLTRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA +AK IK K
Sbjct: 380 CHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSTHYDETLNTLKYANRAKEIKTK 435

 Score = 62.0 bits (149), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 59/107 (55%), Gaps = 10/107 (9%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  DK+F   + Q  V++     +    + G+N T+  YG T  GKTYT++G        
Sbjct: 146 FIFDKLFNEGSSQLAVYRSTTSLLLDSVLDGFNGTVFAYGATGCGKTYTISGT------- 198

Query: 127 LSEAAGIIPRVLFKLFDTLE-VQES-DYMVKCSFIELYNEELKDLLD 171
             E  GII   + +LF  +E ++++ ++ +  S++E+YNE ++DLL+
Sbjct: 199 -PEQPGIIFLAMEELFQKIENIKDTKNFELTLSYLEIYNESIRDLLN 244

>TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {ON}
           Anc_3.528 YGL216W
          Length = 847

 Score =  112 bits (279), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 102/176 (57%), Gaps = 13/176 (7%)

Query: 269 IYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKN------F 322
           I + +L        +E +  + +G  +R  + T  N+ SSRSH +  + + +        
Sbjct: 244 ITVSNLSHHKPQTVQEVMDFVIRGNMNRTTSPTDANETSSRSHAVLQIHIAQTDRTPDLI 303

Query: 323 NGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-----DKN 377
           +  TF  + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L       + 
Sbjct: 304 SNSTF--ATLSIIDLAGSERAASTKNRGERLIEGANINKSLLALGNCINALCISDGTRRT 361

Query: 378 AHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 433
            H+P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL YA +AK+IK K
Sbjct: 362 CHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLTYANRAKDIKTK 417

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 57/107 (53%), Gaps = 10/107 (9%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  DK+F  +A+Q+ V+      +    + G+N T+  YG T  GKT+T++G        
Sbjct: 128 FVFDKLFDETANQTNVYNSTTSSLLDSVLDGFNGTVFAYGATGCGKTFTISG-------- 179

Query: 127 LSEAAGIIPRVLFKLFDTLEVQE--SDYMVKCSFIELYNEELKDLLD 171
             E  GII   + +LF  +E  +   +  +  S++E+YNE ++DLL+
Sbjct: 180 TPEQPGIIFLTMDELFKRIESLKDTKNIELTLSYLEIYNETIRDLLN 226

>TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa]
           {ON} Anc_3.528 YGL216W
          Length = 801

 Score =  111 bits (277), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 104/178 (58%), Gaps = 13/178 (7%)

Query: 269 IYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYK------NF 322
           I + +L  +     +E + L+ +G  +R  +ST  N+ SSRSH +  + L +      + 
Sbjct: 226 ISVSNLSTYSPATIEEVMDLIIQGNLNRTTSSTHANETSSRSHAVLQIHLTQQNKLNNDI 285

Query: 323 NGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL-------AD 375
           N      S ++++DLAGSE  + +  + +   E  +IN+SLL LG  IN+L       + 
Sbjct: 286 NSTEQLFSTLSIIDLAGSERAASTKNRGETLLEGANINKSLLALGNCINALCINTSSHSQ 345

Query: 376 KNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 433
           +  HIP+R+SKLTRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA +AK IK K
Sbjct: 346 QQIHIPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSKHYDETLNTLKYANRAKEIKTK 403

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 56/107 (52%), Gaps = 10/107 (9%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  DK+   ++ Q  VF+   +P+    + GYN T+  YG T  GKTYT++G        
Sbjct: 110 FIFDKLLDQNSTQQHVFQSTTEPLLDSILDGYNGTVFAYGATGCGKTYTISGT------- 162

Query: 127 LSEAAGIIPRVLFKLFDTLE--VQESDYMVKCSFIELYNEELKDLLD 171
             E  GII   L  LF+ +E      +  +  S++E+YNE +KDLLD
Sbjct: 163 -PENPGIIFLTLQSLFNKIENLKDTKEISISLSYLEIYNESIKDLLD 208

>AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL216W
           (KIP3)
          Length = 818

 Score =  110 bits (276), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 63/166 (37%), Positives = 100/166 (60%), Gaps = 9/166 (5%)

Query: 277 FHITDAKEG-LRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGETFRVSK---- 331
           +H  +  E  + L+ +G  +R  + T  N+ SSRSH +  + + ++      +  K    
Sbjct: 251 YHTPETVEDVMDLVIRGNVNRTTSPTDANETSSRSHAVLQVHVVQSSRTVDLKEDKMYAT 310

Query: 332 INLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKN----AHIPFRESKL 387
           ++++DLAGSE  S +  + +R  E  +IN+SLL LG  IN+L         H+P+R+SKL
Sbjct: 311 LSIIDLAGSERASATKNRGERLHEGSNINKSLLALGNCINALCMTGRRAVCHVPYRDSKL 370

Query: 388 TRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 433
           TRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA +AK+IK K
Sbjct: 371 TRLLKFSLGGNCKTVMIVCVSPSSAHYDETLNTLKYANRAKDIKTK 416

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 65/129 (50%), Gaps = 11/129 (8%)

Query: 46  NEVSINTSGDIGITARMNS-KTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLV 104
           N + + + G++    R N  + +  DK+F   A Q  VF+    P+    + G+N T+  
Sbjct: 106 NTMLVGSRGEVRRRMRRNGEQKFMFDKLFDVDASQQDVFQCTTMPLLDSILDGFNGTVFA 165

Query: 105 YGMTSTGKTYTMTGDEKLYDGELSEAAGIIPRVLFKLFDTLE--VQESDYMVKCSFIELY 162
           YG T  GKT+T++G          ++ GII   + +LF  +        + +  S++E+Y
Sbjct: 166 YGATGCGKTFTISG--------TPDSPGIIFLTMQELFQRINNLKDTKTFELTVSYLEIY 217

Query: 163 NEELKDLLD 171
           NE ++DLL+
Sbjct: 218 NETIRDLLE 226

>Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}
           complement(87351..89429) [2079 nt, 693 aa]
          Length = 692

 Score =  109 bits (272), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 91/149 (61%), Gaps = 6/149 (4%)

Query: 288 LLQKGLSHRQVASTKMNDVSSRSHTIFTLTLY--KNFNGETFRVSKINLVDLAGSENISR 345
           L++K    R  A+T  N+ SSRSH+IF + L    N  GE+     +NLVDLAGSE ++ 
Sbjct: 539 LIKKATKLRATATTAANERSSRSHSIFIIHLRGSNNITGES-SYGILNLVDLAGSERLNS 597

Query: 346 SGAQNQRAKEAGSINQSLLTLGRVINSLADKNA---HIPFRESKLTRLLQDSLGGNTKTA 402
           S  +  R +E  +IN+SL  LG VI++L   +A   HIPFR SKLT LLQ SL GN+KT 
Sbjct: 598 SQVEGARLRETQNINKSLSCLGDVIHALGSSDASKRHIPFRNSKLTYLLQYSLTGNSKTL 657

Query: 403 LIATISPAKINSEETSSTLEYATKAKNIK 431
           +   ISP +   +ET ++L +A+K    K
Sbjct: 658 MFVNISPTQQQIQETLNSLRFASKVNTTK 686

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 74/162 (45%), Gaps = 17/162 (10%)

Query: 12  ELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVDK 71
           EL   + V CR R    +K+   +  N   V   N+   N S +I    R   K +  D+
Sbjct: 345 ELRGNIRVFCRIR--PPLKSVEDINTNHIKVQPFNDNHGNQSMEIVKDHRCIQK-FQFDR 401

Query: 72  VFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSEAA 131
           +F        VF EI   +    + GYN  +  YG T +GKT+TM          L+   
Sbjct: 402 IFDQHEVNKDVFDEIG-QLVQSSLDGYNVCIFAYGQTGSGKTFTM----------LNPND 450

Query: 132 GIIPRVL---FKLFDTLEVQESDYMVKCSFIELYNEELKDLL 170
           G+IP  +   F   D+L+ +  +Y V C F+E+YNE + DLL
Sbjct: 451 GMIPATIDHIFDWTDSLKERGWEYEVSCQFVEIYNENIIDLL 492

>KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa]
           {ON} Anc_3.479 YPR141C
          Length = 764

 Score =  109 bits (272), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 67/153 (43%), Positives = 95/153 (62%), Gaps = 4/153 (2%)

Query: 279 ITDAKEGL-RLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYK-NFNGETFRVSKINLVD 336
           + ++KE + ++L++    R  AST  N+ SSRSH+IF + L+  N   +      +NLVD
Sbjct: 602 VLESKESVDKVLKRATKLRSTASTLSNEHSSRSHSIFIIELHGVNHKTKEESCGVLNLVD 661

Query: 337 LAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA--HIPFRESKLTRLLQDS 394
           LAGSE +  S    +R +E  +IN+SL  LG VI +L DKN   HIPFR SKLT LLQ S
Sbjct: 662 LAGSERVHSSQVTGERLRETQNINRSLSCLGDVIYALNDKNTKRHIPFRNSKLTYLLQYS 721

Query: 395 LGGNTKTALIATISPAKINSEETSSTLEYATKA 427
           L GN+KT +   ISP+  +  ET ++L +A+K 
Sbjct: 722 LVGNSKTLMFVNISPSSSHINETINSLRFASKV 754

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 56/108 (51%), Gaps = 14/108 (12%)

Query: 66  TYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDG 125
           ++  DK+F        VFKE+   +    + GYN  +  YG T +GKTYTM         
Sbjct: 471 SFKFDKIFDTGESNDEVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM--------- 520

Query: 126 ELSEAAGIIPRVLFKLFDTLE-VQES--DYMVKCSFIELYNEELKDLL 170
            L    G+IP  +  +FD +E ++E   +Y + C F+E+YNE + DLL
Sbjct: 521 -LHPNDGVIPATISHIFDWVENLKERGWEYKISCQFVEIYNENIVDLL 567

>KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 769

 Score =  109 bits (272), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 65/176 (36%), Positives = 106/176 (60%), Gaps = 14/176 (7%)

Query: 270 YIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYK-NFNG---- 324
           ++ +L +    + +E + L+ KG  +R  + T  N+ SSRSH +  + + + N       
Sbjct: 241 FVSNLSKHSPENVEEVMDLVIKGNMNRTTSPTDANETSSRSHAVLQIHVAQMNRTADIKQ 300

Query: 325 -ETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKN------ 377
            +TF  + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L   +      
Sbjct: 301 DQTF--ATLSIIDLAGSERAAVTKNRGERLLEGANINRSLLALGNCINALCVSSTRTGFS 358

Query: 378 AHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 433
            H+P+R+SKLTRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA +AK IK K
Sbjct: 359 CHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSGHYDETLNTLKYANRAKEIKTK 414

 Score = 68.6 bits (166), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 60/114 (52%), Gaps = 12/114 (10%)

Query: 61  RMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDE 120
           R   + +  D++F     Q  V++    P+    + G+N T+  YG T  GKT+T++G  
Sbjct: 118 RFGEQKFIFDRIFDMDVTQQEVYENTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISGT- 176

Query: 121 KLYDGELSEAAGIIPRVLFKLFDTLEVQESD---YMVKCSFIELYNEELKDLLD 171
                  SE  GII   + +LF  +E Q  D   + ++ SF+E+YNE++ DLLD
Sbjct: 177 -------SEQPGIIFLTMQELFIRME-QLKDTKKFQLQLSFLEIYNEQIHDLLD 222

>NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {ON}
           Anc_8.678
          Length = 655

 Score =  108 bits (271), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 69/178 (38%), Positives = 101/178 (56%), Gaps = 18/178 (10%)

Query: 268 AIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYK-NFNGET 326
            + +  L+E     ++E ++ +++G SHR+ A T  N  SSRSH I  + L   N    T
Sbjct: 278 GVRVMGLREQRCESSEELMKWIRRGDSHRKTAETDYNARSSRSHAIVLIRLTNTNVIDGT 337

Query: 327 FRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL------------- 373
              S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L             
Sbjct: 338 SISSTLSLCDLAGSE---RATGQQERRKEGAFINKSLLALGTVISKLSAESTAASHGNSP 394

Query: 374 -ADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNI 430
            A+ N HIP+R+SKLTR+LQ +L G++    I TI   K ++ ET +TL +A++AKN+
Sbjct: 395 NANGNGHIPYRDSKLTRILQPALSGDSIVTTICTIDTQKESAAETLNTLRFASRAKNV 452

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 55/115 (47%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  D V+ P      +++ I  PM     +G+N T+  YGMT +GKTYTM G       +
Sbjct: 135 FKFDHVYSPHVSNLEIYESINKPMIDKLFQGFNATVFAYGMTGSGKTYTMMGSGGDGGDD 194

Query: 127 LSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNS 181
                  +  +  K+ +   V E  + V  S++E+YNE + DLLD     GG  +
Sbjct: 195 DGLIPLSVSYLFSKVIEVGLVGERKFDVLLSYLEIYNERIYDLLDSESLVGGTTT 249

>KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]
           {ON} similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141C KAR3 Minus-end-directed microtubule motor that
           functions in mitosis and meiosis localizes to the
           spindle pole body and localization is dependent on
           functional Cik1p required for nuclear fusion during
           mating potential Cdc28p substrate
          Length = 702

 Score =  107 bits (267), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 90/150 (60%), Gaps = 6/150 (4%)

Query: 287 RLLQKGLSHRQVASTKMNDVSSRSHTIFTLTL--YKNFNGETFRVSKINLVDLAGSENIS 344
           R+L++ L  R  A+T  N  SSRSH++F + L  Y   +GE      +NLVDLAGSE I 
Sbjct: 549 RMLRRALKMRSTAATVANSRSSRSHSVFIIKLDGYNTISGEK-STGTLNLVDLAGSERIH 607

Query: 345 RSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA---HIPFRESKLTRLLQDSLGGNTKT 401
               Q +R +E  +IN+SL  LG VI++L   +A   HIPFR SKLT LLQ SL G++KT
Sbjct: 608 SLQPQAERLRETQNINKSLSCLGDVIHALGSADASKRHIPFRNSKLTYLLQYSLMGDSKT 667

Query: 402 ALIATISPAKINSEETSSTLEYATKAKNIK 431
            +   +SP   +  ET ++L +A K  + K
Sbjct: 668 LMFVNVSPCANSMLETLNSLRFAAKVNSTK 697

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 76/164 (46%), Gaps = 25/164 (15%)

Query: 14  NITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKT--YTVDK 71
           NI V  R R   E E  + SS+ +         E   + +G   IT + +SK   +T D+
Sbjct: 363 NIRVFCRLRPALENENYSSSSIEI---------EKFSDETGMQSITIKRDSKQHKFTFDR 413

Query: 72  VFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSEAA 131
            F        VF EI   +    + GYN  +  YG T +GKT+TM          L+   
Sbjct: 414 CFSAQETNGDVFSEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTFTM----------LNPND 462

Query: 132 GIIPRVLFKLFDTLE-VQESDYM--VKCSFIELYNEELKDLLDD 172
           GIIP  L  +F  +E ++E  ++  +   F+E+YNE +KDL  +
Sbjct: 463 GIIPSTLNHIFLWVEKLKELGWVYEITSQFVEIYNENIKDLFKE 506

>SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 706

 Score =  106 bits (265), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 101/170 (59%), Gaps = 6/170 (3%)

Query: 263 NEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTL--YK 320
           +++S   ++ ++    +TD      LL++    R  A+T  N+ SSRSH++F + L  Y 
Sbjct: 529 DQESQTTHVTNVTTCKLTDRDMVDTLLKRAAKLRSTAATGSNERSSRSHSVFIIKLRGYN 588

Query: 321 NFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA-- 378
           +  GE  +   +NLVDLAGSE I+ S     R +E  +IN+SL  LG VI++LA  +A  
Sbjct: 589 SNTGEECQ-GTLNLVDLAGSERINASQVTGDRLRETQNINKSLSCLGDVIHALASPDASK 647

Query: 379 -HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKA 427
            HIPFR SKLT LLQ SL G++KT +   ISP   +  ET ++L +A+K 
Sbjct: 648 RHIPFRNSKLTYLLQYSLLGDSKTLMFVNISPCLDHFNETLNSLRFASKV 697

 Score = 64.7 bits (156), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 55/118 (46%), Gaps = 14/118 (11%)

Query: 56  IGITARMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYT 115
           + IT       +  DK+F P      +F+EI   +    + GYN  +  YG T +GKTYT
Sbjct: 402 MNITRDSKKHEFKFDKIFDPENSNDDIFEEIRQ-LVQSSLDGYNVCIFAYGQTGSGKTYT 460

Query: 116 MTGDEKLYDGELSEAAGIIPRVL---FKLFDTLEVQESDYMVKCSFIELYNEELKDLL 170
           M          L    G+IP  L   F+    L+ +  +Y +   FIE+YNE + DLL
Sbjct: 461 M----------LHPQNGMIPSTLDHIFQWIHLLKERGWEYEISSQFIEIYNETIIDLL 508

>CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {ON}
           similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141c KAR3 kinesin-related protein
          Length = 692

 Score =  105 bits (263), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 91/149 (61%), Gaps = 4/149 (2%)

