Re-run this search with the SEG filter switched on (default)

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D01045g6.16ON96596551530.0
Ecym_30206.16ON94495426420.0
SAKL0E01078g6.16ON94894625780.0
ACR010C6.16ON94594625380.0
KLTH0C11330g6.16ON94197424910.0
Kwal_56.224036.16ON94395524680.0
TDEL0G045306.16ON95896322810.0
ZYRO0C07898g6.16ON97494522820.0
Skud_5.286.16ON99893422170.0
Suva_5.66.16ON99996721930.0
NDAI0D008706.16ON106995321200.0
KAFR0L003706.16ON96398820800.0
NCAS0H008806.16ON100483020810.0
CAGL0B03641g6.16ON98880119890.0
TBLA0A072306.16ON109786819350.0
KNAG0M011306.16ON95095517800.0
YEL061C (CIN8)6.16ON100068715480.0
Smik_5.266.16ON100268615410.0
Kpol_1032.66.16ON100455314121e-179
Kpol_1045.736.16ON96295913311e-167
TPHA0M002406.16ON93958912051e-149
TPHA0J003006.16ON98297310401e-125
SAKL0F12298g7.387ON11125909451e-110
ZYRO0B03234g7.387ON11385339321e-108
TPHA0E008907.387ON12329528871e-101
TBLA0D006407.387ON11425607213e-79
Smik_2.537.387ON11133216452e-69
YBL063W (KIP1)7.387ON11113486391e-68
ACR228C7.387ON11293206348e-68
Skud_2.417.387ON11103116232e-66
NCAS0E026407.387ON11024586222e-66
Suva_2.547.387ON11102636222e-66
Ecym_46887.387ON11342196189e-66
TDEL0C016007.387ON11053236108e-65
NDAI0E043007.387ON11862166038e-64
KAFR0L017107.387ON11513135975e-63
Ecym_34152.633ON6623864542e-46
ADR145C2.633ON6354374505e-46
KLLA0D05951g8.678ON6683753832e-37
SAKL0G05016g5.531ON5041753673e-36
KLTH0D11286g8.678ON6783863663e-35
YPL155C (KIP2)8.678ON7064013638e-35
KLTH0G03850g5.531ON4731733549e-35
TPHA0D012708.678ON6964253611e-34
Skud_16.1278.678ON7064013574e-34
TBLA0C053103.479ON6763743557e-34
TDEL0A062408.678ON6374193521e-33
SAKL0G18920g2.633ON6491743484e-33
KLLA0B00759g5.531ON4561653371e-32
NCAS0C013508.678ON6553793441e-32
ZYRO0E08668g3.528ON7783743443e-32
Kwal_47.186085.531ON4791753327e-32
ACR145W8.678ON6854073361e-31
Smik_6.3528.678ON7154073372e-31
Ecym_23958.678ON6874123362e-31
ZYRO0F07414g8.678ON6543953281e-30
Ecym_40665.531ON4781743167e-30
TDEL0F036403.479ON7043773173e-29
Suva_16.1558.678ON7044003164e-29
KAFR0F042103.528ON6722123084e-28
Kpol_1004.255.531ON5061922955e-27
Kwal_47.190933.528ON8191742962e-26
Smik_7.483.528ON8051772952e-26
Skud_7.533.528ON8051752952e-26
Suva_7.443.528ON8051752943e-26
NCAS0E005503.528ON7841642916e-26
ZYRO0D12650g5.531ON4781782848e-26
KNAG0B005203.528ON7234152899e-26
KLTH0G01606g3.528ON8191742901e-25
TDEL0D059603.528ON7331572881e-25
CAGL0I07029g3.528ON7051752872e-25
YGL216W (KIP3)3.528ON8051752872e-25
TBLA0C039403.479ON7391822853e-25
NDAI0I029603.528ON8681852854e-25
SAKL0F01760g3.528ON8091562836e-25
Ecym_12003.528ON8333072811e-24
TPHA0D034803.528ON8471762792e-24
Kpol_423.83.528ON8061762792e-24
TBLA0C049603.528ON8011782773e-24
AER441C3.528ON8181662774e-24
KLLA0A01606g3.528ON7691762739e-24
KNAG0A078803.479ON7641532739e-24
Kpol_505.393.479ON6921492721e-23
KLTH0F14498g3.479ON7021502683e-23
SAKL0F03168g3.479ON7061702656e-23
Skud_16.4353.479ON7293722657e-23
CAGL0D04994g3.479ON6921492641e-22
Kpol_1050.1033.479ON6971532603e-22
AGR253W3.479ON7091692577e-22
Kpol_1013.78.678ON6201592558e-22
KAFR0B065903.479ON7061492561e-21
ZYRO0B04290g3.479ON7311492542e-21
Suva_16.4693.479ON7311462532e-21
Kwal_26.88068.678ON7152032523e-21
NCAS0F034703.479ON6981502514e-21
TPHA0D032003.479ON7241492514e-21
KAFR0H024108.678ON6582232496e-21
KLLA0B10956g3.479ON6901392496e-21
YPR141C (KAR3)3.479ON7291442488e-21
Ecym_44073.479ON7111492461e-20
Smik_16.3883.479ON7291442452e-20
NDAI0B057703.479ON7631542416e-20
SAKL0H06490g8.678ON6571732381e-19
KNAG0J017208.678ON6251802362e-19
CAGL0M02189g8.678ON6721892334e-19
TBLA0C018808.678ON4681492271e-18
NDAI0E02090singletonON6851912291e-18
TDEL0B072702.633ON6442482263e-18
TPHA0D041903.479ON6721692202e-17
Kpol_1019.112.633ON6471741871e-13
YKL079W (SMY1)2.633ON6561291773e-12
Kwal_55.21164singletonOFF5882001763e-12
Kwal_YGOB_55.211643.479ON6572031754e-12
TPHA0N016502.633ON6822151755e-12
Suva_11.1452.633ON6571241728e-12
Skud_11.1482.633ON6561091584e-10
Smik_11.1602.633ON6561091504e-09
KNAG0M025402.633ON5221161461e-08
CAGL0L05104g2.633ON6752851433e-08
KAFR0C040202.633ON6673061433e-08
TBLA0A008202.633ON8031671362e-07
NCAS0H031802.633ON6601231325e-07
TBLA0C008002.633ON6931341272e-06
ZYRO0E01078g2.633ON6681601263e-06
NDAI0C004802.633ON5981191236e-06
KNAG0H003602.633ON6811161067e-04
NCAS0C052002.633ON572126960.011
NCAS0C028308.401ON874132900.053
Skud_4.528.456ON32769820.38
Ecym_52913.211ON248761801.0
KLTH0D04928g2.451ON32551761.8
ZYRO0C01716g8.259ON1413125772.2
Suva_4.438.456ON32769752.7
KNAG0A030508.653ON232117742.8
TPHA0K022204.23ON82041752.9
KLTH0H14806g5.349ON34685742.9
KAFR0D030702.451ON32141743.1
SAKL0G18458g4.365ON76461753.4
Skud_4.1964.238ON1792314754.0
ZYRO0D10032g3.490ON20979714.9
KAFR0F030204.46ON824236735.2
TPHA0B008404.237ON1119104735.7
NDAI0J025404.301ON706142736.2
Kwal_26.76532.451ON32551717.0
Kpol_1037.473.220ON150768728.3
Skud_9.195.702ON1680156719.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D01045g
         (965 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar ...  1989   0.0  
Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to ...  1022   0.0  
SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar ...   997   0.0  
ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON} S...   982   0.0  
KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {...   964   0.0  
Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061...   955   0.0  
TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {O...   883   0.0  
ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {...   883   0.0  
Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON} Y...   858   0.0  
Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON} YE...   849   0.0  
NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {...   821   0.0  
KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16...   805   0.0  
NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {...   806   0.0  
CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} simila...   770   0.0  
TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON} Anc_...   749   0.0  
KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6....   690   0.0  
YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}  C...   600   0.0  
Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON} ...   598   0.0  
Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON} (9109..1...   548   e-179
Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa] ...   517   e-167
TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16...   468   e-149
TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16...   405   e-125
SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa] ...   368   e-110
ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa] ...   363   e-108
TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7....   346   e-101
TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7....   282   3e-79
Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W (R...   253   2e-69
YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}  KIP1Kines...   250   1e-68
ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON} ...   248   8e-68
Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W (R...   244   2e-66
NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7....   244   2e-66
Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W (...   244   2e-66
Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} simila...   242   9e-66
TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7....   239   8e-65
NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {...   236   8e-64
KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa] ...   234   5e-63
Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar t...   179   2e-46
ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON} S...   177   5e-46
KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} simila...   152   2e-37
SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly...   145   3e-36
KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} simila...   145   3e-35
YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON} ...   144   8e-35
KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some s...   140   9e-35
TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.6...   143   1e-34
Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {...   142   4e-34
TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON} Anc_3...   141   7e-34
TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON} Anc_8...   140   1e-33
SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]...   138   4e-33
KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some sim...   134   1e-32
NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {O...   137   1e-32
ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {...   137   3e-32
Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {...   132   7e-32
ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic ho...   134   1e-31
Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C ...   134   2e-31
Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}...   134   2e-31
ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} simila...   130   1e-30
Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar t...   126   7e-30
TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {O...   126   3e-29
Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {...   126   4e-29
KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {O...   123   4e-28
Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON} (54983....   118   5e-27
Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]...   118   2e-26
Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)   118   2e-26
Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)   118   2e-26
Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)   117   3e-26
NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}...   116   6e-26
ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some...   114   8e-26
KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528...   115   9e-26
KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} simila...   116   1e-25
TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa] ...   115   1e-25
CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} simila...   115   2e-25
YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}  KIP3Kinesin-...   115   2e-25
TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {O...   114   3e-25
NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {O...   114   4e-25
SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} simila...   113   6e-25
Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar t...   112   1e-24
TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {O...   112   2e-24
Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON} (11134..13...   112   2e-24
TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa] ...   111   3e-24
AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}...   111   4e-24
KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} simila...   109   9e-24
KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa] ...   109   9e-24
Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}...   109   1e-23
KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]...   107   3e-23
SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} simila...   106   6e-23
Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {...   106   7e-23
CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {...   106   1e-22
Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]...   104   3e-22
AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic ...   103   7e-22
Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON} (11880.....   102   8e-22
KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa] ...   103   1e-21
ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} simila...   102   2e-21
Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {...   102   2e-21
Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C...   101   3e-21
NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {O...   101   4e-21
TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {O...   101   4e-21
KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {O...   100   6e-21
KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} simila...   100   6e-21
YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON} ...   100   8e-21
Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar t...    99   1e-20
Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {...    99   2e-20
NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa] ...    97   6e-20
SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {...    96   1e-19
KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8....    96   2e-19
CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa] ...    94   4e-19
TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.6...    92   1e-18
NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {O...    93   1e-18
TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa] ...    92   3e-18
TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {O...    89   2e-17
Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {O...    77   1e-13
YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Prote...    73   3e-12
Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa] {...    72   3e-12
Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)...    72   4e-12
TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {...    72   5e-12
Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079...    71   8e-12
Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079...    65   4e-10
Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079...    62   4e-09
KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2....    61   1e-08
CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa] ...    60   3e-08
KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.6...    60   3e-08
TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.6...    57   2e-07
NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633     55   5e-07
TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {O...    54   2e-06
ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar ...    53   3e-06
NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}...    52   6e-06
KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633...    45   7e-04
NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON} Anc_2...    42   0.011
NCAS0C02830 Chr3 (534302..536926) [2625 bp, 874 aa] {ON} Anc_8.401     39   0.053
Skud_4.52 Chr4 complement(90001..90984) [984 bp, 327 aa] {ON} YD...    36   0.38 
Ecym_5291 Chr5 (586479..593942) [7464 bp, 2487 aa] {ON} similar ...    35   1.0  
KLTH0D04928g Chr4 complement(447820..448797) [978 bp, 325 aa] {O...    34   1.8  
ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] ...    34   2.2  
Suva_4.43 Chr4 complement(81094..82077) [984 bp, 327 aa] {ON} YD...    33   2.7  
KNAG0A03050 Chr1 complement(374568..375266) [699 bp, 232 aa] {ON...    33   2.8  
TPHA0K02220 Chr11 (473969..476431) [2463 bp, 820 aa] {ON} Anc_4....    33   2.9  
KLTH0H14806g Chr8 (1285442..1285493,1285556..1286544) [1041 bp, ...    33   2.9  
KAFR0D03070 Chr4 (606943..607908) [966 bp, 321 aa] {ON} Anc_2.45...    33   3.1  
SAKL0G18458g Chr7 (1591284..1593578) [2295 bp, 764 aa] {ON} simi...    33   3.4  
Skud_4.196 Chr4 (341072..346450) [5379 bp, 1792 aa] {ON} YDL058W...    33   4.0  
ZYRO0D10032g Chr4 complement(847175..847804) [630 bp, 209 aa] {O...    32   4.9  
KAFR0F03020 Chr6 (595158..597632) [2475 bp, 824 aa] {ON} Anc_4.4...    33   5.2  
TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {...    33   5.7  
NDAI0J02540 Chr10 complement(627186..629306) [2121 bp, 706 aa] {...    33   6.2  
Kwal_26.7653 s26 complement(459583..460560) [978 bp, 325 aa] {ON...    32   7.0  
Kpol_1037.47 s1037 (114295..118818) [4524 bp, 1507 aa] {ON} (114...    32   8.3  
Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON} ...    32   9.5  

>KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar to
           uniprot|Q8J1G7 Ashbya gossypii ACR010C CIN8 Kinesin-like
           protein CIN8 and some similarites with YEL061C
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 965

 Score = 1989 bits (5153), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 965/965 (100%), Positives = 965/965 (100%)

Query: 1   MSATNGSPEGDELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITA 60
           MSATNGSPEGDELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITA
Sbjct: 1   MSATNGSPEGDELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITA 60

Query: 61  RMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDE 120
           RMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDE
Sbjct: 61  RMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDE 120

Query: 121 KLYDGELSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNN 180
           KLYDGELSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNN
Sbjct: 121 KLYDGELSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNN 180

Query: 181 SRKLRIYDSLNSSNNVTNVNSRSSSRSNSPTVNLEAKRRIRAGALYKPKPKLPTQSQSNG 240
           SRKLRIYDSLNSSNNVTNVNSRSSSRSNSPTVNLEAKRRIRAGALYKPKPKLPTQSQSNG
Sbjct: 181 SRKLRIYDSLNSSNNVTNVNSRSSSRSNSPTVNLEAKRRIRAGALYKPKPKLPTQSQSNG 240

Query: 241 QQQQQQQQQQQQQQQQQTQGQVNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVAS 300
           QQQQQQQQQQQQQQQQQTQGQVNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVAS
Sbjct: 241 QQQQQQQQQQQQQQQQQTQGQVNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVAS 300

Query: 301 TKMNDVSSRSHTIFTLTLYKNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSIN 360
           TKMNDVSSRSHTIFTLTLYKNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSIN
Sbjct: 301 TKMNDVSSRSHTIFTLTLYKNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSIN 360

Query: 361 QSLLTLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSST 420
           QSLLTLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSST
Sbjct: 361 QSLLTLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSST 420

Query: 421 LEYATKAKNIKNKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVM 480
           LEYATKAKNIKNKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVM
Sbjct: 421 LEYATKAKNIKNKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVM 480

Query: 481 NDIENYKTEIQESRREIEKLSSQNQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKID 540
           NDIENYKTEIQESRREIEKLSSQNQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKID
Sbjct: 481 NDIENYKTEIQESRREIEKLSSQNQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKID 540

Query: 541 LKHKNEIELTNMIMKLKDAVRNMQGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKL 600
           LKHKNEIELTNMIMKLKDAVRNMQGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKL
Sbjct: 541 LKHKNEIELTNMIMKLKDAVRNMQGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKL 600

Query: 601 DNLKQQALEQSFTIDDDINNVKDSLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLS 660
           DNLKQQALEQSFTIDDDINNVKDSLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLS
Sbjct: 601 DNLKQQALEQSFTIDDDINNVKDSLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLS 660

Query: 661 ELNDMFSKVDEHTDRLKEGLSQITAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNL 720
           ELNDMFSKVDEHTDRLKEGLSQITAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNL
Sbjct: 661 ELNDMFSKVDEHTDRLKEGLSQITAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNL 720

Query: 721 SSKHLMSKITNIISDHVEQNRTLLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVC 780
           SSKHLMSKITNIISDHVEQNRTLLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVC
Sbjct: 721 SSKHLMSKITNIISDHVEQNRTLLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVC 780

Query: 781 DSLSNKFKDDTTESLNSLKSHMESTVRESSLIADKIKDNLCHFQDRNDIANMTTNINGTV 840
           DSLSNKFKDDTTESLNSLKSHMESTVRESSLIADKIKDNLCHFQDRNDIANMTTNINGTV
Sbjct: 781 DSLSNKFKDDTTESLNSLKSHMESTVRESSLIADKIKDNLCHFQDRNDIANMTTNINGTV 840

Query: 841 DDIKNKHSVLRDELEKNVSFIHASSEGFKAIDSSLKRIMNFRMPEGKTETLADDLIKHID 900
           DDIKNKHSVLRDELEKNVSFIHASSEGFKAIDSSLKRIMNFRMPEGKTETLADDLIKHID
Sbjct: 841 DDIKNKHSVLRDELEKNVSFIHASSEGFKAIDSSLKRIMNFRMPEGKTETLADDLIKHID 900

Query: 901 SSSVAPVASSGKTPLRPLLKSETKQRSLSKSVSPAKSSHATIINSPLKRKSSDSRIFPGN 960
           SSSVAPVASSGKTPLRPLLKSETKQRSLSKSVSPAKSSHATIINSPLKRKSSDSRIFPGN
Sbjct: 901 SSSVAPVASSGKTPLRPLLKSETKQRSLSKSVSPAKSSHATIINSPLKRKSSDSRIFPGN 960

Query: 961 SKKQR 965
           SKKQR
Sbjct: 961 SKKQR 965

>Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to
           Ashbya gossypii ACR010C
          Length = 944

 Score = 1022 bits (2642), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/954 (54%), Positives = 706/954 (74%), Gaps = 45/954 (4%)

Query: 11  DELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVD 70
           +ELNITVAVRCRGRNE+EIKAKS+VVV  PDV G+NEVSINT+GDIGI  +MNS+TYTVD
Sbjct: 19  EELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTYTVD 78

Query: 71  KVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSEA 130
           +VFGPSADQ L+FK IA+P+F DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLYDGELS++
Sbjct: 79  QVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSDS 138

Query: 131 AGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKLRIYDSL 190
           AGIIPRVLF+LFDTLE  ESD++VKCS+IELYNEELKDLLDD  D     S++LRI+DS 
Sbjct: 139 AGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTPDY----SKRLRIFDS- 193

Query: 191 NSSNNVTNVNSRSSSRSNSP-----TVNLEAKRRIRAGALYKPKPKLPTQSQSNGQQQQQ 245
              N +TN  SR+ S++NSP     T +  AKRR      Y   P  P +   N Q    
Sbjct: 194 ---NTITN--SRAGSQNNSPKEQDGTSSSMAKRR------YTHIPTKPKRPSLNKQL--- 239

Query: 246 QQQQQQQQQQQQTQGQVNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMND 305
                           + EQSSAIYIQ+LQEFHIT+A+EG+ +LQKGL HRQVASTKMND
Sbjct: 240 ----------------LYEQSSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMND 283

Query: 306 VSSRSHTIFTLTLYKNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLT 365
            SSRSHTIFT+ LYK++ GE FR+SK+NLVDLAGSENISRSGAQNQRAKEAGSINQSLLT
Sbjct: 284 FSSRSHTIFTIMLYKSYEGELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLT 343

Query: 366 LGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYAT 425
           LGRVINSLADK+ HIPFRESKLTRLLQDSLGGNTKTALIATISPAKIN++ETSSTLEYAT
Sbjct: 344 LGRVINSLADKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAT 403

Query: 426 KAKNIKNKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIEN 485
           KAKNIKN+PQLGSFMMKDILVK+IS EL+KLKSDFLSTK+KEGIYMSH HY E++ND+EN
Sbjct: 404 KAKNIKNRPQLGSFMMKDILVKSISSELSKLKSDFLSTKAKEGIYMSHEHYQEMVNDLEN 463

Query: 486 YKTEIQESRREIEKLSSQNQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKN 545
           Y+TEIQES+R++E  SSQN LL KDKK+SQ   E Q ++I  LQ++++YL +KI+ +H+N
Sbjct: 464 YQTEIQESKRQVESFSSQNSLLLKDKKASQQLNELQDMKITRLQNTIEYLCDKIERQHRN 523

Query: 546 EIELTNMIMKLKDAVRNMQGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQ 605
           EI+L + I KLK+A+  M+G+L+ +E HE RLQ+DI+++LY  I  YR  ++  L+ +K 
Sbjct: 524 EIDLVSTIHKLKEALHTMKGSLQNYETHELRLQNDIKEVLYQGITSYRESMDQHLETVKT 583

Query: 606 QALEQSFTIDDDINNVKDSLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSE-LND 664
           + L+++ +I+ +++ ++      L++V+     MC N+  K+V DQP        E L D
Sbjct: 584 RMLDKNLSINHNMDEIRTIFHETLDSVRSAGSDMCTNIV-KIVKDQPSTSYQQFKEALGD 642

Query: 665 MFSKVDEHTDRLKEGLSQITAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKH 724
           + +KV  ++  L   L+++T ENNN+K YLD HF +NN+QE+L++  +K YH+   +S  
Sbjct: 643 LDTKVQTYSVTLTNKLTEMTEENNNMKEYLDEHFLKNNNQEMLDLRMEKAYHKSKTASDA 702

Query: 725 LMSKITNIISDHVEQNRTLLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLS 784
           L+S + +++  H+E++R L++ ++K A +E+I +E+  F+PV++ W  SF +IN CD+  
Sbjct: 703 LISSVVSMMESHMEESRNLMLSSMKDAVSEMIDKELEMFQPVKERWVLSFENINECDAAH 762

Query: 785 NKFKDDTTESLNSLKSHMESTVRESSLIADKIKDNLCHFQDRNDIANMTTNINGTVDDIK 844
            +F++ +T+ L +LK   +++V  +  +A ++++N+ +F+     A+   +I   ++DI 
Sbjct: 763 QQFENKSTKLLTNLKELADNSVVAADDVAKQVQENVTNFEGIVRQASAKESIVKQMNDIN 822

Query: 845 NKHSVLRDELEKNVSFIHASSEGFKAIDSSLKRIMNFRMPEGKTETLADDLIKHIDSSSV 904
           +KH +L D  E N+ +   SS+GF+ +D S+K+I+    PE       + L++ ++S S 
Sbjct: 823 DKHKMLEDHFENNIKYFKESSKGFEEMDCSIKKIIREMSPEVGDIKQIEALLERVNSRSF 882

Query: 905 APVASSGKTPLRPLLKSETKQRSLSKSVSPAKSSHATIIN-SPL-KRKSSDSRI 956
            P+AS+GKTP+RP LK+    ++ S+S+SP KS    +++  PL KR + D  +
Sbjct: 883 GPIASTGKTPMRPELKNPIP-KTRSRSMSPIKSLDTNVVHVVPLIKRGTMDIEV 935

>SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar to
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 948

 Score =  997 bits (2578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/946 (54%), Positives = 696/946 (73%), Gaps = 31/946 (3%)

Query: 10  GDELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTV 69
           G ELNITV+VRCRGRNE+EIKAKSSVVV  PDV G+NEVSINT+ ++GITA+MNSKTYTV
Sbjct: 14  GQELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTV 73