Query: 287 RLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGETFRVSKI-NLVDLAGSENISR 345
           ++L++    R  AST  N+ SSRSH+IF + L     G   +   I NLVDLAGSE ++ 
Sbjct: 539 KVLKRANKLRSTASTAANEHSSRSHSIFIIHLEGKNEGTGEKSQGILNLVDLAGSERLNS 598

Query: 346 SGAQNQRAKEAGSINQSLLTLGRVINSLADKNA---HIPFRESKLTRLLQDSLGGNTKTA 402
           S    +R +E  SIN+SL  LG VI++L   +    HIPFR SKLT LLQ SL G++KT 
Sbjct: 599 SMVVGERLRETQSINKSLSCLGDVIHALNSPDGQKRHIPFRNSKLTYLLQYSLIGSSKTL 658

Query: 403 LIATISPAKINSEETSSTLEYATKAKNIK 431
           +   ISPA ++  ET ++L +A+K  N K
Sbjct: 659 MFVNISPAALHLNETINSLRFASKVNNTK 687

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 66/136 (48%), Gaps = 17/136 (12%)

Query: 53  SGDIGITA-RMNSKT--YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTS 109
           +GD G+T  R NS+   +  DK+F        +FKE+   +    + GYN  +  YG T 
Sbjct: 380 NGDQGMTINRGNSQVIPFKFDKIFDQQETNDEIFKEVGQ-LIQSSLDGYNVCIFAYGQTG 438

Query: 110 TGKTYTMTGDEKLYDGELSEAAGIIPRVL---FKLFDTLEVQESDYMVKCSFIELYNEEL 166
           +GKTYTM          L+   GI+P  +   F   D L  +   Y V C FIE+YNE +
Sbjct: 439 SGKTYTM----------LNPGDGIVPATINHIFSWIDKLAARGWSYKVSCEFIEIYNENI 488

Query: 167 KDLLDDGQDSGGNNSR 182
            DLL  G  S  NN R
Sbjct: 489 VDLLRSGAPSQENNDR 504

>Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]
           {ON} complement(235625..237718) [2094 nt, 698 aa]
          Length = 697

 Score =  104 bits (260), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 100/153 (65%), Gaps = 6/153 (3%)

Query: 280 TDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGETFRVSK--INLVDL 337
           ++ +E   L+Q+    R+ A T MN+ SSRSH++F + + + FN ++    K  +NLVDL
Sbjct: 543 SNRRELQELVQRLNKVRRTAKTAMNNRSSRSHSVFIVEV-EGFNKDSEERCKGVLNLVDL 601

Query: 338 AGSENISRSG-AQNQRAKEAGSINQSLLTLGRVINSLADKNA--HIPFRESKLTRLLQDS 394
           AGSE ++RSG    +R +E   IN+SL ++G VI++L   +   HIPFR +KLT LL+ S
Sbjct: 602 AGSERMNRSGLVDKERIEETKQINKSLSSVGDVIHALRQGSGSLHIPFRNTKLTYLLKHS 661

Query: 395 LGGNTKTALIATISPAKINSEETSSTLEYATKA 427
           L G++KT ++ T+SP+  +  ET ++L +ATK 
Sbjct: 662 LQGSSKTLMLVTVSPSNSSRNETMNSLRFATKV 694

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 58/114 (50%), Gaps = 14/114 (12%)

Query: 64  SKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLY 123
           S  +  DK+F        VF E+ + +    + G+N  +  YG T +GKTYTM       
Sbjct: 405 SVNFQFDKIFNYDESNRQVFGEVKE-LVQSALDGHNVCIFTYGQTGSGKTYTM------- 456

Query: 124 DGELSEAAGIIPRVLFKLFD---TLEVQESDYMVKCSFIELYNEELKDLLDDGQ 174
              L+E  GIIP  L  + D   +++     Y +K  F+E+YN+ + DLL+DG+
Sbjct: 457 ---LNEEDGIIPSTLDHIIDWTSSMKKLGWQYGLKIKFVEIYNDRIFDLLNDGK 507

>TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON}
           Anc_3.479 YPR141C
          Length = 676

 Score =  104 bits (260), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 70/175 (40%), Positives = 103/175 (58%), Gaps = 8/175 (4%)

Query: 263 NEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNF 322
           ++ S    +++L+   +T  +    +L+  +  R  AST  N+ SSRSH+IF + ++   
Sbjct: 498 DDASKTTVVENLETITLTSKESVDAVLKNAMKLRATASTSSNERSSRSHSIFIIKIH-GI 556

Query: 323 N---GETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA- 378
           N   GE  R   +NL+DLAGSE +S S  Q++R KE   IN+SL  LG V+NSL   +A 
Sbjct: 557 NEGLGEE-RNGLLNLIDLAGSERLSVSKVQSERIKETQHINKSLSFLGNVMNSLGSPDAT 615

Query: 379 --HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIK 431
             HI FR+SKLT LLQ SL GN+KT ++  IS +  +  ET  +L +A K  + K
Sbjct: 616 TRHISFRDSKLTYLLQYSLTGNSKTLMVVNISSSSDHINETIKSLNFAKKVNSTK 670

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 63/121 (52%), Gaps = 16/121 (13%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           Y+ DKVF  +     +FKE+++ +    + G+N  +  YG T +GKT+TM          
Sbjct: 383 YSFDKVFSQTDTNQEIFKEVSE-LIQSSLDGFNVCIFAYGQTGSGKTFTM---------- 431

Query: 127 LSEAAGIIPRVLFKLFDTLEVQESD---YMVKCSFIELYNEELKDLL--DDGQDSGGNNS 181
           L+   GIIP     +FD ++    +   Y V C F+E+YN+E+ DLL  DD + +  N  
Sbjct: 432 LNPKDGIIPSTAKHIFDWIDNSAKNGWKYNVTCEFLEIYNDEIYDLLRSDDNKSNSSNGP 491

Query: 182 R 182
           R
Sbjct: 492 R 492

>Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON}
           (11880..13742) [1863 nt, 621 aa]
          Length = 620

 Score =  103 bits (256), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 66/174 (37%), Positives = 101/174 (58%), Gaps = 15/174 (8%)

Query: 268 AIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKN--FNGE 325
            + +  L E      +E L  ++ G  HR+ +ST  N  SSRSH I  + L  +   +GE
Sbjct: 230 GVRVIGLTEKRCQSHEELLNWIKLGDKHRKTSSTDFNTRSSRSHAIILIRLISSDLSSGE 289

Query: 326 TFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK--------- 376
               S ++L DLAGSE ++   AQ++R +E   IN+SLL LG VI+ L+ +         
Sbjct: 290 VV-TSTLSLCDLAGSERVT---AQHERRQEGSFINKSLLALGTVISKLSAEVNNSTESVN 345

Query: 377 NAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNI 430
           N+HIP+R+SKLTR+LQ +L GN+    I TI  +   + E+ +TL +A++AKN+
Sbjct: 346 NSHIPYRDSKLTRILQPALSGNSIVTTICTIDTSVDATNESVNTLRFASRAKNV 399

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/109 (37%), Positives = 58/109 (53%), Gaps = 12/109 (11%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           YT D VF P A    V+     P+      G+N T+  YGMT +GKTYTM+G     DG 
Sbjct: 104 YTYDNVFHPDASNFDVYAATCKPLIDKLFDGFNSTVFAYGMTGSGKTYTMSG----VDGN 159

Query: 127 LSEAAGIIP----RVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLD 171
               AG+IP     +  K+FD+   +   Y    S++E+YNE++ DLL+
Sbjct: 160 ----AGLIPLSVAYMYSKIFDSTIHENKKYDTLVSYLEIYNEKIYDLLE 204

>AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR141C (KAR3)
          Length = 709

 Score =  103 bits (256), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 67/172 (38%), Positives = 102/172 (59%), Gaps = 6/172 (3%)

Query: 265 QSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLY-KNFN 323
           +    YI ++    +T   +   +L+K    R  A+T+ N+ SSRSH++F + +  +N +
Sbjct: 535 EKQGTYITNVTRMKMTSTSQVDTILKKASKMRSTAATRSNERSSRSHSVFMVHINGRNLH 594

Query: 324 -GETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA---H 379
            GET +  K+NLVDLAGSE I+ S    +R +E  +IN+SL  LG VI +L   +A   +
Sbjct: 595 TGETSQ-GKLNLVDLAGSERINSSAVTGERLRETQNINKSLSCLGDVIYALNTPDAGKRY 653

Query: 380 IPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIK 431
           IPFR SKLT LLQ SL G++KT +   I P   +  ET ++L +A+K  + K
Sbjct: 654 IPFRNSKLTYLLQYSLVGDSKTLMFVNIPPDPNHISETLNSLRFASKVNSTK 705

 Score = 74.7 bits (182), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 53/170 (31%), Positives = 81/170 (47%), Gaps = 22/170 (12%)

Query: 9   EGDELNITVAVRCRGRNE--KEIKAKSSVVVN-CPDVIGANEVSINTSGDIGITARMNSK 65
           E  EL   + V CR R     E +  S +++    +  GA  ++IN +       R+ S 
Sbjct: 359 ELQELRGNIRVYCRVRPPLLNEPQDMSHILIEKFNEAKGAQSLTINRN-----EGRILSY 413

Query: 66  TYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDG 125
            +  D +F PS     +F+EI   +    + GYN  +  YG T +GKTYTM         
Sbjct: 414 NFQFDMIFEPSHTNKEIFEEIRQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM--------- 463

Query: 126 ELSEAAGIIPRVL---FKLFDTLEVQESDYMVKCSFIELYNEELKDLLDD 172
            L+   G+IP  L   FK    L+ +  +Y ++C +IE+YNE + DLL D
Sbjct: 464 -LNAGDGMIPMTLSHIFKWTANLKERGWNYEMECEYIEIYNETILDLLRD 512

>KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa]
           {ON} Anc_3.479 YPR141C
          Length = 706

 Score =  102 bits (255), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 88/149 (59%), Gaps = 4/149 (2%)

Query: 287 RLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLY-KNFNGETFRVSKINLVDLAGSENISR 345
           ++L +    R  ASTK N+ SSRSH+IF + L+ KN          +NLVDLAGSE I+ 
Sbjct: 554 KVLHRATKLRSTASTKSNEHSSRSHSIFIIHLHGKNSKTNEDSYGILNLVDLAGSERINS 613

Query: 346 SGAQNQRAKEAGSINQSLLTLGRVI---NSLADKNAHIPFRESKLTRLLQDSLGGNTKTA 402
           S    +R +E   IN+SL  LG VI   NS   K  HIPFR SKLT LL+ SL GN+KT 
Sbjct: 614 SQVSGERLRETQHINKSLSCLGDVIHALNSSEHKERHIPFRNSKLTHLLKYSLSGNSKTL 673

Query: 403 LIATISPAKINSEETSSTLEYATKAKNIK 431
           +   IS +  +  ET ++L +A+K  + K
Sbjct: 674 MFVNISASLNHVNETINSLRFASKVNSTK 702

 Score = 82.0 bits (201), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 63/122 (51%), Gaps = 14/122 (11%)

Query: 58  ITARMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMT 117
           IT   N+  Y  DK+F      S +FKE+   +    + GYN  +  YG T +GKT+TM 
Sbjct: 412 ITKNNNTNKYKFDKIFDQFESNSEIFKEVGQ-LVQSALDGYNVCIFAYGQTGSGKTFTM- 469

Query: 118 GDEKLYDGELSEAAGIIP---RVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQ 174
                    L+ + GIIP   R +F   D L+ +  +Y + C F+E+YNE + DLL + Q
Sbjct: 470 ---------LNPSDGIIPSTVRHIFTWIDNLKERGWEYQINCQFVEIYNENIIDLLREKQ 520

Query: 175 DS 176
            S
Sbjct: 521 TS 522

>TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {ON}
           Anc_3.479 YPR141C
          Length = 704

 Score =  102 bits (254), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 91/152 (59%), Gaps = 12/152 (7%)

Query: 288 LLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGETFRVSK-----INLVDLAGSEN 342
           LL++    R  AST  N+ SSRSH+IF + L    +GE     +     +NLVDLAGSE 
Sbjct: 549 LLKRANKLRSTASTACNERSSRSHSIFIVHL----SGENVLTGERSHGILNLVDLAGSER 604

Query: 343 ISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA---HIPFRESKLTRLLQDSLGGNT 399
           I+ S    +R +E  SIN+SL  LG VI++L   +A   HIPFR SKLT LLQ SL GN+
Sbjct: 605 INTSQVIGERLRETQSINKSLSCLGDVIHALGSADASKRHIPFRNSKLTYLLQYSLTGNS 664

Query: 400 KTALIATISPAKINSEETSSTLEYATKAKNIK 431
           KT +   IS    ++ ET ++L +A+K  + K
Sbjct: 665 KTLMFVNISGNPNHTNETLNSLRFASKVNSTK 696

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 57/118 (48%), Gaps = 14/118 (11%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  D++F        VF+EI   +    + GYN  +  YG T +GKTYTM          
Sbjct: 403 FKFDRIFNEKETNYDVFQEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM---------- 451

Query: 127 LSEAAGIIPRVLFKLFD---TLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNS 181
           L+   GIIP  +  +F+    L+ +   Y V C F+E+YNE + DLL   +   G+ S
Sbjct: 452 LNPTDGIIPATITHIFNWTKNLKERGWRYDVSCQFVEIYNETIADLLRREEKPAGSAS 509

>ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 731

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 67/149 (44%), Positives = 91/149 (61%), Gaps = 6/149 (4%)

Query: 288 LLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGETFRVSK--INLVDLAGSENISR 345
           LL+K    R  AST  N+ SSRSH++F + L K  N  T   S   +NLVDLAGSE I+ 
Sbjct: 566 LLRKANRLRSTASTSANERSSRSHSVFIIFL-KGSNHLTGEQSDGILNLVDLAGSERINS 624

Query: 346 SGAQNQRAKEAGSINQSLLTLGRVINSLADKNA---HIPFRESKLTRLLQDSLGGNTKTA 402
           S    +R +E  +IN+SL  LG V+++L   +A   HIPFR SKLT LLQ SL GN+KT 
Sbjct: 625 SQVLGERLRETQNINKSLSCLGDVVHALGSNDAAKRHIPFRNSKLTYLLQYSLTGNSKTL 684

Query: 403 LIATISPAKINSEETSSTLEYATKAKNIK 431
           +   IS  + +  ET ++L +A+K  + K
Sbjct: 685 MFVNISACESHLNETLNSLRFASKVNSTK 713

 Score = 74.7 bits (182), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 76/166 (45%), Gaps = 18/166 (10%)

Query: 14  NITVAVRCRGRNEKEIKAKSSVVVN-CPDVIGANEVSINTSGDIGITARMNSKTYTVDKV 72
           NI V  R R   + E    + + VN   D  G   + I  S + G +   N   +  D++
Sbjct: 377 NIRVFCRIRPPLKYENPNTAHLTVNKFDDENGCQTMEIVKSNNTGNSIPQN---FKFDRI 433

Query: 73  FGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSEAAG 132
           F  +     VF+EI   +    + GYN  +  YG T +GKTYTM          L+   G
Sbjct: 434 FDQNETNENVFEEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM----------LNPRNG 482

Query: 133 IIPRVL---FKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQD 175
           IIP  +   F   + L+ +  +Y + C FIE+YNE + DLL   QD
Sbjct: 483 IIPATISHIFSWIENLKERGWNYEINCQFIEIYNENIADLLRSDQD 528

>Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {ON}
           YPR141C (REAL)
          Length = 731

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 65/146 (44%), Positives = 90/146 (61%), Gaps = 6/146 (4%)

Query: 287 RLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGETFRVS--KINLVDLAGSENIS 344
           R+L++    R  AST  N+ SSRSH+IF + L    N +T   S   +NLVDLAGSE I+
Sbjct: 575 RVLKRANKLRSTASTASNEHSSRSHSIFIIHL-SGLNAKTGAQSYGTLNLVDLAGSERIN 633

Query: 345 RSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA---HIPFRESKLTRLLQDSLGGNTKT 401
            S     R +E  +IN+SL  LG VI++L   ++   HIPFR SKLT LLQ SL G++KT
Sbjct: 634 ISQVVGDRLRETQNINKSLSCLGDVIHALGQPDSAKRHIPFRNSKLTYLLQYSLTGDSKT 693

Query: 402 ALIATISPAKINSEETSSTLEYATKA 427
            +   ISP+  +  ET ++L +A+K 
Sbjct: 694 LMFVNISPSSSHINETLNSLRFASKV 719

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 53/107 (49%), Gaps = 14/107 (13%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  DK+F        VFKE+   +    + GYN  +  YG T +GKT+TM          
Sbjct: 436 FKFDKIFDQRNTNEDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM---------- 484

Query: 127 LSEAAGIIPRVL---FKLFDTLEVQESDYMVKCSFIELYNEELKDLL 170
           L+   GIIP  +   F   + L+ +  DY V C FIE+YNE + DLL
Sbjct: 485 LNPGDGIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNENIVDLL 531

>Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C
           (KIP2) - kinesin-related protein [contig 68] FULL
          Length = 715

 Score =  101 bits (251), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 72/203 (35%), Positives = 109/203 (53%), Gaps = 24/203 (11%)

Query: 268 AIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKN---FNG 324
            + +  L E  +  +++ L+ +  G ++R+   T  N  SSRSH I TL L         
Sbjct: 277 GVRVMGLTEQRVYSSEDVLKWISLGDTNRRTGETDYNTRSSRSHAIVTLNLACTDLVSGA 336

Query: 325 ETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK-------- 376
           ET   S ++L DLAGSE   R+  Q++R KE   IN+SLL LG VI+ L+          
Sbjct: 337 ET--TSTLSLCDLAGSE---RAAGQHERRKEGAFINKSLLALGTVISKLSASSMHTTPSF 391

Query: 377 -NAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNI----- 430
            N+HIP+R+SKLTR+LQ +L G +    I TI        ET +T+ +A++AKN+     
Sbjct: 392 GNSHIPYRDSKLTRILQPALSGESIVTTICTIDTRLDAMSETVNTIRFASRAKNVSMTVK 451

Query: 431 KNKPQLGSFMMKDILVKNISHEL 453
           +N+ +L     KD L+ N+  +L
Sbjct: 452 RNEAELAH--EKDALIHNLRRQL 472

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 58/108 (53%), Gaps = 11/108 (10%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  D VF P ++   V+++I  PM     +GYN  +  YGMT +GKT+TM+G        
Sbjct: 139 FKFDNVFRPQSNNYEVYQQIGKPMIDRLFQGYNAIIFAYGMTGSGKTFTMSGT------- 191

Query: 127 LSEAAGIIPRVLFKLFDTL---EVQESDYMVKCSFIELYNEELKDLLD 171
             E AG+I   +  +F  +    +    + V  S++E+YNE++ DLL+
Sbjct: 192 -PEEAGLISLSVEHIFAQIMSESLANKSFQVTVSYLEIYNEKIYDLLN 238

>TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {ON}
           Anc_3.479 YPR141C
          Length = 724

 Score =  100 bits (250), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 92/149 (61%), Gaps = 6/149 (4%)

Query: 288 LLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGETFRVSK--INLVDLAGSENISR 345
           +L+K    R  A+T  N+ SSRSH++F + L K  N  T   S+  +NLVDLAGSE ++ 
Sbjct: 571 VLKKATKLRATAATNSNERSSRSHSVFMIYL-KGKNEITGDSSEGILNLVDLAGSERLNS 629

Query: 346 SGAQNQRAKEAGSINQSLLTLGRVINSLADKN---AHIPFRESKLTRLLQDSLGGNTKTA 402
           S A   R +E  +IN+SL  LG VI++L   +    HIPFR SKLT LLQ SL G++KT 
Sbjct: 630 SQAVGARLRETQNINKSLSCLGDVIHALGQNDNTKRHIPFRNSKLTYLLQYSLTGSSKTL 689

Query: 403 LIATISPAKINSEETSSTLEYATKAKNIK 431
           +   ISP K +  ET ++L +A+K  + K
Sbjct: 690 MFVNISPTKSHLNETINSLRFASKVNSTK 718

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 66/129 (51%), Gaps = 18/129 (13%)

Query: 64  SKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLY 123
           S+ Y  D++F  +   + VFKEI   +    + G+N  +  YG T +GKTYTM       
Sbjct: 427 SQIYKFDRIFDQADSNTEVFKEIG-QLVQSSLDGHNVCIFAYGQTGSGKTYTM------- 478

Query: 124 DGELSEAAGIIPRVLFKLFDTLEVQESD---YMVKCSFIELYNEELKDLL----DDGQDS 176
              L++  G+IP  +  +FD  E  +     Y + C FIE+YNE + DLL     DG ++
Sbjct: 479 ---LNDNDGMIPATISHIFDWTESMKEKGWIYDISCQFIEIYNEGIIDLLRDNSTDGNEA 535

Query: 177 GGNNSRKLR 185
           G  N  ++R
Sbjct: 536 GSPNKHEIR 544

>NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {ON}
           Anc_3.479 YPR141C
          Length = 698

 Score =  100 bits (250), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 92/150 (61%), Gaps = 8/150 (5%)

Query: 288 LLQKGLSHRQVASTKMNDVSSRSHTIFTLTLY--KNFNGE-TFRVSKINLVDLAGSENIS 344
           +L++    R  AST  N+ SSRSH+IF + L    +  GE ++ +  +NLVDLAGSE I+
Sbjct: 548 ILKRANKLRSTASTGSNEHSSRSHSIFIIHLRGSNSLTGEESYGI--LNLVDLAGSERIN 605

Query: 345 RSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA---HIPFRESKLTRLLQDSLGGNTKT 401
            S     R +E  +IN+SL  LG VI++L   +    HIPFR SKLT LLQ SL GN+KT
Sbjct: 606 SSQVTGDRLRETQNINRSLSCLGDVIHALGGPDQGKRHIPFRNSKLTYLLQYSLTGNSKT 665

Query: 402 ALIATISPAKINSEETSSTLEYATKAKNIK 431
            +   ISP+  +  ET ++L +A+K  + K
Sbjct: 666 LMFVNISPSANHINETINSLRFASKVNSTK 695

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 79/173 (45%), Gaps = 25/173 (14%)

Query: 9   EGDELNITVAVRCRGRNE-KEIKAKSSVVVNCPDVIGANEVSINTSGDI--GITARMNSK 65
           E  EL   + V CR R     I++K +  +   D    N +    S ++  GI    N+ 
Sbjct: 341 ELQELRGKIRVYCRIRPPLPNIESKDTAHIKVEDFDDDNGIQ---SMEVMKGIEVNNNNA 397

Query: 66  T-----YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDE 120
           T     +  DK+F  +   + VFKE+   +    + GYN  +  YG T +GKTYTM    
Sbjct: 398 TQIPQRFKFDKIFNQTDTNADVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM---- 452

Query: 121 KLYDGELSEAAGIIPRVLFKLFD---TLEVQESDYMVKCSFIELYNEELKDLL 170
                 L    GIIP  +  +F+    L+ +   Y + C F+E+YNE + DLL
Sbjct: 453 ------LRPKDGIIPSTIKHIFNWTKNLKERGWHYEIDCQFVEIYNENIIDLL 499

>KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {ON}
           Anc_8.678 YPL155C
          Length = 658

 Score =  100 bits (248), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 76/223 (34%), Positives = 112/223 (50%), Gaps = 36/223 (16%)

Query: 268 AIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYK-NFNGET 326
            + I  L E     ++E ++ ++ G S+R+ + T+ N  SSRSH +  + L   N    +
Sbjct: 266 GVKITGLNEERCDTSQELMKWIKYGDSNRKTSETEYNLRSSRSHAVILVRLVTHNVIDGS 325

Query: 327 FRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA------------ 374
              S + L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L+            
Sbjct: 326 KTSSTLTLCDLAGSE---RAAGQQERRKEGAFINKSLLALGTVISKLSAESLSNSKHVSN 382

Query: 375 ------------DKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLE 422
                       + N HIP+R+SKLTRLLQ +L GN+    I TI P      ET +TL 
Sbjct: 383 PMGPPASPSLNSNGNNHIPYRDSKLTRLLQPALSGNSAVTTICTIDPRMETYAETINTLR 442

Query: 423 YATKAKNI-------KNKPQLG-SFMMKDILVKNISHELAKLK 457
           +A++AKN+       KN   +  S + KD ++K ++  L K K
Sbjct: 443 FASRAKNVSLRFNIKKNLSTISKSEVEKDKIIKELTFRLEKQK 485

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 45/116 (38%), Positives = 63/116 (54%), Gaps = 9/116 (7%)

Query: 59  TARMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTG 118
           T   N+  Y  D VF P  D   ++K  A P+      G+N T+  YGMT +GKTYTM G
Sbjct: 125 TINTNNDEYKFDHVFSPHVDNFEIYKTTAIPLIDKLFTGFNATLFCYGMTGSGKTYTMMG 184

Query: 119 DEKLYDGELSEAAGIIPRVLFKLFDTLEVQESD--YMVKCSFIELYNEELKDLLDD 172
           D +  D       GI+P  +  LF+ +    +D  Y V  S++E+YNE++ DLLDD
Sbjct: 185 DNENPD-------GIVPLSVSLLFNQVLNSRNDKKYDVILSYLEIYNEKIYDLLDD 233

>KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 690

 Score =  100 bits (248), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 61/139 (43%), Positives = 88/139 (63%), Gaps = 4/139 (2%)

Query: 296 RQVASTKMNDVSSRSHTIFTLTLYKNFNGETFRVSK--INLVDLAGSENISRSGAQNQRA 353
           + +A+T  N+ SSRSH++FT+ ++   N  T   S   +NLVDLAGSE I  S     R 
Sbjct: 549 KSIAATNSNERSSRSHSVFTIRIHGT-NSITGEASDGVLNLVDLAGSERIDTSNVTGDRL 607

Query: 354 KEAGSINQSLLTLGRVINSLADKN-AHIPFRESKLTRLLQDSLGGNTKTALIATISPAKI 412
           +E  +IN+SL  LG VI +L  K+  HIPFR SKLT LLQ SL G++KT +   +SP+  
Sbjct: 608 RETQNINKSLSCLGDVIYALNGKDMKHIPFRNSKLTYLLQYSLIGDSKTLMFVNVSPSSN 667

Query: 413 NSEETSSTLEYATKAKNIK 431
           + +ET ++L +A+K  + K
Sbjct: 668 HVKETLNSLRFASKVNSTK 686

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 76/160 (47%), Gaps = 21/160 (13%)

Query: 14  NITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVDKVF 73
           NI V  R R   E E++  S + V+  D       + N S  I I+    +  +  DKVF
Sbjct: 358 NIRVYCRIRPPLENEVQDISHIHVSNFD-------NRNGSQAIEISNEDRNSRFLFDKVF 410

Query: 74  GPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSEAAGI 133
             +A    VF+E+   +    + GYN  +  YG T +GKTYTM  D            G+
Sbjct: 411 SSNASNRDVFEEVGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTMMND----------PDGV 459

Query: 134 IPRVLFKLFDT---LEVQESDYMVKCSFIELYNEELKDLL 170
           IP  L  +FD    L+ +  DY  +  FIE+YNE++ DLL
Sbjct: 460 IPMTLDHIFDWTHLLKERGWDYSFEAQFIEIYNEQIVDLL 499

>YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON}
           KAR3Minus-end-directed microtubule motor that functions
           in mitosis and meiosis, localizes to the spindle pole
           body and localization is dependent on functional Cik1p,
           required for nuclear fusion during mating; potential
           Cdc28p substrate
          Length = 729

 Score =  100 bits (248), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 63/144 (43%), Positives = 86/144 (59%), Gaps = 4/144 (2%)

Query: 288 LLQKGLSHRQVASTKMNDVSSRSHTIFTLTLY-KNFNGETFRVSKINLVDLAGSENISRS 346
           +L+K    R  AST  N+ SSRSH+IF + L   N          +NLVDLAGSE I+ S
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNAKTGAHSYGTLNLVDLAGSERINVS 636

Query: 347 GAQNQRAKEAGSINQSLLTLGRVINSLADKNA---HIPFRESKLTRLLQDSLGGNTKTAL 403
                R +E  +IN+SL  LG VI++L   ++   HIPFR SKLT LLQ SL G++KT +
Sbjct: 637 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 404 IATISPAKINSEETSSTLEYATKA 427
              ISP+  +  ET ++L +A+K 
Sbjct: 697 FVNISPSSSHINETLNSLRFASKV 720

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 51/166 (30%), Positives = 77/166 (46%), Gaps = 17/166 (10%)

Query: 9   EGDELNITVAVRCRGRNE-KEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTY 67
           E  EL   + V CR R   K ++   + ++N  +    + V       I  TA+++   +
Sbjct: 379 ELQELRGNIRVYCRIRPALKNLENSDTSLINVNEFDDNSGVQSMEVTKIQNTAQVHE--F 436

Query: 68  TVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGEL 127
             DK+F        VFKE+   +    + GYN  +  YG T +GKT+TM          L
Sbjct: 437 KFDKIFDQQDTNVDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM----------L 485

Query: 128 SEAAGIIPRVL---FKLFDTLEVQESDYMVKCSFIELYNEELKDLL 170
           +   GIIP  +   F   + L+ +  DY V C FIE+YNE + DLL
Sbjct: 486 NPGDGIIPSTISHIFNWINKLKTKGWDYKVNCEFIEIYNENIVDLL 531

>KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 668

 Score = 99.8 bits (247), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 100/172 (58%), Gaps = 13/172 (7%)

Query: 268 AIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLY--KNFNGE 325
            + +  L E +++  KE ++ +  G  +R+   T  N  SSRSH +  + ++      GE
Sbjct: 235 GVKVVGLVERNVSSNKELMKCISIGDHNRKTGETDFNTRSSRSHAVVLIRVFCTDEITGE 294

Query: 326 TFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA------- 378
              +S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L+ +++       
Sbjct: 295 QV-MSTLSLCDLAGSE---RATGQQERRKEGAYINKSLLALGTVISKLSMESSGLSTNVG 350

Query: 379 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNI 430
           HIP+R+SKLTR+LQ +L G++  A I T+      S E+ +T+ +A++AKNI
Sbjct: 351 HIPYRDSKLTRILQPALSGDSLVATICTVDTRPETSTESINTIRFASRAKNI 402

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 61/110 (55%), Gaps = 10/110 (9%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  D VF P  +   V++ +A PM     +G+NCT+  YGMT +GKTYTM+G +      
Sbjct: 106 FNFDHVFSPEMNNDRVYETMALPMIDKLFEGFNCTIFAYGMTGSGKTYTMSGSK------ 159

Query: 127 LSEAAGIIPRVLFKLFDTLEV--QESDYMVKCSFIELYNEELKDLLDDGQ 174
                GIIP  +  +FD + V      + V+ S++E+YNE + DLL+  Q
Sbjct: 160 --SGPGIIPMCVDTIFDRINVGLPRKKFTVRVSYLEIYNERIFDLLNLPQ 207

>Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 65/145 (44%), Positives = 90/145 (62%), Gaps = 6/145 (4%)

Query: 288 LLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGETFRVS--KINLVDLAGSENISR 345
           +L+K    R  AST  N+ SSRSH+IF + L  + N +T   S   +NLVDLAGSE I+ 
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFMIHLSGS-NAKTGAQSYGTLNLVDLAGSERINI 635

Query: 346 SGAQNQRAKEAGSINQSLLTLGRVINSLADKNA---HIPFRESKLTRLLQDSLGGNTKTA 402
           S     R +E  +IN+SL  LG VI++L   ++   HIPFR SKLT LLQ SL G++KT 
Sbjct: 636 SQVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTL 695

Query: 403 LIATISPAKINSEETSSTLEYATKA 427
           +   ISP+  +  ET ++L +A+K 
Sbjct: 696 MFVNISPSSSHINETLNSLRFASKV 720

 Score = 75.1 bits (183), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 61/124 (49%), Gaps = 21/124 (16%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTM--TGDEKLYD 124
           +  DK+F        VFKE+   +    + GYN  +  YG T +GKT+TM  TGD     
Sbjct: 436 FKFDKIFDQQNTNEDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTMLNTGD----- 489

Query: 125 GELSEAAGIIPRVL---FKLFDTLEVQESDYMVKCSFIELYNEELKDLLDD---GQDSGG 178
                  GIIP  +   F   + L+ +  DY V C FIE+YNE + DLL +   G+D   
Sbjct: 490 -------GIIPSTISHIFSWINKLKTKGWDYKVNCEFIEIYNENIVDLLRNDSIGKDDTN 542

Query: 179 NNSR 182
            NS+
Sbjct: 543 TNSK 546

>Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar to
           Ashbya gossypii AGR253W
          Length = 711

 Score = 99.4 bits (246), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 65/169 (38%), Positives = 100/169 (59%), Gaps = 6/169 (3%)

Query: 268 AIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGETF 327
           A  I ++ +  +T  ++   +L++    R  A T+ N+ SSRSH++F + +    N +T 
Sbjct: 540 ATSITNVTKMKMTSQEQVDSMLKRASRMRSTACTRSNERSSRSHSVFMVHI-NGHNDQTG 598

Query: 328 RVS--KINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA---HIPF 382
            VS  K+NL+DLAGSE I+ S     R +E  +IN+SL  LG VI +L   +A   HIPF
Sbjct: 599 EVSHGKLNLIDLAGSERINSSLVTGDRLRETQNINKSLSCLGDVIYALNSPDAAKRHIPF 658

Query: 383 RESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIK 431
           R SKLT LLQ SL G++KT +   I   + ++ ET ++L +A+K  + K
Sbjct: 659 RNSKLTYLLQYSLIGDSKTLMFVNIPSDQKHTNETLNSLRFASKVNSTK 707

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 55/114 (48%), Gaps = 14/114 (12%)

Query: 60  ARMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGD 119
            R  S  +  DK+F P    + VF+EI   +    + GYN  +  YG T +GKTYTM   
Sbjct: 410 GRCFSYNFHFDKIFEPHNTNADVFQEICQ-LVQCSLDGYNVCIFAYGQTGSGKTYTM--- 465