Query: 70  DKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSE 129
           DKVFGPSADQSL+FK+IA+P+F DFIKGYNCT+LVYGMTSTGKTYTMTGDE+LYDGELS+
Sbjct: 74  DKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSD 133

Query: 130 AAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKLRIYDS 189
           AAGIIPR+LFKLFDTLE Q+ DY+VKCSFIELYNEELKDLL++ Q+SG    +KLRI+DS
Sbjct: 134 AAGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNEPQESGV--IKKLRIFDS 191

Query: 190 LNSSNNVTNVNSRSSSRSNSPTVNLEAKRRIRAGALYKPKPKLPTQSQSNGQQQQQQQQQ 249
             ++ +  + N+  ++  N    +   KR  +    YK + +     Q   QQQ +    
Sbjct: 192 --NTTSSNSRNNSRNNSPNLVGTSGTFKRIFKTPVPYKQQQQHQQHLQQQQQQQPRLINN 249

Query: 250 QQQQQQQQTQGQVNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSR 309
           +QQ         ++EQSSAIYIQ+LQEFHIT+AK+G+ LLQ+GL HRQVASTKMND SSR
Sbjct: 250 KQQS--------LSEQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSR 301

Query: 310 SHTIFTLTLYKNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRV 369
           SHTIFT+ LYKN NGE FRVSK+NLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRV
Sbjct: 302 SHTIFTIMLYKNHNGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRV 361

Query: 370 INSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKN 429
           INSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKIN+EETSSTLEYATKAKN
Sbjct: 362 INSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKN 421

Query: 430 IKNKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTE 489
           IKNKPQLG+ +MKDILVKNI+ ELAK+KSDFLSTKSK+GIYM+  HY E+ +D+ENYKTE
Sbjct: 422 IKNKPQLGTLVMKDILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSDLENYKTE 481

Query: 490 IQESRREIEKLSSQNQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIEL 549
           +QE +REIEK++SQN LL KDK++S +  E QR++I++L   + +LY+K+D +HKNE +L
Sbjct: 482 VQECKREIEKMNSQNVLLLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDL 541

Query: 550 TNMIMKLKDAVRNMQGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQALE 609
              I  LKDA+  +Q +LK  ED++ + +S+++ +LYD++  +++ I  +L  +K     
Sbjct: 542 VCTIHTLKDAIYTVQNSLKNCEDYQLQCKSEMEDVLYDHVTSFKQSIHEQLAAMKASHSS 601

Query: 610 QSFTIDDDINNVKDSLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSELNDMFSKV 669
           +   ID +I+ +++ L  +LE++   ++ +C +  +K++   PK F S+  +L D+ + V
Sbjct: 602 RHLGIDGNIDIIQEELSQVLESICSTSVDVCRSCVEKILESNPKHFESIRRDLLDISTVV 661

Query: 670 DEHTDRLKEGLSQITAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKHLMSKI 729
           D +++ L + L  I+ E NN + YL+ H F+NNH+E L++H DKTYH L  S+  L SK 
Sbjct: 662 DSYSNELVKNLGDISEEYNNFREYLNEHLFKNNHEETLSIHVDKTYHMLKKSAGELFSKF 721

Query: 730 TNIISDHVEQNRTLLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLSNKFKD 789
             ++  H+E+N++L++ +LKTA+ EV+ +E+  F PV++ WE S  +IN CDSL+N F  
Sbjct: 722 KEMMDSHLEENKSLMIKSLKTASDEVVAKEVKLFAPVKQKWESSLENINKCDSLNNTFDS 781

Query: 790 DTTESLNSLKSHMESTVRESSLIADKIKDNLCHFQDRNDIANMTTNINGTVDDIKNKHSV 849
              ++L  L+ ++E ++  S   A  +KD+L  F   +++    T +   ++++K KH+ 
Sbjct: 782 TVKDALRRLEGNIEGSLEFSKNTAGDVKDSLKKFDGISEVLKNNTKVVNNINEVKEKHTF 841

Query: 850 LRDELEKNVSFIHASSEGFKAIDSSLKRIMNFRMPE---GKTETLADDLIKHIDSSSVAP 906
           LRD++E+  S+I A++E F+ ID  +++I++ ++P    G  E L + +++ +  + + P
Sbjct: 842 LRDQVERTSSYIEAANEKFEGIDQFIRQIIDKKLPTHLVGNGE-LVNVMLEQLGKTHLKP 900

Query: 907 VASSGKTPLRPLLKSETKQRSLSKSVSPAKSSHATIIN--SPLKRK 950
           + S+ +TP              S+SVSP K+    I N  SP KRK
Sbjct: 901 IGSASRTP-------------SSRSVSPMKTLDNNIFNGISPSKRK 933

>ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL061C
           (CIN8)
          Length = 945

 Score =  982 bits (2538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/946 (53%), Positives = 684/946 (72%), Gaps = 42/946 (4%)

Query: 11  DELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVD 70
           +ELNITVAVRCRGRNE+EIKAKSSVVV  PDV G+NEVSINT+ ++GI A+MNS+TYTVD
Sbjct: 19  EELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTVD 78

Query: 71  KVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSEA 130
           KVFGPSADQSL+FKEIA+P+F DF+KGYNCT+LVYGMTSTGKTYTMTGDEKLYDG+LS++
Sbjct: 79  KVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSDS 138

Query: 131 AGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKLRIYDSL 190
           AGIIPR++FKLFD LE  +SD++VKCS+IELYNEELKDLLD+  DS    S++LRI+DS 
Sbjct: 139 AGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHDS----SKRLRIFDS- 193

Query: 191 NSSNNVTNVNSRSSSRSNSPTV--NLEAKRRIRAGALYKPKPKLPTQSQSNGQQQQQQQQ 248
            SS N ++  S  S+    P V  N  ++RR R      P P                  
Sbjct: 194 -SSMNHSSRASSQSNSPREPEVAHNGFSRRRQR------PPP------------------ 228