Query: 120 EKLYDGELSEAAGIIPRVL---FKLFDTLEVQESDYMVKCSFIELYNEELKDLL 170
                  L+   G+IP  L   F+  + L      Y + C +IE+YNE + DLL
Sbjct: 466 -------LNPGDGMIPMTLSHIFQWTEDLMEHGWRYEMDCEYIEIYNETILDLL 512

>Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 63/144 (43%), Positives = 86/144 (59%), Gaps = 4/144 (2%)

Query: 288 LLQKGLSHRQVASTKMNDVSSRSHTIFTLTLY-KNFNGETFRVSKINLVDLAGSENISRS 346
           +L+K    R  AST  N+ SSRSH+IF + L   N          +NLVDLAGSE I+ S
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNTKTGAQSYGTLNLVDLAGSERINIS 636

Query: 347 GAQNQRAKEAGSINQSLLTLGRVINSLADKNA---HIPFRESKLTRLLQDSLGGNTKTAL 403
                R +E  +IN+SL  LG VI++L   ++   HIPFR SKLT LLQ SL G++KT +
Sbjct: 637 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 404 IATISPAKINSEETSSTLEYATKA 427
              ISP+  +  ET ++L +A+K 
Sbjct: 697 FVNISPSSSHINETLNSLRFASKV 720

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 54/107 (50%), Gaps = 14/107 (13%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  DK+F      + VFKE+   +    + GYN  +  YG T +GKT+TM          
Sbjct: 436 FKFDKIFDQKDTNADVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM---------- 484

Query: 127 LSEAAGIIPRVL---FKLFDTLEVQESDYMVKCSFIELYNEELKDLL 170
           L+   GIIP  +   F   + L+ +  DY V C FIE+YNE + DLL
Sbjct: 485 LNPGDGIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNENIVDLL 531

>KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 678

 Score = 97.1 bits (240), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 65/181 (35%), Positives = 100/181 (55%), Gaps = 22/181 (12%)

Query: 268 AIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTL--TLYKNFNGE 325
            + +  L E  +  +++ LR ++ G S+R+   T  N  SSRSH I T+  T  +  +G 
Sbjct: 274 GVRVVGLTEQQVHSSEDVLRKIELGNSNRRTGETDYNTRSSRSHAIVTIKVTCTELLSG- 332

Query: 326 TFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD---------- 375
           T   S ++L DLAGSE   R+  Q++R KE   IN+SLL LG VI+ L+           
Sbjct: 333 TDTTSTLSLCDLAGSE---RAAGQHERRKEGAFINKSLLALGTVISKLSAVSGASGGGAA 389

Query: 376 ------KNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKN 429
                  N+H+P+R+SKLTR+LQ +L G++    I TI        ET +T+ +A++AKN
Sbjct: 390 TPPPTFGNSHVPYRDSKLTRILQPALSGDSIVTTICTIDTKPDAMSETVNTIRFASRAKN 449

Query: 430 I 430
           +
Sbjct: 450 V 450

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 61/108 (56%), Gaps = 11/108 (10%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  DKVF P  +   V++EI  PM     +GYN T+  YGMT +GKT+TM+G        
Sbjct: 140 FWFDKVFSPQTNNYGVYEEIGKPMIDKLFQGYNATIFAYGMTGSGKTFTMSGTR------ 193

Query: 127 LSEAAGIIPRVLFKLFDTL---EVQESDYMVKCSFIELYNEELKDLLD 171
             + AG+I   + ++F  +    V    Y V+ S++E+YNE++ DLL+
Sbjct: 194 --DEAGLILLSVEQIFSQIMKESVNNKSYEVRVSYLEIYNEKIYDLLN 239

>ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 654

 Score = 97.1 bits (240), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 97/190 (51%), Gaps = 21/190 (11%)

Query: 268 AIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGETF 327
            + I  L E     + E L+ ++ G   R+   T  N  SSRSH I  + L K    E  
Sbjct: 261 GVKIVGLTERRCESSDELLKWIRIGDKSRKTGETTYNTRSSRSHAIVMIRLTKTDLKEGT 320

Query: 328 RVSK-INLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKN--------- 377
            VS  ++L DLAGSE   ++   N+R KE   IN+SLL LG VI+ L+ ++         
Sbjct: 321 SVSSTLSLCDLAGSE---KAVTHNERRKEGAFINKSLLALGTVISKLSAESTSHRNGGSS 377

Query: 378 ----AHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIK-- 431
                HIP+R+SKLTR+LQ +L GN     I TI      S ET +TL +A++AKN+   
Sbjct: 378 SPVTGHIPYRDSKLTRILQPALSGNGVVTTICTIDTRPDASSETLNTLRFASRAKNVSLH 437

Query: 432 --NKPQLGSF 439
              KP L S 
Sbjct: 438 IFRKPLLPSM 447

 Score = 68.2 bits (165), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 58/109 (53%), Gaps = 12/109 (11%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  D VF  + +   V+ + + PM     +G N T+  YGMT +GKT+TM G E      
Sbjct: 122 FKYDHVFKTACNNVEVYAQTSKPMIDRVFEGLNATVFAYGMTGSGKTFTMAGTE------ 175

Query: 127 LSEAAGIIPRVLFKLFDTLEVQ----ESDYMVKCSFIELYNEELKDLLD 171
             E  G+IP  +  L+  +  +    +S + +  S++E+YNE++ DLLD
Sbjct: 176 --ETLGLIPLSVAYLYSRVMEESLQGDSRFEIAVSYLEIYNEKIYDLLD 222

>NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa]
           {ON} Anc_3.479
          Length = 763

 Score = 97.1 bits (240), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 90/154 (58%), Gaps = 11/154 (7%)

Query: 288 LLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGETFRVSK--INLVDLAGSENISR 345
           +L++    R  AST  N+ SSRSH+IF + L K  N  T   S   +NLVDLAGSE I+ 
Sbjct: 603 ILRRANKLRSTASTLSNEHSSRSHSIFIIHL-KGTNEITGEKSYGILNLVDLAGSERINS 661

Query: 346 SGAQNQRAKEAGSINQSLLTLGRVINSLAD--------KNAHIPFRESKLTRLLQDSLGG 397
           S    +R +E  +IN+SL  LG VI++L          K  HIPFR SKLT LLQ SL G
Sbjct: 662 SQVTGERLRETQNINRSLSCLGDVIHALTGSEKDKENAKKRHIPFRNSKLTYLLQYSLIG 721

Query: 398 NTKTALIATISPAKINSEETSSTLEYATKAKNIK 431
           N+KT +   ISP+     ET ++L +A+K  + K
Sbjct: 722 NSKTLMFVNISPSINYVNETLNSLRFASKVNSAK 755

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 58/115 (50%), Gaps = 14/115 (12%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  DK+F  +     VFKE+   +    + GYN  +  YG T +GKTYTM          
Sbjct: 453 FKFDKIFNQNETNDDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM---------- 501

Query: 127 LSEAAGIIPRVLFKLFD---TLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGG 178
           L    GIIP  +  +F+    L+ +   Y ++C F+E+YNE + DLL +  D+ G
Sbjct: 502 LHPKDGIIPATISHIFNWTNNLKERGWKYEIECEFVEIYNENIVDLLRNEHDNNG 556

>Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {ON}
           YPL155C (REAL)
          Length = 706

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 95/195 (48%), Gaps = 35/195 (17%)

Query: 268 AIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYK-NFNGET 326
            + +  L E      +E LR +  G   R++  T  N  SSRSH I  + L   + N  T
Sbjct: 302 GVKVIGLTERRCESTEELLRWIGIGDKSRKIGETDYNTRSSRSHAIVLIRLTSTDVNNGT 361

Query: 327 FRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL-ADKNA------- 378
            R S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L ADK         
Sbjct: 362 SRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKTTSVDSNIS 418

Query: 379 -----------------------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSE 415
                                  HIP+R+SKLTRLLQ +L G++    I T+      + 
Sbjct: 419 TTPTGSSGSSSGSITGNSGIPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRNDAAA 478

Query: 416 ETSSTLEYATKAKNI 430
           ET +TL +A++AKN+
Sbjct: 479 ETMNTLRFASRAKNV 493

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 62/117 (52%), Gaps = 12/117 (10%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  D VF        V++    PM    + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYERTGKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 127 LSEAAGIIPRVLFKLFDTLEVQESD----YMVKCSFIELYNEELKDLLDDGQDSGGN 179
           L    G+IP  +  LF  +  Q  D    + V  S++E+YNE + DLL+ G +  G+
Sbjct: 219 L----GLIPLSVSYLFSNIMEQSMDGDKKFDVIISYLEIYNERIYDLLESGLEESGS 271

>YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON}
           KIP2Kinesin-related motor protein involved in mitotic
           spindle positioning, stabilizes microtubules by
           targeting Bik1p to the plus end; Kip2p levels are
           controlled during the cell cycle
          Length = 706

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 71/195 (36%), Positives = 97/195 (49%), Gaps = 35/195 (17%)

Query: 268 AIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYK-NFNGET 326
            + +  L E     ++E LR +  G   R++  T  N  SSRSH I  + L   N    T
Sbjct: 302 GVKVIGLTERRCESSEELLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTSTNVKNGT 361

Query: 327 FRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL-ADK--------- 376
            R S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L ADK         
Sbjct: 362 SRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKMNSVGSNIP 418

Query: 377 ------------NA---------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSE 415
                       NA         HIP+R+SKLTRLLQ +L G++    I T+      + 
Sbjct: 419 SPSASGSSSSSGNATNNGTSPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRNDAAA 478

Query: 416 ETSSTLEYATKAKNI 430
           ET +TL +A++AKN+
Sbjct: 479 ETMNTLRFASRAKNV 493

 Score = 74.7 bits (182), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 68/126 (53%), Gaps = 13/126 (10%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  D VF        V++  + PM    + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYERTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 127 LSEAAGIIPRVLFKLFDTLEVQ----ESDYMVKCSFIELYNEELKDLLDDG-QDSGGNNS 181
           L    G+IP  +  LF  +  Q    +  + V  S++E+YNE + DLL+ G ++SG   S
Sbjct: 219 L----GLIPLSVSYLFTNIMEQSMNGDKKFDVIISYLEIYNERIYDLLESGLEESGSRIS 274

Query: 182 RKLRIY 187
              R+Y
Sbjct: 275 TPSRLY 280

>SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {ON}
           similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155C KIP2 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 657

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 112/214 (52%), Gaps = 16/214 (7%)

Query: 268 AIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTL-YKNFNGET 326
            + +  L E  +  +++ ++ +  G S+R+   T  N  SSRSH I  + L   +     
Sbjct: 272 GVKVIGLTEQEVDTSEDVMKWIALGNSNRKTGETDFNSRSSRSHAIVLIRLTCTDLKSGL 331

Query: 327 FRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA-------- 378
              S ++L DLAGSE   R+ AQ +R KE   IN+SLL LG VI+ L+ ++         
Sbjct: 332 ETTSTLSLCDLAGSE---RATAQRERRKEGAFINKSLLALGTVISKLSAESTQNMGVGGG 388

Query: 379 -HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIK---NKP 434
            HIP+R+SKLTR+LQ +L G+     I T+     +S ET +T+ +A++AKNI     + 
Sbjct: 389 HHIPYRDSKLTRILQPALSGDGIVTTICTVDAHAESSAETINTIRFASRAKNISLVVKRN 448

Query: 435 QLGSFMMKDILVKNISHELAKLKSDFLSTKSKEG 468
           ++     KD +++N+  +L +        KS  G
Sbjct: 449 EMDISNEKDHIIENLRRQLEQQNETIAVLKSNNG 482

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 61/108 (56%), Gaps = 11/108 (10%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           ++ D VF P+ D   V++E A PM     +G+N T+  YGMT +GKT+TM+G        
Sbjct: 147 FSFDHVFHPTNDNFAVYEETARPMIEKLFQGFNSTIFAYGMTGSGKTFTMSGT------- 199

Query: 127 LSEAAGIIPRVLFKLFDTL---EVQESDYMVKCSFIELYNEELKDLLD 171
            S   G+IP  +  +F  +    +    + VK S++E+YNE++ DLL+
Sbjct: 200 -SNEPGLIPLSVNDIFSNIMSKSLNNQRFDVKVSYLEIYNEKIYDLLN 246

>KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8.678
           YPL155C
          Length = 625

 Score = 94.7 bits (234), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 66/180 (36%), Positives = 95/180 (52%), Gaps = 21/180 (11%)

Query: 268 AIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKN--FNGE 325
            + +  + E     A+E ++ +  G + R+   T  N  SSRSH I  + L      NG 
Sbjct: 242 GVKVHGVLEQKCDTAEELMKWVSVGEAVRKTGKTDYNMRSSRSHAIIQVKLITTNLLNGT 301

Query: 326 TFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK--------- 376
           T   + ++L DLAGSE  S    Q +R KE   IN+SLL LG VI+ L+ +         
Sbjct: 302 TH-FNTLSLCDLAGSEKASE---QLERRKEGSFINKSLLALGTVISKLSAESNAHDSSRP 357

Query: 377 ------NAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNI 430
                 N+HIP+R+SKLTRLLQ +L  ++    I TI P K    ET +TL +A++AKN+
Sbjct: 358 SSGSLNNSHIPYRDSKLTRLLQPALCNDSVVTAICTIDPTKEAMTETVNTLRFASRAKNV 417

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 56/112 (50%), Gaps = 6/112 (5%)

Query: 60  ARMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGD 119
           A  +   +  D VFGP+A    +F E+   +      G N T+L YG T +GKTYTM G 
Sbjct: 120 AHWDQGDFQFDHVFGPTATNEDLFAELGGGLVEKLFDGCNATLLAYGTTGSGKTYTMVGH 179

Query: 120 EKLYDGELSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLD 171
               DG +      +   +    D  +V+ S   V  S++E+YNE++ DLL+
Sbjct: 180 N---DGIVKMCGDCVFTRMLNAADERQVKRS---VTVSYLEIYNEKICDLLN 225

>ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL155C (KIP2)
          Length = 685

 Score = 94.7 bits (234), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 68/202 (33%), Positives = 107/202 (52%), Gaps = 19/202 (9%)

Query: 268 AIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYK-NFNGET 326
            + +  L E  ++  ++ ++ +  G  +R+   T  N  SSRSH I  L L + +    +
Sbjct: 274 GVKVVDLTEQLVSSHEDVMKWIATGDRNRKTGETDFNTRSSRSHAIVLLRLTRYDLKTGS 333

Query: 327 FRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA------------ 374
              S ++L DLAGSE   R+  Q  R KE   IN+SLL LG VI  L+            
Sbjct: 334 EATSTLSLCDLAGSE---RAVTQIVRRKEGAFINKSLLALGTVIAKLSMLGSQANGLQPS 390

Query: 375 DKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIK--- 431
               HIP+R+SKLTR+LQ +L G++    I TI     +S ET++T+ +A++AKNI    
Sbjct: 391 PAAGHIPYRDSKLTRILQPALTGDSIITTICTIDSKAESSTETTNTVRFASRAKNIALNV 450

Query: 432 NKPQLGSFMMKDILVKNISHEL 453
            K ++ S   KD +++N+  +L
Sbjct: 451 RKNEMDSHAEKDTIIQNLRKQL 472

 Score = 74.7 bits (182), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 43/132 (32%), Positives = 68/132 (51%), Gaps = 18/132 (13%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  D VF        V++ +  P+     +GYN T+  YGMT +GKT+TM+G++      
Sbjct: 146 FQFDHVFTKGVCNQEVYQALGVPIIDKLFEGYNATIFAYGMTGSGKTFTMSGNK------ 199

Query: 127 LSEAAGIIPRVLFKLFDTLEVQESD----YMVKCSFIELYNEELKDLL---DDGQDSGGN 179
             +  G+IP+ +  +FD +  +       Y VK S++E+YNE++ DLL   D    S G 
Sbjct: 200 --QEPGLIPQCVGNIFDRISSEHHGASLAYEVKVSYLEIYNEKIYDLLNYVDRQAGSTGQ 257

Query: 180 NSR---KLRIYD 188
            SR    L+I D
Sbjct: 258 PSRNATGLKIRD 269

>CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa]
           {ON} similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155c KIP2 kinesin-related protein
          Length = 672

 Score = 94.0 bits (232), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 98/189 (51%), Gaps = 29/189 (15%)

Query: 268 AIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLY-KNFNGET 326
            + +  L +     ++E L  + KG  +R+ + T+ N  SSRSH I  + L  K+     
Sbjct: 268 GVRVVGLTQKRCDTSEEVLDWINKGNKNRKTSETEFNTRSSRSHAIVMIRLISKDIRTGE 327

Query: 327 FRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVIN--------------- 371
             +  ++L DLAGSE   R   QN+R KE   IN+SLL LG VI+               
Sbjct: 328 QNIRTLSLCDLAGSE---RGVGQNERRKEGAFINRSLLALGTVISRLSAENNGSHHTGRA 384

Query: 372 -----SLADKNA-----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTL 421
                SLA  N      HIP+R+SKLTRLLQ +L G++    + TI  A  +S ET +TL
Sbjct: 385 ANSQQSLASPNGSSSGNHIPYRDSKLTRLLQPALSGDSVVVALCTIDLAHESSSETLNTL 444

Query: 422 EYATKAKNI 430
            +A+++KN+
Sbjct: 445 RFASRSKNV 453

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 61/111 (54%), Gaps = 16/111 (14%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +T D VF        ++ +   P+    I+GYN T+  YGMT +GKT+TM+G E      
Sbjct: 133 FTFDHVFSTGCSNFDIYGKTTQPLIDRLIEGYNATIFAYGMTGSGKTFTMSGTE------ 186

Query: 127 LSEAAGIIPRVLFKLFDTL------EVQESDYMVKCSFIELYNEELKDLLD 171
             E  G+IP  +  LF +L      E ++S+  V  S++E+YNE++ DLLD
Sbjct: 187 --EEKGLIPLSVSYLFSSLLEKTNTENEKSEVWV--SYLEIYNEKINDLLD 233

>TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON}
           Anc_8.678 YPL155C
          Length = 637

 Score = 94.0 bits (232), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 74/214 (34%), Positives = 112/214 (52%), Gaps = 30/214 (14%)

Query: 268 AIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKN--FNGE 325
            + I  L E     ++E  R +Q G  +R+ + T  N  SSRSH I  + L      +GE
Sbjct: 250 GVRITGLTEKRCESSEELSRWIQIGDKNRKTSETIYNTRSSRSHAIVLVRLNNTDLRSGE 309

Query: 326 TFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVI--------------- 370
           T   S ++L DLAGSE   ++ +Q +R KE   IN+SLL LG VI               
Sbjct: 310 TVS-STLSLCDLAGSE---KAVSQYERRKEGAFINKSLLALGTVISKLSSESLSKNGPPT 365

Query: 371 ---NSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKA 427
               +  + N HIP+R+SKLTR+LQ +L GN+    I TI      + ET +T+ +A++A
Sbjct: 366 FTSTNPTEPNTHIPYRDSKLTRILQPALSGNSIITTICTIDTRNEAASETVNTIRFASRA 425

Query: 428 KN----IKNKPQL--GSFMMKDILVKNISHELAK 455
           KN    +  +P +  GS+  KD  ++N++ +L K
Sbjct: 426 KNVTLQVAKRPAVGTGSYNEKDQTIENLTQQLEK 459

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 61/109 (55%), Gaps = 12/109 (11%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +T D+VF  +     +++  + PM    ++G+N T+  YGMT +GKT+TMTG E      
Sbjct: 112 FTFDRVFPANCTNLDIYEASSRPMIDKLLQGFNATVFAYGMTGSGKTFTMTGTE------ 165

Query: 127 LSEAAGIIPRVLFKLFDTLEVQE----SDYMVKCSFIELYNEELKDLLD 171
             + AG+IP  +  LF  +        S Y V  S++E+YNE++ DLLD
Sbjct: 166 --DEAGLIPLSVTYLFSKILEHSMRGTSKYEVVVSYLEIYNEKIYDLLD 212

>TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.678
           YPL155C
          Length = 696

 Score = 93.6 bits (231), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 98/183 (53%), Gaps = 23/183 (12%)

Query: 268 AIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYK-NFNGET 326
            I +  L E   +   + ++ ++ G  +++++ T+ N  SSRSH+I  + L   +     
Sbjct: 248 GIKVVGLSEHRCSSKDDLMKWVRIGDKNKKISETEYNSRSSRSHSILLVRLIATDLETGI 307

Query: 327 FRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK---------- 376
              S ++L DLAGSE   ++ +Q +R KE   IN+SLL LG VI  L+ +          
Sbjct: 308 VTTSTLSLCDLAGSE---KATSQQERRKEGAFINKSLLALGTVIAKLSSESNQHRNADNV 364

Query: 377 ---------NAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKA 427
                    N+HIP+R+SKLTR+LQ +L GN+    I T+      S ET +TL +A++A
Sbjct: 365 NHQETSNPNNSHIPYRDSKLTRILQPALSGNSIITTICTVDIRSDASSETLNTLRFASRA 424

Query: 428 KNI 430
           KN+
Sbjct: 425 KNV 427

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 70/141 (49%), Gaps = 12/141 (8%)

Query: 35  VVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDF 94
           +V   P  I  NE  +    D    A  +   + +D++F        ++ E+  P+    
Sbjct: 77  IVAIRPKPISNNEKKVWNIVDNKRIAHDDVGEFRLDRIFDCDVSNLEIYSELCKPLIDKL 136

Query: 95  IKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSEAAGIIPRVLFKLFDTLE----VQES 150
             GYN T+  YGMT +GKT+TM+G +        E  G+IP  +  LF+T+     + + 
Sbjct: 137 AMGYNATLFAYGMTGSGKTFTMSGTQ--------EDTGLIPLSISHLFNTINEENLLGKK 188

Query: 151 DYMVKCSFIELYNEELKDLLD 171
            Y +  S++E+YNE+L DLLD
Sbjct: 189 KYEMLVSYMEIYNEKLYDLLD 209

>TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.678
           YPL155C
          Length = 468

 Score = 92.0 bits (227), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 56/149 (37%), Positives = 89/149 (59%), Gaps = 10/149 (6%)

Query: 286 LRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGETFRVSKINLVDLAGSENISR 345
           L L+ +G  +R+V ST+ N  SSRSH +  L +  +  G   RV  + L DLAGSE   R
Sbjct: 241 LELVAQGNRNRRVRSTQHNTGSSRSHAVLRLRITDSM-GSKARV--LTLCDLAGSE---R 294

Query: 346 SGAQNQRAK-EAGSINQSLLTLG---RVINSLADKNAHIPFRESKLTRLLQDSLGGNTKT 401
           +   ++  + E G+IN+SL+ LG   R++N     + H+P+R+SKLTRLL+ SL GN   
Sbjct: 295 ASVHDRGLRAEGGAINKSLMALGTVVRLLNETGPSSTHVPYRDSKLTRLLKPSLSGNGLV 354

Query: 402 ALIATISPAKINSEETSSTLEYATKAKNI 430
            ++ T+S +  + E++  TL +A +A  +
Sbjct: 355 TMVCTVSLSGTDYEQSLGTLRFARRASGV 383

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 54/111 (48%), Gaps = 25/111 (22%)

Query: 82  VFKEIADPMFH----DFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSEAAGIIPRV 137
           +F     P+ H    D I G   T++ YG T +GKTYTM G         ++A G I  V
Sbjct: 122 IFVRDCKPLVHRVATDCISG---TIIAYGATGSGKTYTMHG---------TKAEGGI--V 167

Query: 138 LFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKLRIYD 188
              + D L     +  +  S++E+YNE L DLL DG       +++LRI D
Sbjct: 168 QLSIRDLLTQLSKNCQITISYLEIYNERLHDLLCDG-------TKELRILD 211

>NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {ON} 
          Length = 685

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 69/191 (36%), Positives = 96/191 (50%), Gaps = 31/191 (16%)

Query: 268 AIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLY-KNFNGET 326
            + +  L E     ++E +  + KG   R+ A T  N  SSRSH I  + L   +    T
Sbjct: 280 GVRVIGLTEKRCESSEELMNWIIKGDKIRKTAETDFNARSSRSHAIVLIRLTTSDMKDGT 339

Query: 327 FRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA---DKN------ 377
              S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L+   +KN      
Sbjct: 340 SISSTLSLCDLAGSE---RATGQQERRKEGAFINKSLLALGTVISKLSTESNKNRSPTLP 396

Query: 378 ------------------AHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSS 419
                              HIP+R+SKLTRLLQ +L G++    I TI     +S ET +
Sbjct: 397 SPPLSSSSSSTSINSSVPGHIPYRDSKLTRLLQPALSGDSIVTTICTIDTKNESSAETLN 456

Query: 420 TLEYATKAKNI 430
           TL +A++AKNI
Sbjct: 457 TLRFASRAKNI 467

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 74/162 (45%), Gaps = 25/162 (15%)

Query: 15  ITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVDKVFG 74
           ITVA+R +  +     + SS +V     I  ++V                  +  D VF 
Sbjct: 101 ITVAIRPKPTSNPSDVSTSSWLVTDEKTIAHDDVG----------------EFKFDHVFN 144

Query: 75  PSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSEAAGII 134
                  +++ I  PM     +G+N T+  YGMT +GKTYTM G       E  +  G+I
Sbjct: 145 SFVSNLEIYQVINRPMIDKLFQGFNSTIFAYGMTGSGKTYTMMGCP-----EREQKDGLI 199

Query: 135 PRVLFKLFDTL--EVQESD--YMVKCSFIELYNEELKDLLDD 172
           P  +  LF  +  E  + D  + +  S++E+YNE++ DLL D
Sbjct: 200 PLSVSYLFTKIMEETLDGDKKFEIVLSYLEIYNEKIYDLLGD 241

>Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}
           similar to Ashbya gossypii ACR145W
          Length = 687

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 68/206 (33%), Positives = 104/206 (50%), Gaps = 23/206 (11%)

Query: 268 AIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYK-NFNGET 326
            + +  L E  +    E ++ +  G  +R+   T  N  SSRSH I  L L +      T
Sbjct: 275 GVKVVDLTEQQVESHGEVIKWIAAGDKNRKTGETDFNSRSSRSHAIVLLRLTRCELKTGT 334

Query: 327 FRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL------------- 373
              S ++L DLAGSE   R+  Q  R KE   IN+SLL LG VI  L             
Sbjct: 335 EVTSTLSLCDLAGSE---RAVTQLVRRKEGAFINKSLLALGTVIAKLSANSAGSGSGSNG 391

Query: 374 ---ADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNI 430
              +    HIP+R+SKLTR+LQ +L G++    I TI     ++ ET++T+ +A++AKNI
Sbjct: 392 QPPSAMGGHIPYRDSKLTRILQPALTGDSIITTICTIDSKSESNSETTNTVRFASRAKNI 451

Query: 431 K---NKPQLGSFMMKDILVKNISHEL 453
                K ++ +   KD +++N+  +L
Sbjct: 452 SLNVRKNEMDTSNEKDSIIQNLRKQL 477

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 65/123 (52%), Gaps = 13/123 (10%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  D VF      S V+  +  P+     +GYN T+  YGMT +GKT+TM+G +      
Sbjct: 145 FQFDHVFTKEVTNSEVYMALGQPIVDKLFQGYNATIFAYGMTGSGKTFTMSGTK------ 198

Query: 127 LSEAAGIIPRVLFKLFD-----TLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNS 181
             +  G+IP  +  +FD     T +  E  Y VK S++E+YNE++ DLL   + +G   S
Sbjct: 199 --QDPGLIPLCVGNMFDRVMEETSKSTEHKYEVKVSYLEIYNEKIYDLLSITEANGAVAS 256

Query: 182 RKL 184
           R+L
Sbjct: 257 RQL 259

>TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa]
           {ON} Anc_2.633 YKL079W
          Length = 644

 Score = 90.9 bits (224), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 83/257 (32%), Positives = 124/257 (48%), Gaps = 45/257 (17%)

Query: 262 VNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKN 321
           ++ + S+I I++L+  ++T   E L   +KG   R +AS       SRS  I  +T+ + 
Sbjct: 182 LDSKKSSISIKNLRCVYVTSLLEALSYCEKG---RSLAS-------SRSSVIIRITVEQR 231

Query: 322 FN-GETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA------ 374
            N  E F+     LVDL  S+ I +        +    INQS++TL  V  SLA      
Sbjct: 232 DNVKEVFKTGSFQLVDLGSSDKIDKQNNLGISPENTKKINQSMVTLENVARSLAGTEQSV 291

Query: 375 ------DKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAK 428
                   N +IP++ES LT+LLQ+++GGN KT L+   S AK + EET +TL +    K
Sbjct: 292 KNGRPRSGNYYIPYKESCLTQLLQETIGGNCKTTLVLMCSTAKQDEEETLNTLNFGANMK 351

Query: 429 NIK-----NKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSHLHY--NEVMN 481
            +K     NK    S  M D+L+K           DF    +KE  Y SH+     E+MN
Sbjct: 352 LVKNLFQQNKAGTNSKAMLDLLMK-----------DF---DAKEKNYQSHIQLLEKELMN 397

Query: 482 DIE-NYKTEIQESRREI 497
             +  Y +E  + + EI
Sbjct: 398 LKKLQYGSETADKQNEI 414

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 51/114 (44%), Gaps = 11/114 (9%)

Query: 60  ARMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGD 119
           A  N K + VD++F P A        I          GYN  ++ YG T +GKT TM G 
Sbjct: 64  AGQNLKLFRVDQIFNPGAQTKDTTSSIIGDSVAQLFNGYNVAIMAYGQTDSGKTSTMFGY 123

Query: 120 EKLYDGELSEAAGIIPRVLFKLFDTLEVQES---DYMVKCSFIELYNEELKDLL 170
            K          G+I  V  ++F T+E       DY +  S IE+  E ++DLL
Sbjct: 124 NK--------GDGVINGVCKQIFTTVETGSENNIDYSISLSIIEVNCESIRDLL 169

>TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {ON} 
          Length = 672

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 62/164 (37%), Positives = 93/164 (56%), Gaps = 5/164 (3%)

Query: 268 AIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLY-KNFNGET 326
            I + H ++  I  + +  +L++ G + R   ST MN+ SSRSH++F + +   N   + 
Sbjct: 507 TIKLTHNEDDEIAKSAQIRQLIRNGNNTRNTKSTHMNNASSRSHSVFMMKITGHNRITQE 566

Query: 327 FRVSKINLVDLAGSENISRSG--AQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRE 384
               ++NLVDLAGSE + +       +  KE  SIN+SL  L  VI+S+  +  +IPFR 
Sbjct: 567 HSTGRLNLVDLAGSERLQQQEQITSQETLKETTSINKSLTCLADVIHSMKHRQPYIPFRN 626

Query: 385 SKLTRLLQDSLGGNTKTALIATISPAKINS-EETSSTLEYATKA 427
           SKLT LL++SL   +KT +   ISP  INS  ET ++L  A K 
Sbjct: 627 SKLTYLLKNSLINKSKTLMYVNISP-NINSIRETINSLRLARKV 669

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 55/108 (50%), Gaps = 14/108 (12%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +T DK+FG   D   VF +I + +    + GYN  +  YG T +GKTYTM          
Sbjct: 384 FTFDKIFGMQDDNYEVFDDIKN-LVQSSLDGYNVCIFTYGQTGSGKTYTM---------- 432

Query: 127 LSEAAGIIPRV---LFKLFDTLEVQESDYMVKCSFIELYNEELKDLLD 171
           L+E  GII +    +      L     +Y ++  FIE+YNE ++DLL+
Sbjct: 433 LNEKDGIIMQTIEYIVHFAGNLHKLGWEYELEVEFIEIYNETIRDLLN 480

>Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C
           (REAL)
          Length = 715

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 67/201 (33%), Positives = 96/201 (47%), Gaps = 41/201 (20%)

Query: 268 AIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYK-NFNGET 326
            + +  L E     +++ LR +  G   R++  T  N  SSRSH I  + L   +    T
Sbjct: 302 GVKVIGLTERRCESSEDLLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTSTDVRDGT 361

Query: 327 FRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL-ADK--------- 376
            R S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L ADK         
Sbjct: 362 SRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKTNSVGSIIP 418

Query: 377 ---------------------------NAHIPFRESKLTRLLQDSLGGNTKTALIATISP 409
                                      + HIP+R+SKLTRLLQ +L G++    I T+  
Sbjct: 419 TTPTSSGNSSSSSSSSSGSIVSNSNTSSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDT 478

Query: 410 AKINSEETSSTLEYATKAKNI 430
               + ET +TL +A++AKN+
Sbjct: 479 RNDAAAETMNTLRFASRAKNV 499

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 64/117 (54%), Gaps = 12/117 (10%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  D VF        V+++ + PM    + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYEKTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 127 LSEAAGIIPRVLFKLFDTLEVQ----ESDYMVKCSFIELYNEELKDLLDDGQDSGGN 179
           L    G+IP  +  LF  +  Q    +  + V  S++E+YNE + DLL+ G +  G+
Sbjct: 219 L----GLIPLSVSYLFTNIMEQSMNGDKKFDVVISYLEIYNERIYDLLESGLEESGS 271

>Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {ON}
           YPL155C (REAL)
          Length = 704

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 66/195 (33%), Positives = 94/195 (48%), Gaps = 35/195 (17%)

Query: 268 AIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYK-NFNGET 326
            + +  L E     ++E L+ +  G   R++  T  N  SSRSH I  + L   +    T
Sbjct: 302 GVKVIGLTERRCESSEELLKWIAIGDKSRKIGETDYNARSSRSHAIVLIRLTSTDLESGT 361

Query: 327 FRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL-ADK------NAH 379
            R S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L ADK      N H
Sbjct: 362 SRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKINPTGSNIH 418

Query: 380 IP------------------------FRESKLTRLLQDSLGGNTKTALIATISPAKINSE 415
                                     +R+SKLTRLLQ +L G++    I T+      + 
Sbjct: 419 TTPTNTGSSSSGTVTSNNNIPNNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRNDAAA 478