Query: 249 QQQQQQQQQTQGQVNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSS 308
             +  +   T+ Q++E  S IY+Q++QEFHI +A+EG+ +LQKGL HRQVASTKMND SS
Sbjct: 229 -VKANRMSATKQQLSESGSGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSS 287

Query: 309 RSHTIFTLTLYKNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGR 368
           RSHTIFT+ LYKN +GE FRVSK+NLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGR
Sbjct: 288 RSHTIFTIMLYKNCDGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGR 347

Query: 369 VINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAK 428
           VINSLADK+ HIPFRESKLTRLLQDSLGGNTKTALIATISPAKIN++ETSSTLEYA KAK
Sbjct: 348 VINSLADKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAK 407

Query: 429 NIKNKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKT 488
           NIKN+PQLG+ MMKDILVKNIS ELAK+KSDFLSTKSK+GIYMSH HY E++ND+EN +T
Sbjct: 408 NIKNRPQLGALMMKDILVKNISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQT 467

Query: 489 EIQESRREIEKLSSQNQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIE 548
           EIQES+R+IE L+SQN LL KDKK+SQ+  E Q  +I+ LQS+++YLY+KI+ +H NE E
Sbjct: 468 EIQESKRQIESLTSQNNLLLKDKKASQEVTELQNSKIKKLQSTIEYLYDKIERQHHNETE 527

Query: 549 LTNMIMKLKDAVRNMQGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQAL 608
           L   I KLK+A+  MQG+LK++E HE RLQ+DI+++LY  I  YR  +   L+ +K   L
Sbjct: 528 LATTIHKLKEALHTMQGSLKSYETHELRLQNDIKEVLYQGITSYRESMNQHLEKVKVSML 587

Query: 609 EQSFTIDDDINNVKDSLETLLETVKKDAIIMCENLAQKVVGDQP----KFFNSMLSELND 664
           +++ +I ++INN+    +  L++V+ +   MC+ L  K++ + P    K FN  +S L  
Sbjct: 588 DKNLSIKENINNITTIFDDTLKSVEANGSDMCDTLV-KLIKETPSMYLKEFNETVSSLK- 645

Query: 665 MFSKVDEHTDRLKEGLSQITAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKH 724
             S++  +++ L   L++I+ ENN+L+ YLD H F+N+ QE+L++  +  Y ++   S  
Sbjct: 646 --SELSSYSNALTNKLTEISEENNHLREYLDQHLFKNSTQEVLDLRMESVYQKVKNDSDQ 703

Query: 725 LMSKITNIISDHVEQNRTLLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLS 784
           L+SK+ +++  HVE++RTL+++++K    E+I  E S F+P+R  W  S ++IN CD+  
Sbjct: 704 LLSKLVSMVGAHVEESRTLMVNSMKDTVNEIIDNERSLFQPIRDRWIASCDNINQCDASH 763

Query: 785 NKFKDDTTESLNSLKSHMESTVRESSLIADKIKDNLCHFQDRNDIANMTTNINGTVDDIK 844
             F+  +T  L+ LK   +++++ S    +K K     F D         ++   + DI 
Sbjct: 764 QNFEAKSTSGLDKLKELSDASLKSSEDAVNKAKHRTDSFHDFVQKLCCDQSLKKQMHDIS 823

Query: 845 NKHSVLRDELEKNVSFIHASSEGFKAIDSSLKRIMNFRMPEGKTETLADDLIKHIDSSSV 904
           +KH +L D  + NV +   SS+GF+ +D S+K+I++   PE       + L++ I++ + 
Sbjct: 824 DKHRMLEDHFDDNVKYFKESSKGFEDMDCSIKKIIHEMSPEVGDIKSVETLMERINARTF 883

Query: 905 APVASSGKTPLRPLLKSETKQRSLSKSVSPAKSSHATI-INSPLKR 949
           +PV  +GKTP R +LK+    ++ S+S+SP K+    + I SP+KR
Sbjct: 884 SPVRPTGKTPSRQVLKNAITSKASSRSMSPIKTLDTNVRIISPVKR 929

>KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {ON}
           similar to uniprot|P27895 Saccharomyces cerevisiae
           YEL061C CIN8 Kinesin motor protein involved in mitotic
           spindle assembly and chromosome segregation
          Length = 941

 Score =  964 bits (2491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 510/974 (52%), Positives = 687/974 (70%), Gaps = 56/974 (5%)

Query: 9   EGDELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYT 68
           E +ELNITVAVRCRGRNEKE+KAKSSVVV  PDV G NEVSINT+GD GITA++NSKTYT
Sbjct: 3   EEEELNITVAVRCRGRNEKEVKAKSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYT 62

Query: 69  VDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELS 128
           VD+VFGPSADQ L+FK IA+P+F DFIKGYNCT+LVYGMTSTGKTYTMTGDE+LYDGELS
Sbjct: 63  VDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELS 122

Query: 129 EAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKLRIYD 188
           E AGIIPRVLFKLFD L+    DYM+KCSFIELYNEELKDLLD+  DS  +  RKLRI+D
Sbjct: 123 EGAGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETPDS--SMPRKLRIFD 180

Query: 189 SLNSSNNVTNVNSRSSSRSNSPTVNLEAKRRIRAGALYKPK--PKL-PTQSQSNGQQQQQ 245
           S+ + N+  + +  SS +    + +   KRRIR   +YKP   P + PT S         
Sbjct: 181 SVTNPNSSRSSSRNSSPKPPEGSTS-GTKRRIRPNTMYKPSRSPTVKPTLS--------- 230

Query: 246 QQQQQQQQQQQQTQGQVNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMND 305
                            +E +SAI+IQ+LQEFHI DAKEG+RLLQ+GL HRQVASTKMND
Sbjct: 231 -----------------SELNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMND 273

Query: 306 VSSRSHTIFTLTLYKNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLT 365
           VSSRSHTIFT+ LY+  NGE+FRVSK+NLVDLAGSENISRSGAQNQRAKEAGSINQSLLT
Sbjct: 274 VSSRSHTIFTIMLYRKCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLT 333

Query: 366 LGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYAT 425
           LGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYAT
Sbjct: 334 LGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYAT 393

Query: 426 KAKNIKNKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIEN 485
           KAKNIKNKPQ+GSF+MKD+LVKN++ EL K++SD L+TKSK+GIYMS  +Y E+ N++EN
Sbjct: 394 KAKNIKNKPQVGSFIMKDVLVKNVTAELVKIRSDLLATKSKDGIYMSQENYKELTNELEN 453

Query: 486 YKTEIQESRREIEKLSSQNQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKN 545
           YKTE+QE +R IE+LS+QN LL K+K+ + +  ESQRL+I+ L +++D+LY+KID +HKN
Sbjct: 454 YKTEVQECKRAIERLSTQNGLLTKEKRITNEVNESQRLKIKKLSNNIDFLYDKIDRQHKN 513

Query: 546 EIELTNMIMKLKDAVRNMQGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQ 605
           E EL+N++ +L  A+R MQ +LK +ED   R Q++++++LY+NI  ++  +  +++ LK 
Sbjct: 514 EQELSNVVQELMRALRTMQNSLKVYEDQGHRFQTEMERVLYENIGSFKHSLLNEIEKLKG 573

Query: 606 QALEQSFTIDDDINNVKDSLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSELNDM 665
              E  F +D +I+ +   L  + + +    I +C     K+    P +   + +++  +
Sbjct: 574 TE-EDGFDVDANIDTLTKELNRIYDFINTSTIEICRKFMNKITEQTPTYLQDIRNQVESI 632

Query: 666 FSKVDEHTDRLKEGLSQITAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKHL 725
              V  ++  L   LS I+ E N+LK YL+ HFF+NN Q+ L+VH D+TYHQL +S+  +
Sbjct: 633 THVVGSYSSDLMMHLSSISEEYNHLKDYLNEHFFKNNFQDALDVHVDRTYHQLKVSANSI 692

Query: 726 MSKITNIISDHVEQNRTLLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLSN 785
             K+  ++++ +E N+ ++M +LK A +EV+ +EM   +PV++ WE S  +IN CD L++
Sbjct: 693 FLKLREMMNEELETNKEIMMQSLKNAASEVVAKEMGLLDPVKQAWESSLENINECDKLNS 752

Query: 786 KF-KD------DTTESLNSLKSHMESTVRESSLIADKIKDNLCHFQDRNDIANMTTNING 838
            F KD      D  E +N      ES V +++L       +L  FQD +        I G
Sbjct: 753 GFEKDIGSVVRDVFEKINEGLQFSESAVGDANL-------DLSRFQDASRALRTDDVIPG 805

Query: 839 TVDDIKNKHSVLRDELEKNVSFIHASSEGFKAIDSSLKRIMNFR-MPEGKTETLADDLIK 897
           ++++IK KH++L+ +++ + S++ A+++ F  ID S++ ++N + + +  +E   + L++
Sbjct: 806 SIEEIKKKHNMLKLKVQDSASYMEAATQKFGEIDDSIQGLLNSQAVSQPHSENRIEGLLE 865

Query: 898 HIDSSSVAPVASSGKTPLRPL--LKSETKQRSL----SKSVSPAKSSHAT-IINSPLKRK 950
            ++   + P+  SGKTP+R      + + Q SL    S S+SP +        +SP KRK
Sbjct: 866 QLNGKPLKPLGPSGKTPMRITQGCIASSDQLSLPRKRSYSISPIREIDGNRKASSPFKRK 925

Query: 951 -SSDSRIFPGNSKK 963
            + D    P +S+K
Sbjct: 926 ITIDHENVPFSSQK 939

>Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061C
           (CIN8) - 1:1 [contig 185] FULL
          Length = 943

 Score =  955 bits (2468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/955 (51%), Positives = 681/955 (71%), Gaps = 48/955 (5%)

Query: 11  DELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVD 70
           +ELNITVAVRCRGRNEKE+KA+SSVVV  PDV G NEVSINT+GD GITA++NSKTYTVD
Sbjct: 5   EELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTVD 64

Query: 71  KVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSEA 130
           KVFGPSADQ L+FK IA+P+F DFIKGYNCT+LVYGMTSTGKTYTMTGDE+LYDGELSE 
Sbjct: 65  KVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEG 124

Query: 131 AGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKLRIYDSL 190
           AGIIPRVLFKLFD L  Q  DYM+KCSFIELYNEELKDLLD+  DS     +KLRI+DS+
Sbjct: 125 AGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETPDSSM--PKKLRIFDSV 182

Query: 191 NSSNNVTNVNSRSSSRSNSPTVNLEAKRRIRAGALYKP------KPKLPTQSQSNGQQQQ 244
           ++ ++ +  +SR++S   +   +   +R+ RA ++++P      KP  P           
Sbjct: 183 SNVSSNSRASSRNNSPKPNEGSSFGTRRKTRAPSIHRPTKSPVSKPVSPC---------- 232

Query: 245 QQQQQQQQQQQQQTQGQVNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMN 304
                              E SSAI+IQ+LQEFHI DAKEG+RLLQ+GL HRQVASTKMN
Sbjct: 233 -------------------EPSSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMN 273

Query: 305 DVSSRSHTIFTLTLYKNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLL 364
           DVSSRSHTIFT+ LYK  NGE+FRVSK+NLVDLAGSENISRSGAQNQRAKEAGSINQSLL
Sbjct: 274 DVSSRSHTIFTIMLYKKCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLL 333

Query: 365 TLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYA 424
           TLGRVINSLADK+ HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYA
Sbjct: 334 TLGRVINSLADKSLHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYA 393

Query: 425 TKAKNIKNKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIE 484
           TKAKNIKNKPQ+GSF+MKD+L+K+++ EL K+KSD LSTKSK+GIYMS  +Y E+ N++E
Sbjct: 394 TKAKNIKNKPQVGSFIMKDVLLKSVTAELVKIKSDLLSTKSKDGIYMSQENYKELTNELE 453

Query: 485 NYKTEIQESRREIEKLSSQNQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHK 544
           NYKTE++E +R +EK+S+QN LL K+K+ S +  ESQ++++R L +++++LY+KID +HK
Sbjct: 454 NYKTEVEECKRAMEKVSAQNSLLIKEKRVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHK 513