Query: 416 ETSSTLEYATKAKNI 430
           ET +TL +A++AKN+
Sbjct: 479 ETINTLRFASRAKNV 493

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 69/126 (54%), Gaps = 13/126 (10%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  D VF        V++  + PM    + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FEFDHVFASHCTNLEVYERTSKPMIDKLLVGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 127 LSEAAGIIPRVLFKLF-DTLEVQ---ESDYMVKCSFIELYNEELKDLLDDG-QDSGGNNS 181
           L    G+IP  +  LF + +E+    +  + V  S++E+YNE + DLL+ G ++S    S
Sbjct: 219 L----GLIPLSVSYLFSNVMELSMNGDKKFDVIISYLEIYNERIYDLLESGLEESLSRPS 274

Query: 182 RKLRIY 187
              R+Y
Sbjct: 275 TPSRLY 280

>Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {ON}
           complement(20458..22401) [1944 nt, 648 aa]
          Length = 647

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/174 (32%), Positives = 88/174 (50%), Gaps = 15/174 (8%)

Query: 304 NDVSSRSHTIFTLTLYK-NFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQS 362
           N++  RSHTI  +++ K N   E+  +S + +VDLAGS+ I ++ +     ++A  IN  
Sbjct: 225 NNLIQRSHTIMEVSIEKRNKLDESITMSSLYIVDLAGSDPIGKNSSSGITTEDAKKINHQ 284

Query: 363 LLTLGRVINSLADKNAH-------------IPFRESKLTRLLQDSLGGNTKTALIATISP 409
           + ++  VIN L   N               +P++ S LTRLL D LGGN KT  + T S 
Sbjct: 285 IKSVNDVINGLVVMNREGGIMTDISTLMHKVPYKSSILTRLLLDPLGGNCKTTFLLTSSL 344

Query: 410 AKINSEETSSTLEYATKAKNIKNKPQLGSFMMKDILVKNISHELAKLKSD-FLS 462
            K +  ET STL++    K+    P++  F +      +I     KLK D F+S
Sbjct: 345 KKNDWNETLSTLKFGYNCKSANTNPRINRFGLNSKATMDIFLTDMKLKEDNFIS 398

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 62/111 (55%), Gaps = 16/111 (14%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           Y  DKVF  S D  +  +E  +      ++GYN +++ YG + TGK++ + G+++     
Sbjct: 73  YKFDKVFA-SNDTGVEHQEFIESNLESLLQGYNTSIVTYGQSGTGKSFELYGEQQ----- 126

Query: 127 LSEAAGIIPRVLFKLFDTLEVQESD------YMVKCSFIELYNEELKDLLD 171
                G+I ++L KLF+ ++ +  +      Y VK SF+E+Y E++ DL+D
Sbjct: 127 ----DGLIFQLLTKLFNRIDEEMGNNNKNIHYTVKFSFLEVYQEKMFDLMD 173

>YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Protein
           that interacts with Myo2p, proposed to be involved in
           exocytosis; N-terminal domain is related to the motor
           domain of kinesins
          Length = 656

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 66/129 (51%), Gaps = 12/129 (9%)

Query: 46  NEVSINTSGDIGITARMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVY 105
           N V   T+  +  T +    T+  DKVF  +A Q  V K +  P+ +D + GYN T++ Y
Sbjct: 54  NTVLFRTNNPLHETTKETHSTFQFDKVFDANATQEDVQKFLVHPIINDVLNGYNGTVITY 113

Query: 106 GMTSTGKTYTMTGDEKLYDGELSEAAGIIPRVLFKLFDTLEVQES----DYMVKCSFIEL 161
           G + +GK+Y++ G +        E+ GI+P +   LFDTLE  E      + V     E+
Sbjct: 114 GPSFSGKSYSLIGSK--------ESEGILPNICKTLFDTLEKNEETKGDSFSVSVLAFEI 165

Query: 162 YNEELKDLL 170
           Y E+  DLL
Sbjct: 166 YMEKTYDLL 174

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/137 (33%), Positives = 69/137 (50%), Gaps = 13/137 (9%)

Query: 308 SRSHTIFTLTL-YKNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 366
           SRSH +F L +  +N   +  + S + LVDL G+E   +             +NQS+  L
Sbjct: 233 SRSHLVFQLHVEQRNRKDDILKNSSLYLVDLHGAEKFDKRTESTLSQDALKKLNQSIEAL 292

Query: 367 GRVINSLA---------DKNAHI-PFRESKLTRLLQDSLGGNTKTALIATISPAKINSEE 416
              + SL+          K +H   +RES+LT +L+DSLGGN KT +I T   + + +  
Sbjct: 293 KNTVRSLSMKERDSAYSAKGSHSSAYRESQLTEVLKDSLGGNRKTKVILTCFLSNVPT-- 350

Query: 417 TSSTLEYATKAKNIKNK 433
           T STLE+    + I NK
Sbjct: 351 TLSTLEFGDSIRQINNK 367

>TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {ON}
           Anc_2.633 YKL079W
          Length = 682

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 60/215 (27%), Positives = 107/215 (49%), Gaps = 16/215 (7%)

Query: 268 AIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYK-NFNGET 326
            + + +L++ H+   KE L    + +S   V ++K ++   R++TIF + + K +   E+
Sbjct: 208 GLPVDNLRQVHVASFKETLYYFNQAMS---VLNSKHDNSFPRTNTIFNINIEKLDKLDES 264

Query: 327 FRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD------KNAH- 379
              S I LVDLAGS+ I R  +    +++   IN S+ ++  +I SL+       KN   
Sbjct: 265 TTSSSIYLVDLAGSDLIDRKNSSGVNSEDVKRINSSIKSVQNIITSLSKLSYSDYKNYEF 324

Query: 380 -----IPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKP 434
                +P+  SKL +LL++ LGGN KT  + TIS      ++    L+  T  ++ K  P
Sbjct: 325 SLENSVPYDSSKLGKLLKEPLGGNCKTNFLFTISMNPEQYDDIIEALQLGTILQDSKTVP 384

Query: 435 QLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGI 469
           Q+  F + +    +I+ E  KLK +    +  E +
Sbjct: 385 QINKFGLNENKTLSIALENFKLKENNFKIQQAESV 419

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 58/106 (54%), Gaps = 14/106 (13%)

Query: 72  VFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSEAA 131
           +F   ++  L+   I   M  + ++GYN  ++ YG   +GKTY+      LY  ++ ++ 
Sbjct: 89  IFDRDSNIDLIGNTIVTGMIDEAMEGYNTALVTYGPKYSGKTYS------LYGNDVDDSF 142

Query: 132 GIIPRVLFK-LFDTLEVQESD------YMVKCSFIELYNEELKDLL 170
           G + +++FK LF  +    +D      ++VK SF+E++ +++ DLL
Sbjct: 143 G-LGQIIFKDLFSRINKSVTDSNAKYTFIVKISFLEVWLDKVVDLL 187

>Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079W
           (REAL)
          Length = 657

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 65/124 (52%), Gaps = 19/124 (15%)

Query: 51  NTSGDIGITARMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTST 110
           NT+GD          T+  DKVF  +A Q  V   + DP  +D + GYN T+L YG + +
Sbjct: 67  NTTGDT-------HSTFQFDKVFDANATQKDVQDFLLDPTINDVLSGYNSTILTYGPSFS 119

Query: 111 GKTYTMTGDEKLYDGELSEAAGIIPRVLFKLFDTLEVQE----SDYMVKCSFIELYNEEL 166
           GK+Y++ G +   DG      GI+P +   LF TLE +E    +++ V     E+Y E+ 
Sbjct: 120 GKSYSLIGPQ---DG-----GGILPNICKALFSTLEDREKNKGNNFSVSVLAFEIYMEKT 171

Query: 167 KDLL 170
            DLL
Sbjct: 172 YDLL 175

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 69/137 (50%), Gaps = 13/137 (9%)

Query: 308 SRSHTIFTLTL-YKNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 366
           SRSH +F L +  +N   +  + S + L+DL G+E   +             +NQS+  L
Sbjct: 234 SRSHVVFQLHVEQRNRRHDILKNSSLYLIDLHGAEKFDKRIENTLSQDSLKKLNQSIEAL 293

Query: 367 GRVINSL---------ADKNAHIP-FRESKLTRLLQDSLGGNTKTALIATISPAKINSEE 416
              + SL         + K +H   +RES+LT +L+DSLGGN KT +I T   + + +  
Sbjct: 294 KNTVQSLEIKSMDSVYSAKASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLSNVPT-- 351

Query: 417 TSSTLEYATKAKNIKNK 433
           T STL++    + I N+
Sbjct: 352 TLSTLKFGDSIRQINNR 368

>Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa]
           {OFF} YPR141C (KAR3) - kinesin-like nuclear fusion
           protein [contig 452] PARTIAL
          Length = 588

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 83/186 (44%), Gaps = 31/186 (16%)

Query: 9   EGDELNITVAVRCRGR----NEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNS 64
           E  EL   + V CR R    NEKE    SS+ ++     G +    + +G   IT +  +
Sbjct: 355 ELQELRGNIRVFCRLRPHLDNEKE--DSSSISID-----GFS----DENGTQCITIKREA 403

Query: 65  K--TYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKL 122
           K   +T D+ FG       +F EI   +    + GYN  +  YG T +GKTYTM      
Sbjct: 404 KYHKFTFDRCFGAQESNKDIFHEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM------ 456

Query: 123 YDGELSEAAGIIPRVLFKLF---DTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGN 179
               L+   GIIP  L  +F   + L+     Y +   FIE+YNE +KDL  D      +
Sbjct: 457 ----LNPEDGIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNENIKDLFKDHDTENDD 512

Query: 180 NSRKLR 185
            S  L+
Sbjct: 513 GSEALK 518

>Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)
           [1974 bp, 657 aa] {ON} ANNOTATED BY YGOB -
          Length = 657

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 83/186 (44%), Gaps = 31/186 (16%)

Query: 9   EGDELNITVAVRCRGR----NEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNS 64
           E  EL   + V CR R    NEKE    SS+ ++     G +    + +G   IT +  +
Sbjct: 355 ELQELRGNIRVFCRLRPHLDNEKE--DSSSISID-----GFS----DENGTQCITIKREA 403

Query: 65  K--TYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKL 122
           K   +T D+ FG       +F EI   +    + GYN  +  YG T +GKTYTM      
Sbjct: 404 KYHKFTFDRCFGAQESNKDIFHEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM------ 456

Query: 123 YDGELSEAAGIIPRVLFKLF---DTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGN 179
               L+   GIIP  L  +F   + L+     Y +   FIE+YNE +KDL  D      +
Sbjct: 457 ----LNPEDGIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNENIKDLFKDHDTENDD 512

Query: 180 NSRKLR 185
            S  L+
Sbjct: 513 GSEALK 518

>Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 59/109 (54%), Gaps = 12/109 (11%)

Query: 66  TYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDG 125
           T+  DKVF  +A Q  V   + +P   D + GYN T+L YG + +GK+Y++ G +  Y+ 
Sbjct: 74  TFQFDKVFDANATQKDVQDFLVNPTIKDILSGYNSTILTYGPSFSGKSYSLLGSQ--YN- 130

Query: 126 ELSEAAGIIPRVLFKLFDTLEVQE----SDYMVKCSFIELYNEELKDLL 170
                 G++P +   LF+TLE  E    +++ V     E+Y E+  DLL
Sbjct: 131 -----EGVLPNICQVLFETLEENEETKGTNFCVSVLAFEIYMEKSYDLL 174

 Score = 55.1 bits (131), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 67/137 (48%), Gaps = 13/137 (9%)

Query: 308 SRSHTIFTLTL-YKNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 366
           S+SH +F L +  +N   +  + S + L+DL G+E   +             +NQS+  L
Sbjct: 233 SKSHLVFQLHVEQRNRREDILKNSSLYLIDLHGAEKFEKRTENTLSQDALKKLNQSIEAL 292

Query: 367 GRVINSLADKNAHIPF----------RESKLTRLLQDSLGGNTKTALIATISPAKINSEE 416
             ++  LA KN    +          RES+LT +L+DSLGGN K  +I T   + + +  
Sbjct: 293 KNIVQLLAVKNPDSAYSTKASHSSTYRESQLTEVLRDSLGGNRKMKVILTCFLSNVPT-- 350

Query: 417 TSSTLEYATKAKNIKNK 433
           T STLE+    + I NK
Sbjct: 351 TISTLEFGDNIRQIINK 367

>Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 57/109 (52%), Gaps = 12/109 (11%)

Query: 66  TYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDG 125
           T+  DKVF  +A Q  V   +  P   D + GYN T++ YG + +GK+Y++ G +     
Sbjct: 74  TFKFDKVFDTNATQEDVQDFLVRPSIDDVLSGYNGTIITYGPSFSGKSYSLLGSQ----- 128

Query: 126 ELSEAAGIIPRVLFKLFDTL----EVQESDYMVKCSFIELYNEELKDLL 170
              E  GI+P +   LF+TL    E + +++ V     E++ E+  DLL
Sbjct: 129 ---EGEGILPNICKVLFETLEKNKETKGNNFSVSVLAFEIFMEKTYDLL 174

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 72/137 (52%), Gaps = 13/137 (9%)

Query: 308 SRSHTIFTLTL-YKNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 366
           S+SH +F L +  +N N +  R S + L+DL G+E   +             +NQS+  L
Sbjct: 233 SKSHLVFQLHVEQRNRNADILRKSSLYLIDLHGAERFDKRTEVTLSQDALKKLNQSIEAL 292

Query: 367 GRVIN--SLADKNAHIP--------FRESKLTRLLQDSLGGNTKTALIATISPAKINSEE 416
             ++   S+ D+++           +RES+LT +L+DSLGGN KT +I T   + +++  
Sbjct: 293 KNIVRLLSVKDRDSAYSVKASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLSNVST-- 350

Query: 417 TSSTLEYATKAKNIKNK 433
           T STLE+    + I NK
Sbjct: 351 TLSTLEFGECIRQITNK 367

>KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2.633
           YKL079W
          Length = 522

 Score = 61.6 bits (148), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 60/116 (51%), Gaps = 8/116 (6%)

Query: 65  KTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYD 124
           +T+++DKVF PSA Q+ V   +  P+  +   G N  M   G + TGKT+TM G + +  
Sbjct: 42  RTFSLDKVFPPSASQADVTAVLLGPIVDNLAHGVNVQMASLGDSQTGKTHTMLGQQGV-- 99

Query: 125 GELSEAAGIIPRVLFKLFDTLEVQES-DYMVKCSFIELYNEELKDLLDDGQDSGGN 179
                + G++ R+L K+F  +   E        S +EL N+++ DLL+     G N
Sbjct: 100 -----SQGLLQRILTKVFQLMNENEGVTVQYSLSAVELVNDKVYDLLNKRSPLGQN 150

>KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.633
           YKL079W
          Length = 667

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 80/306 (26%), Positives = 136/306 (44%), Gaps = 45/306 (14%)

Query: 308 SRSHTIFTLTL-YKNFNGETFRVSKINLVDLAGSENISRSG--AQNQRAKEAGSINQSLL 364
           S+SH I  + +  +N N +  +   I+  DLA  + I +    +    + E   +N    
Sbjct: 219 SKSHLITKINVEQRNLNEDVVKRGSISFFDLAAIDFIDKDSMVSLGLTSDEVKKLNLEST 278

Query: 365 TLGRVINSLAD----KNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSST 420
           TL   I S+++     NA IP++ S LT+LL     GN KT +I T S  K N  ET  T
Sbjct: 279 TLKNSIISMSELSENPNAVIPYKNSNLTKLLNQCFMGNMKTTVILTCSMLKSNEAETLET 338

Query: 421 LEYATKAKNIK-----NKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSHLH 475
           L+   K ++I      NK  L S    D++V+++              KSKE  YM+ + 
Sbjct: 339 LKMGLKLESISSNVHMNKHALNSKKKLDLIVEDM--------------KSKEANYMNRIR 384

Query: 476 ------------YNEVMNDIENYKTEIQESRREIEKLSSQNQLLHK--DKKSSQDTIESQ 521
                       Y E +++  ++K E+ + R +  KL  + ++  K   KK    +  S+
Sbjct: 385 LLETELNDLRASYGEAISETSSFKEEMNKERAKNVKLKEELEVFKKLLQKKGEAQSTHSK 444

Query: 522 RLQIRNLQSSMDYLYEK----IDLKHKNEIELTNMIMKLKDAVRNMQGALKTHEDHEQRL 577
            + + + +  M  L EK     +LK   +IE  +   KL + ++N    L+T +     L
Sbjct: 445 EMPLTDDEEIMQQLIEKSASVAELKATLDIE-KHKSFKLNEVLKNYVEKLQTLKKMNDNL 503

Query: 578 QSDIQK 583
            + I+K
Sbjct: 504 VTRIEK 509

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 52/106 (49%), Gaps = 11/106 (10%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           Y  D V   S +   ++  I   + ++  +GY+  ++ YG   TGK+    G +  Y+G 
Sbjct: 63  YQFDSVHEKSTE---LYNGIKGDLINNIFEGYHTGVITYGSAGTGKSSIFYGTDSTYEG- 118

Query: 127 LSEAAGIIPRVLFKLFDTLEVQESD--YMVKCSFIELYNEELKDLL 170
                G++   +  L+D ++   +D  + V  S IE++ E++ DLL
Sbjct: 119 -----GVVLMFVQDLYDKIDSIGNDTHFTVSLSTIEIHLEKMYDLL 159

>CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa]
           {ON} similar to uniprot|P32364 Saccharomyces cerevisiae
           YKL079w SMY1 kinesin-related protein
          Length = 675

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 72/285 (25%), Positives = 124/285 (43%), Gaps = 42/285 (14%)

Query: 268 AIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYK--NFNGE 325
            +Y Q     +I   KE  R+++    +++ +  KM+   S SH +   ++ +    +G 
Sbjct: 205 GLYYQEANNEYINSIKEFDRVMKLIQDNKEASEKKMDSKRSTSHVVIRCSVEQLDRVHG- 263

Query: 326 TFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL---ADKN----- 377
           T   S I   DL GS    +   Q    +    +N S+  L  V+NS+     KN     
Sbjct: 264 TITSSNIMFADLCGSNRFEKDVDQKLGVENIKKLNLSISNLESVVNSVLQNQQKNHLYIE 323

Query: 378 ------------AHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYAT 425
                         +P+++S+LT L+Q++LGGN++T ++      K + EET +TL +  
Sbjct: 324 NKLVPSVNSSDLQRVPYKDSQLTGLIQEALGGNSRTRVVLNCFDDKSHHEETIATLRFGV 383

Query: 426 KAKNIKNKPQLGSFMMKDILVKNISHELAKLKSDF--LSTKSKEGIYMSHLHYNEVMNDI 483
           + +NI N      F+  D+   N    L  L  +   +     + I +     N++ + +
Sbjct: 384 QLQNILN------FVRADVTGLNSKKTLDLLIDNMKVIENNYDQKITLLESELNKLADTV 437

Query: 484 ------ENYKTEIQESRREIEKLSSQ----NQLLHK-DKKSSQDT 517
                 E  +TEI E   EI+KL  Q     QL +  D K S+DT
Sbjct: 438 KKAKVTEELETEIVEKNDEIKKLREQLETMTQLFNNIDPKESEDT 482

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 15/63 (23%), Positives = 33/63 (52%)

Query: 58  ITARMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMT 117
           IT   +   +  +KV+        + K +++ +  D   GY+ +++ YG   +GK++T+ 
Sbjct: 78  ITNFADESIFNFEKVYDVGVPLVDIHKSLSESVLKDIYDGYDVSIISYGEAGSGKSFTLF 137

Query: 118 GDE 120
           G+E
Sbjct: 138 GNE 140

>TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.633
           YKL079W
          Length = 803

 Score = 56.2 bits (134), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 83/167 (49%), Gaps = 18/167 (10%)

Query: 267 SAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNF-NGE 325
           S++ I++L++ ++   +E    L +G S+R      M  ++SRS+ +  + L + F   +
Sbjct: 235 SSLEIENLRQVYVESFEELNSYLIEGRSNRN-----MKHLTSRSNIVIKINLEQVFLEDQ 289

Query: 326 TFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRE- 384
             + S + L+D+A S+ I ++ +    AKEA  +N  + +    IN LA+     P+ + 
Sbjct: 290 LMKCSSLILLDMAASDYIDKNDSLGISAKEAKKLNYPMESFTSYINLLAETGTS-PYDQQ 348

Query: 385 ----------SKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTL 421
                     S L  ++   +GGN KT  I+TISP   N  ET  TL
Sbjct: 349 INGKKSNDYNSNLVDIMSIPIGGNCKTLFISTISPLLANQNETFITL 395

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 67  YTVDKVFGPSADQS-LVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKL 122
           + VDKVF     QS L+  +I      +   G+N +++ +G + TGK++TM G+  L
Sbjct: 51  FQVDKVFDRFTKQSDLLSSDIVKNKISELFDGFNSSIIAFGQSGTGKSFTMFGNNSL 107

>NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633
          Length = 660

 Score = 55.1 bits (131), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 63/123 (51%), Gaps = 17/123 (13%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGD-EKLYDG 125
           Y  D +F   + ++  +  I D +  D  KGYN T++ YG TS+GK++ + GD +   DG
Sbjct: 86  YQFDSIFDVDSKETEFYDSITDNLIDDISKGYNTTIMTYGPTSSGKSHALFGDPDSTNDG 145

Query: 126 ELSEAAGIIPRVLF-KLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKL 184
            ++  A    R+LF +  D L+      +   S  ELY +++ DLL        NN + L
Sbjct: 146 LINHIAD---RLLFPQCEDNLKT-----LCSISMWELYIDKVYDLL-------LNNGKPL 190

Query: 185 RIY 187
           +++
Sbjct: 191 KVH 193

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 66/131 (50%), Gaps = 14/131 (10%)

Query: 328 RVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK----NAHIPFR 383
           R S I  +DL GS+ +++  A    + +    NQ +  L  +I +L ++    ++H  F+
Sbjct: 251 RCSSITFIDLCGSDLLTKQNASKLSSDDIKKFNQMIYLLQNLIKTLPEEQSTNSSH--FK 308

Query: 384 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMK- 442
           +S L ++L D LGG+TK  L+  I     N+      ++   KAK IKN P +    +  
Sbjct: 309 DSSLNKILMDYLGGDTKMTLVVAIDG---NTGGYEDAVKLGAKAKLIKNYPTMNKIGLNA 365

Query: 443 ----DILVKNI 449
               D+LV+++
Sbjct: 366 KRKMDLLVQDM 376

>ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar to
           uniprot|Q759X8 Ashbya gossypii ADR145C ADR145Cp and
           weakly similar to YKL079W uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a kinesin
           colocalizes with Myo2p kinesin heavy chain homolog
          Length = 668

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 80/335 (23%), Positives = 153/335 (45%), Gaps = 54/335 (16%)

Query: 308 SRSHTIFTLTL-YKNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 366
           SRS     +T+  +N   ET + S + L+DLA S+ + ++   +    E  S N S+  L
Sbjct: 224 SRSSAFLNITVEQRNKKEETLKHSVLQLIDLASSDKLDKNLKYDISTDEMKSTNSSMQNL 283

Query: 367 GRVINSLAD-----------KNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSE 415
            +V+  L++           K+ H   R S+L + LQ ++GG++KT  +   S  K + E
Sbjct: 284 HQVVYGLSELESPSSKNHSSKHTH---RTSRLAKFLQQAIGGDSKTTAVMLSSTDKADRE 340

Query: 416 ETSSTLEYATKAKNIKNKP-----QLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIY 470
            T  TL   ++ ++I N P      L S  + D+ +KN+S              ++E  Y
Sbjct: 341 NTVITLSLGSRLRSIHNFPVQNKMGLNSKALLDLRLKNMS--------------TREDSY 386

Query: 471 MSHLHYNEVMNDIENYKTEIQESRREIEKLSSQNQLLHKDKKSSQDTIESQR--LQIRNL 528
           ++ + Y E  +++      IQ+++ ++    S N+ L +      D +E  R   Q +  
Sbjct: 387 LTRIKYLE--DEVSKLGGTIQQNKNQV----STNKSLTEKNMKLMDQLELYRKSQQTQKS 440

Query: 529 QSSMDYLYEKIDLKHKNEIE--LTNMIMKLKDAVRNMQGALKTHEDHEQRLQSDIQKMLY 586
            S  + L  + + + +NE+   L N++ K +  ++     L+   D E R +S + +   
Sbjct: 441 GSEEENLTSQQNGRIQNEMSEVLDNLMEKCERVIQ-----LQMRLDEELRQKSQMSQQ-- 493

Query: 587 DNILEYRRKIETKLDNLKQQALEQSFTIDDDINNV 621
              L Y+      L+ +  + LEQ  T ++++ NV
Sbjct: 494 ---LNYKESKAQALEAMNVKLLEQLNTNENEMRNV 525

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 52/108 (48%), Gaps = 12/108 (11%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  +KV+     Q  V ++I      + + G+N +++ +G   +GKTYTM G++      
Sbjct: 68  FRFNKVYDVGVRQQEVCEDIIGDNVMELLAGFNVSIMAFGSEGSGKTYTMFGND------ 121

Query: 127 LSEAAGIIPRVLFKLFDTLEVQESD----YMVKCSFIELYNEELKDLL 170
                GI+ R+   +FD L+    D      +  +F EL+ E + DLL
Sbjct: 122 --HEEGIVQRMCQSIFDQLDKLHEDSGNESTISINFFELFAENVYDLL 167

>TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {ON}
           Anc_2.633 YKL079W
          Length = 693

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 70/134 (52%), Gaps = 7/134 (5%)

Query: 309 RSHTIFTLTLYKNFNGETFRV-SKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLG 367
           RS TI  + L +    E     S I  VDLAGS+  S+   +    + A   N+ + +L 
Sbjct: 265 RSSTILRIKLLQLDEDEDLETQSTICFVDLAGSDRASKDIEKGITREAASKYNRVMDSLN 324

Query: 368 RVINSLADK-----NAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLE 422
            ++ +LA+      N  I +R S LTR+L D L GN KT LI + S  K +  ET STL 
Sbjct: 325 SMVYTLANSESISINKSI-YRNSHLTRILYDLLAGNHKTNLIFSCSLNKDDEYETFSTLG 383

Query: 423 YATKAKNIKNKPQL 436
           +++ A ++ N+ ++
Sbjct: 384 FSSYASSMSNQIKI 397

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 37/71 (52%), Gaps = 2/71 (2%)

Query: 48  VSINTSGDIGITARMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGM 107
           +++N+S + G      S  Y  DK+F P      +   ++    +D  KGYN T + YG 
Sbjct: 41  ITLNSSVNQGSLG--GSNQYRFDKIFEPEKPDDEINSTLSFACINDLFKGYNSTYISYGQ 98

Query: 108 TSTGKTYTMTG 118
           T TGKTYT+ G
Sbjct: 99  TGTGKTYTLYG 109

>NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}
           Anc_2.633
          Length = 598

 Score = 51.2 bits (121), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 65/125 (52%), Gaps = 8/125 (6%)

Query: 321 NFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHI 380
           N   + +++S ++ +DL G +  ++   Q     E   +N  + +   +I +L+D  + +
Sbjct: 259 NPKDQLYKLSTLSFIDLYGIDKFTKKDIQ-LTNDEMKKLNTLMSSFQNLITTLSDPKS-L 316

Query: 381 PF-----RESKLTRLLQDSLGGNTKTALIATI-SPAKINSEETSSTLEYATKAKNIKNKP 434
           P+     ++S L ++LQD +GGN+KT  I    SP+ I  EE    L++A   K+IKN  
Sbjct: 317 PYTSSLYKDSALNKILQDYIGGNSKTTFIIPFPSPSIIQHEELIEMLKFAMGLKSIKNPL 376

Query: 435 QLGSF 439
            +  F
Sbjct: 377 IMNVF 381

 Score = 33.9 bits (76), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 49/94 (52%), Gaps = 15/94 (15%)

Query: 59  TARMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTG 118
           T +++S+ +  D +F  +++Q+   + +      D   GYN + + YG +++GK+ T+  
Sbjct: 61  TLKLDSQDFKFDNIFPTNSEQN---EMLTVSTIKDLFDGYNQSFITYGKSNSGKSDTL-- 115

Query: 119 DEKLYDGELSEAAGIIPRVLF-KLFDTLEVQESD 151
                    +E  G+I R+LF +LF  ++   +D
Sbjct: 116 --------FNEKDGLI-RLLFEQLFKKVQSLTAD 140

>KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633
           YKL079W
          Length = 681

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 54/114 (47%), Gaps = 4/114 (3%)

Query: 61  RMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDE 120
           ++  ++++  KV    A ++  F E+A  +  D + G NC +  YG      +  M G +
Sbjct: 84  KLGEQSFSFSKVLNDQATKTEQFTELASKVTDDVLSGINCCVTTYGSGLAADSLVMFGPQ 143

Query: 121 KLYDGE---LSEAAGIIPRVLFKLFDTLEVQE-SDYMVKCSFIELYNEELKDLL 170
                E    S  +G++ +    +F+ ++    S+Y V  S  E+Y +++ DLL
Sbjct: 144 SGNSKEEQDSSRCSGLLQQTCKHIFNAIDSDSTSEYQVSLSLCEVYVDKVFDLL 197

 Score = 32.0 bits (71), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 77/377 (20%), Positives = 148/377 (39%), Gaps = 98/377 (25%)

Query: 307 SSRSHTIFTLTLYK-NFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLT 365
           S +SH    + + + N   +T +   +  V+LA     S   +Q +  K +  +      
Sbjct: 260 SKKSHIFVRMKITQVNELKDTLKEGIVQFVNLASDFKDSPGISQEESKKSSAGV----AL 315

Query: 366 LGRVINSLA-DKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYA 424
           L  V+  L+ D++    ++E+ LT+L+ + L  N KT+ +   S    N  +T   L++ 
Sbjct: 316 LREVVADLSSDESKASRYKEAHLTKLMYEPLMVNFKTSFVLCCSNNSKNRNDTLQLLQFG 375

Query: 425 TKAKNIKNKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIE 484
            + + I+ +     F                     L++K K  +Y+S +   E     E
Sbjct: 376 AQLQQIRTQVSGNVFG--------------------LNSKRKMELYLSDMKLKE-----E 410

Query: 485 NYKTEIQESRREIE---------------------------------KLSSQNQLLH--K 509
           NYK  I+  +R++E                                 KL  Q +LLH  K
Sbjct: 411 NYKERIRFLQRQLESSKNLNNGTAGTTSNKPANPVMDRLMKIQIENFKLKEQVKLLHSLK 470

Query: 510 DKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRNMQGALKT 569
             K+S +T   +++        M  L EK +     +IE+ +      +A+  + G LK 
Sbjct: 471 KAKASGETFNEEKI--------MQTLLEKCEQLATLQIEVDDE----GEAITKLNGKLKL 518

Query: 570 HEDHEQRL---------QSDIQKMLYDNILEYRRKIETKLDNLKQQALEQSFTIDDDINN 620
            E+ +  L         Q + Q+   + ++E+   + ++L++ K           + I  
Sbjct: 519 IEEKDHSLEKMNAKLVEQMNFQEQSLEKVIEHNSVLVSELNHWK-----------NLITT 567

Query: 621 VKDSLETLLETVKKDAI 637
            KD++E L E +K+  I
Sbjct: 568 QKDNIEALEEKLKRLGI 584

>NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON}
           Anc_2.633 YKL079W
          Length = 572

 Score = 40.8 bits (94), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 57/126 (45%), Gaps = 19/126 (15%)

Query: 308 SRSHTIFTLTL-YKNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 366
           S  HT   ++L   N + ++FR   I  VDL   E++                 Q + +L
Sbjct: 192 STFHTFVKISLQLVNCHEDSFRKCCIEFVDLCAQEDVL----------------QLVCSL 235

Query: 367 GRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATK 426
             V+++  D +  I   +S+  +LL +S+GGN KT  I   S  + N + +  TLE+  K
Sbjct: 236 VAVLSN--DNDKKIGKEKSQFCKLLSNSIGGNRKTTFILACSTLEQNEKISLETLEFGLK 293

Query: 427 AKNIKN 432
              + N
Sbjct: 294 VSQVVN 299

 Score = 40.0 bits (92), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 33/58 (56%), Gaps = 10/58 (17%)

Query: 91  FHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSEAAGIIPRVLFKLFDTLEVQ 148
            ++  +G +C+M+ YG ++TGKT+       L+D    +  GIIP  + +L+  LE Q
Sbjct: 73  INELTRGVDCSMVTYGQSATGKTHV------LFD----QVRGIIPLFIEQLYIYLEAQ 120

>NCAS0C02830 Chr3 (534302..536926) [2625 bp, 874 aa] {ON} Anc_8.401
          Length = 874

 Score = 39.7 bits (91), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 60/132 (45%), Gaps = 12/132 (9%)

Query: 276 EFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGETFRV------ 329
           E  I DA E L    K LS R  A  ++   S     ++ L L +    E          
Sbjct: 367 EIDIDDAIELLGSTFKNLSVRSYAVNRLKKASDTELELYLLQLVQAVCFENISTFSDKTN 426

Query: 330 SKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHI---PFRESK 386
           S+  +VD+ G++++ +S  QN   K    +N SLLTLG+ IN+L      I   P  E  
Sbjct: 427 SEFTIVDMNGTQHLGKS--QNVMPKTT-ELNSSLLTLGKSINNLNLDEMPIVISPLAEFL 483

Query: 387 LTRLLQDSLGGN 398
           + R L++S  GN
Sbjct: 484 IRRALKNSRLGN 495

>Skud_4.52 Chr4 complement(90001..90984) [984 bp, 327 aa] {ON}
           YDL205C (REAL)
          Length = 327

 Score = 35.8 bits (81), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 42/69 (60%), Gaps = 4/69 (5%)

Query: 596 IETKLDNLKQQALEQSFTID-DDINNVKDSLETLLETVKKDAIIMCENLAQKVVGDQPKF 654
           +E+K +   ++ L ++  +D D    V+D +E L+E VK+D++   +NLA++++ D  K 
Sbjct: 257 VESKYNEETKKLLLKAIVVDVDGTEAVEDEIEMLIENVKEDSMACGKNLAERMIADGAK- 315

Query: 655 FNSMLSELN 663
              +L E+N
Sbjct: 316 --KILDEIN 322

>Skud_4.196 Chr4 (341072..346450) [5379 bp, 1792 aa] {ON} YDL058W
            (REAL)
          Length = 1792

 Score = 35.4 bits (80), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 60/314 (19%), Positives = 139/314 (44%), Gaps = 30/314 (9%)

Query: 439  FMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIE--NYKTEIQESRRE 496
            F   DILV  ++ +L  L +++   ++     ++ +   +  N ++  N +++     +E
Sbjct: 950  FQSHDILVAKLTEKLKSLANNYRDLQATHESLIASMEEIKKENTMQMSNLESKFDSLSQE 1009

Query: 497  IEKLSSQNQLLHKDKKSSQDTIESQRL-----------QIRNLQSSMDYLYEKIDLKHKN 545
             E   S+ +LL ++ +  ++TI +  L              + +S +  L E+++     
Sbjct: 1010 KESFQSERELLEENIRKLKETISTLELTKEEAITKFNSSKEDYESQIGLLKEQLETVATE 1069

Query: 546  EIELTNMIMKLKDAVRNMQGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQ 605
              E  N I +L   + +++G L+T ++ +  L++          LE  +K+  +    +Q
Sbjct: 1070 NGESVNKISELSHNIDDLKGELETQKNFKDDLEAK---------LEASKKVLKETQANEQ 1120

Query: 606  QALEQSFTIDDDINNVKDSLETL------LETVKKDAIIMCENLAQKVVGDQPKFFNSML 659
               E+   ++ +I  +K+ L+ L      LE   K+++   E   +K + D+ K +N  L
Sbjct: 1121 HLKEEKLQLEGEITKIKEQLDNLRDNLKSLEKENKESVAQVEEY-KKQISDKEKEYNGKL 1179

Query: 660  SELNDMFSKVDEHTDRLKEGLSQITAENNNL-KAYLDTHFFRNNHQEILNVHADKTYHQL 718
            SELN+  + V +  + + +   ++  E   + KA  D    + +  E LN   ++     
Sbjct: 1180 SELNNEINSVQQKNETICQNNEKLKGEIEEIEKASEDQSNLKGSKIEALNAQIEELEESK 1239

Query: 719  NLSSKHLMSKITNI 732
             ++   L+  + N+
Sbjct: 1240 QITETKLLDSVKNM 1253

>Ecym_5291 Chr5 (586479..593942) [7464 bp, 2487 aa] {ON} similar to
           Ashbya gossypii AEL006W
          Length = 2487

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 34/61 (55%), Gaps = 7/61 (11%)

Query: 551 NMIMKLKDAVRNMQGALKTHEDHEQRL------QSDIQKMLYDNILEYRRKIETKL-DNL 603
           N++MKL    RN++   K+ E H++ L       +D QK+ ++ +L Y+  +  K  DNL
Sbjct: 830 NLLMKLVGKFRNIKAVYKSEELHQRLLILLGSRTTDAQKLSFEALLAYKEPVVVKYKDNL 889

Query: 604 K 604
           K
Sbjct: 890 K 890

>KLTH0H14806g Chr8 (1285442..1285493,1285556..1286544) [1041 bp, 346
           aa] {ON} similar to uniprot|Q06675 Saccharomyces
           cerevisiae YDR318W MCM21 Protein involved in
           minichromosome maintenance component of the COMA complex
           that bridges kinetochore subunits that are in contact
           with centromeric DNA and the subunits bound to
           microtubules
          Length = 346

 Score = 33.5 bits (75), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 37/85 (43%), Gaps = 15/85 (17%)

Query: 835 NINGTVDDIKNKHSVLRDELE---KNVSFIHASSEGFKAIDSSLKRIMNFRMPEGKTETL 891
           ++N  +  +KNK  VL DEL+   K VS +    EG    +  LK             TL
Sbjct: 13  SLNAEILQLKNKCRVLEDELQAQKKGVSEVPVEFEGLFQKNPELKH------------TL 60

Query: 892 ADDLIKHIDSSSVAPVASSGKTPLR 916
           +  + K  DS    P +S  K PL+
Sbjct: 61  SQKIFKETDSFPQTPYSSPKKRPLK 85

>KNAG0A03050 Chr1 complement(374568..375266) [699 bp, 232 aa] {ON}
           Anc_8.653 YOR232W
          Length = 232

 Score = 33.1 bits (74), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 55/117 (47%), Gaps = 3/117 (2%)

Query: 529 QSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRNMQGALKTHEDHEQRLQSDIQKMLYDN 588
           Q  +  L E+++ K K  ++L + +++     RN+QG   T +D E+     +QK   D 
Sbjct: 68  QQKIKTLEEQLETKEKENVDLKDRLLRSVADFRNLQGV--TKKDVEKAKAFALQKFAKD- 124

Query: 589 ILEYRRKIETKLDNLKQQALEQSFTIDDDINNVKDSLETLLETVKKDAIIMCENLAQ 645
           +LE        L   K++ L++S  I D    VK + E    T++K  I   + L +
Sbjct: 125 LLESVDNFGHALGAFKEEDLKKSKEISDLYTGVKMTKEVFENTLRKHGIEKVDPLGE 181

>KAFR0F03020 Chr6 (595158..597632) [2475 bp, 824 aa] {ON} Anc_4.46
           YLR309C
          Length = 824

 Score = 33.5 bits (75), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 71/268 (26%), Positives = 125/268 (46%), Gaps = 52/268 (19%)

Query: 488 TEIQESRREIEKLSSQ-----NQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLK 542
           TE++ S+ E +KLSSQ     N+L+ K+K     T+     QI+    + + + + +DL 
Sbjct: 415 TEVKTSKNETDKLSSQLNQVKNKLIQKEK-----TVIYLEKQIKEYAENQEPVKQAMDLL 469

Query: 543 HKNEIELTNMIMKLKDAVRNMQGALK----THEDH-------EQRLQSDIQKMLYDNILE 591
            +   +L+N I  LK+   ++   LK    T+ED+        +R+  DI +  YD +  
Sbjct: 470 KRENKQLSNRIDLLKNENESLNNDLKKNSSTYEDYLKENGKLTERI--DILQEKYDTLQN 527

Query: 592 YRRKIETKLDNLKQQALEQSFTIDDDINNVKDSLETLLETVKKDAIIMCENLAQ--KVVG 649
            +      +D++K+Q  E          NVK      L    K  I + + L+    ++ 
Sbjct: 528 LKNNSSDHMDSIKKQCEEL---------NVK------LREANKKIISLEDELSDYTSIIQ 572

Query: 650 DQPKFFNSM---LSEL-NDMFSKVDEHTDRLKEGLSQITAENNNLKAYLDTHFFRN---- 701
           D+ +  ++M   LSE  ND  +K+DE    ++  L+ +  ENNNLK+ L+    RN    
Sbjct: 573 DKAREADTMRRLLSESNNDEKNKLDE----METKLNSMIDENNNLKSELNLQSSRNKIEL 628

Query: 702 NHQEILNVHADKTYHQLNLSSKHLMSKI 729
            + + LN  +      L L+   L+S+I
Sbjct: 629 QNLQSLNDQSQNEIKSLQLNKLQLLSEI 656

>ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] {ON}
            similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1413

 Score = 33.9 bits (76), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 61/125 (48%), Gaps = 1/125 (0%)

Query: 464  KSKEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSSQNQLLHKDKKSSQDTIESQRL 523
            K++  I  SH    E   D+EN+  EIQ  +  IE L      +H+   S Q T E    
Sbjct: 993  KTENEINKSHKMKLETSRDLENFNQEIQTLKTTIEGLQDSLNKVHESVTSVQHTKEGLIE 1052

Query: 524  QIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRNMQGALKTHEDHEQRLQ-SDIQ 582
            + R L+  ++ + E I +    E+E+ N + KL     +++  +K +E+    L+  D+ 
Sbjct: 1053 ESRTLEDKLNDINEDIAIFKSFEMEMKNELEKLNSLSFHLKKEIKHYEEKLGDLKIRDVT 1112

Query: 583  KMLYD 587
            ++L+D
Sbjct: 1113 QILHD 1117

>Suva_4.43 Chr4 complement(81094..82077) [984 bp, 327 aa] {ON}
           YDL205C (REAL)
          Length = 327

 Score = 33.1 bits (74), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 41/69 (59%), Gaps = 4/69 (5%)

Query: 596 IETKLDNLKQQALEQSFTID-DDINNVKDSLETLLETVKKDAIIMCENLAQKVVGDQPKF 654
           +ET+ +   ++ L ++  +D D    V+D +E L+E VK+D++   + LA++++ D  K 
Sbjct: 257 VETRYNEKTKKLLLKAIVVDVDGTEAVEDEIEMLIENVKEDSMACGKILAERMIADGAK- 315

Query: 655 FNSMLSELN 663
              +L E+N
Sbjct: 316 --KILDEIN 322

>TPHA0K02220 Chr11 (473969..476431) [2463 bp, 820 aa] {ON} Anc_4.23
           YLL034C
          Length = 820

 Score = 33.5 bits (75), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 26/41 (63%), Gaps = 1/41 (2%)

Query: 820 LCHFQDRNDIANMTTNINGT-VDDIKNKHSVLRDELEKNVS 859
           L +FQ++ DI N  T +NGT +DD  N   ++RD+  KN S
Sbjct: 690 LPNFQEKLDIINTITKVNGTPLDDSVNLSEIIRDDRCKNFS 730

>SAKL0G18458g Chr7 (1591284..1593578) [2295 bp, 764 aa] {ON} similar
           to uniprot|P38883 Saccharomyces cerevisiae YHR197W RIX1
           RIbosome eXport essential protein
          Length = 764

 Score = 33.5 bits (75), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 32/145 (22%), Positives = 61/145 (42%), Gaps = 13/145 (8%)

Query: 780 CDSLSNKFKDDTTESLNSLKSHMESTVRESSLIADKIKDNLCHFQDRNDIANMTTNINGT 839
           CDS+  +F D   + +N+L +HM   + E ++    +  +L   QD+  + +M  N+N  
Sbjct: 423 CDSIKQEFFD-LLKLVNALSAHMGHCINEVTIFTKLVDVSLYLLQDKTSLDSMFANLNVN 481

Query: 840 VD----------DIKNKHSVLRDELEKNVSFIHASSEGFKAIDSSLKRIMNFRMPEGKTE 889
           V           D +     + D      SFI  SS  +  + +    I+ F+     T+
Sbjct: 482 VGAKQISKKQKKDARATTGSMSDLYSHPQSFISQSSLKWYTVVNEFLSIVLFQWKLPSTQ 541

Query: 890 TLADDLIKHIDSSSVAPVASSGKTP 914
            ++  +IK+   +S+      G  P
Sbjct: 542 QVS--IIKYAVGTSLILKEELGHVP 564

>TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {ON}
           Anc_4.237 YLR383W
          Length = 1119

 Score = 33.1 bits (74), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 55/104 (52%), Gaps = 8/104 (7%)

Query: 584 MLYDNILEYRRKIETKLDNLKQQALEQSFTIDDDINNVKDSLETLLETVKKDAIIMCENL 643
           + Y+N ++   +I   LD + ++A       D+ +N++  S ++L E   K+ +I  E+L
Sbjct: 787 IAYENSIQ---QIRNNLDQITEEAQPLKVNFDETLNDLTASQKSLKEA--KEEVINRESL 841

Query: 644 AQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKEGLSQ--ITA 685
            +K   D  K ++  +    D+  K+DE+   L+EG+ +  ITA
Sbjct: 842 MEKYQYD-LKIYSEKIKSYTDIIKKIDENVQSLEEGIEKQVITA 884

>NDAI0J02540 Chr10 complement(627186..629306) [2121 bp, 706 aa] {ON}
           Anc_4.301 YLR424W
          Length = 706

 Score = 32.7 bits (73), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 69/142 (48%), Gaps = 23/142 (16%)

Query: 474 LHYNEVMNDIENYKTEIQESRREIEKLSSQ------NQLLHKDKKSSQDT----IESQRL 523
           L  NE++N++  +++E +    +IE L SQ       + L +D KS   T    IE+   
Sbjct: 184 LALNEIVNELMLFQSESKSLDYQIEALQSQLEDLEVKETLFQDIKSLWSTTDNKIETVAQ 243

Query: 524 QIRNLQSS------MDYLYEKIDLK------HKNEIELTNMI-MKLKDAVRNMQGALKTH 570
           +IR +         M  L+ ++ LK      + N +E+ N+I M+L   V ++   + T 
Sbjct: 244 KIRIIDDDLLVDKLMAQLFSEVFLKDIGKLDNWNPLEIDNIILMQLDPIVTDLTYRMDTD 303

Query: 571 EDHEQRLQSDIQKMLYDNILEY 592
             H  R Q+ + K++++ +L Y
Sbjct: 304 SKHLNRTQTIVFKIIFNKLLAY 325

>Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON}
            YIL149C (REAL)
          Length = 1680

 Score = 32.7 bits (73), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 77/156 (49%), Gaps = 23/156 (14%)

Query: 428  KNIKNKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYK 487
            K++KN  +    + K+++  N+  E+++L+   + TK +  I     + N+V+     Y+
Sbjct: 1186 KSLKNVTEKNEAIYKELI--NMQEEISRLQGHLIQTKEQVSI-----NANKVLA----YE 1234

Query: 488  TEIQESRREIEKLSSQNQLLHKDKKSSQDTI----ESQRLQIRNLQSSMD--------YL 535
            +EI++ ++  + LS Q +L HK++      +    E + L ++N  + ++          
Sbjct: 1235 SEIEQCKQRYQDLSQQQKLTHKNETEKLHNVIGDLEVKLLNVQNANADLENKFNRLKKQA 1294

Query: 536  YEKIDLKHKNEIELTNMIMKLKDAVRNMQGALKTHE 571
            +EK+D   K +  LTN + +LK+    ++  L   E
Sbjct: 1295 HEKLDASKKQQTALTNELNELKETKDKLEENLHNEE 1330

>Kpol_1037.47 s1037 (114295..118818) [4524 bp, 1507 aa] {ON}
           (114295..118818) [4524 nt, 1508 aa]
          Length = 1507

 Score = 32.3 bits (72), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 5/68 (7%)

Query: 467 EGIYMSHLHYNEVMNDIENYKTEI-QESRREIEKLSSQNQLLHKDKKSSQDTI----ESQ 521
           E  + S   + ++++DIE YKTE+  E  REI  +S + +     +KSS  T+    + +
Sbjct: 442 ESYWKSSPEFKQLLSDIETYKTEVDPEKTREIYTMSLKQEKTKWTRKSSYYTVSFPEQVK 501

Query: 522 RLQIRNLQ 529
              IR  Q
Sbjct: 502 LCTIRGFQ 509

>NCAS0A05960 Chr1 complement(1173851..1176613) [2763 bp, 920 aa]
           {ON} Anc_4.46 YLR309C
          Length = 920

 Score = 32.3 bits (72), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 69/284 (24%), Positives = 134/284 (47%), Gaps = 40/284 (14%)

Query: 410 AKINSEETSSTLEYATKAKNIKNKPQLGSFMMKDILVKN----ISHELAKLKSDFLSTKS 465
           +KI+ EE ++      K K   N+  + ++ MK + + N    +++EL K K+   S + 
Sbjct: 431 SKIDKEELTNARNEIEKLKK-DNEAVVSTYRMKHVELTNKIDYLNNELTKFKAS--SDEQ 487

Query: 466 KEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSSQNQLLHKDKKSSQDTIESQRLQI 525
           K+ +  S  + N+++N ++   + I    R+   L  +N  + K+K     TI     QI
Sbjct: 488 KKQLQESVNNANDIINKLKIENSNITSQFRDYNNL--KNATIQKEK-----TIAYLEKQI 540

Query: 526 RNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRNMQGALKTHEDHEQRLQSDIQKML 585
           +    + D L ++ID++ K  I+LTN +  LK   +N+      H++  +  QS      
Sbjct: 541 KEYTEAKDKLNKEIDIQKKENIQLTNRLGLLKKENQNL------HDNESKNSQS------ 588

Query: 586 YDNILEYRRKIETKLDNLKQQALEQSFTIDDDINNVKDSLETLLETVKKDAIIMCENLAQ 645
           ++N L+   K+  +L  L+++         D + N+K +     +T+K+     CE L  
Sbjct: 589 FENYLKENGKLSERLSILQEKY--------DTLQNLKSNSSEQNDTIKR----QCEELNI 636

Query: 646 KVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKEGLSQITAENNN 689
           K+     +   S+  ELND  + + E T R  E + ++ A++ N
Sbjct: 637 KLKESNKRVI-SLEDELNDYTNIIQEKT-RESETMRRLLADSQN 678

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.129    0.349 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 93,546,959
Number of extensions: 4065903
Number of successful extensions: 20679
Number of sequences better than 10.0: 1215
Number of HSP's gapped: 20752
Number of HSP's successfully gapped: 1850
Length of query: 965
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 846
Effective length of database: 39,836,145
Effective search space: 33701378670
Effective search space used: 33701378670
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 71 (32.0 bits)