Query: 545 NEIELTNMIMKLKDAVRNMQGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLK 604
           NE EL+N++ +L  A+  MQ +L+ +ED  QR  ++++++LYDNI  +++ +  +++ LK
Sbjct: 514 NEQELSNVVQELMRALHTMQQSLRIYEDQGQRFHTEMERVLYDNIGSFKKSLMDEIEKLK 573

Query: 605 QQALEQSFTIDDDINNVKDSLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSELND 664
               E    ++ +++ V   L  + + +    I +  N  +KV    P +F  + S++  
Sbjct: 574 INVDENGDDVEVNVDAVTTELTRIFDFMNSSNIEVFRNYIKKVNDQTPAYFKDIYSQVES 633

Query: 665 MFSKVDEHTDRLKEGLSQITAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKH 724
           + S V  ++  L   LS I+ E NNLK YL+ HFF+NN QE L+VH D+TYHQL +S+  
Sbjct: 634 ITSVVSSYSSNLMIHLSSISEEYNNLKDYLNEHFFKNNFQEALDVHVDRTYHQLKVSANS 693

Query: 725 LMSKITNIISDHVEQNRTLLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLS 784
           +  K+  ++++ ++ N+  +M +L+ A +EV+ +EM   +PV++ WE S  +IN CD L+
Sbjct: 694 IFLKLREMLNEELDTNKEFMMQSLRHAASEVVAKEMCLLDPVKQAWENSLENINECDKLN 753

Query: 785 NKFKDDTTESLNSLKSHMESTVRESSLIADKIKDNLCHFQDRNDIANMTTN--INGTVDD 842
           N F++    ++N +   ++   + S +  +  K  L     R   +++  N  I   VD 
Sbjct: 754 NVFENKIGVTVNEIFKTIDQGQKTSQVTTEDAKSELTRV--RAAFSSLQNNGIILQNVDS 811

Query: 843 IKNKHSVLRDELEKNVSFIHASSEGFKAIDSSLKRIMNFR-MPEGKTETLADDLIKHIDS 901
           IK KH++L+ +++ + +++ A+++ F  ID+S++ ++N + +P+ ++E   D L++ ++ 
Sbjct: 812 IKKKHNLLKSQVQDSANYMQAATQKFGEIDNSIQDLLNAQTIPQPQSENPIDGLLEQLND 871

Query: 902 SSVAPVASSGKTPLRPLLKSETKQRSLSKSVSPAKSSHATIINSPLKRKSSDSRI 956
            S+ P+  SGKTP+R + +S T    L   + P KSS+     SP+K    + R+
Sbjct: 872 KSLKPLGPSGKTPMRTVQRSVTNTDQL---LPPQKSSYTI---SPIKEIDGNRRL 920

>TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {ON}
           Anc_6.16 YEL061C
          Length = 958

 Score =  883 bits (2281), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/963 (50%), Positives = 658/963 (68%), Gaps = 60/963 (6%)

Query: 11  DELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVD 70
           +ELNITVAVRCRGRNE+EIKAKSSVVV+ PDV G+NEVSINT+GD+GITA++NSKTYTVD
Sbjct: 13  EELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTYTVD 72

Query: 71  KVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSEA 130
           +VFGPSA+QSLVF++IA+P+F DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLYDGELSE+
Sbjct: 73  EVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSES 132

Query: 131 AGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKLRIYDSL 190
           AGIIPR+LFKLF+TLE+Q+ DY+VKCSF+ELYNEELKDLL D Q+    +SRKLRI+DS 
Sbjct: 133 AGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIA--SSRKLRIFDS- 189

Query: 191 NSSNNVTNVNSRSSSRSNS-----------PTVNLEAKRRIRAGALYKPKPKLPTQSQSN 239
           N+ +  TN  S  +S  NS           PT     KR       +K  P + TQS  N
Sbjct: 190 NTMSAATNSMSTGNSTKNSRNNSPRSSSELPTATFLRKR-------WKTAPSV-TQSHQN 241

Query: 240 GQQQQQQQQQQQQQQQQQTQGQVNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVA 299
            Q                      +Q++ IYIQ+LQ+FHIT+AKEG++LLQKGL HRQVA
Sbjct: 242 SQ----------------------DQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVA 279

Query: 300 STKMNDVSSRSHTIFTLTLYKNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSI 359
           +TKMND SSRSHTIFT+TLYK +NGE FRVSK+NLVDLAGSENISRSGAQ+QRAKEAGSI
Sbjct: 280 TTKMNDFSSRSHTIFTITLYKEYNGEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSI 339

Query: 360 NQSLLTLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSS 419
           NQSLLTLGRVINSL DK+ H+PFRESKLTRLLQDSLGGNTKTALIATISPAKINSEET S
Sbjct: 340 NQSLLTLGRVINSLTDKSLHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCS 399

Query: 420 TLEYATKAKNIKNKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEV 479
           TL+YA KAKNIKNKPQLGS +MKDILVKNI+ ELAK+K+D LSTKSKEGIYMS  +Y E+
Sbjct: 400 TLQYAAKAKNIKNKPQLGSVIMKDILVKNITGELAKIKADLLSTKSKEGIYMSQDNYKEL 459

Query: 480 MNDIENYKTEIQESRREIEKLSSQNQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKI 539
            ND+E+YKTE++E +R IE L+SQN LL KDKK+S +  + QR++++N++ +M  LY K 
Sbjct: 460 TNDLESYKTEVKECKRAIETLTSQNTLLLKDKKASNEVNDLQRIKLQNMRDAMSDLYSKA 519

Query: 540 DLKHKNEIELTNMIMKLKDAVRNMQGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETK 599
           + ++K E  L      LK  V  MQ  +K HE  E+ ++S +  +  +     ++ I + 
Sbjct: 520 EKQNKREQNLVATASTLKTTVGTMQSIIKEHERRERDIESKMGDLFNNEFARVKQTILSN 579

Query: 600 LDNLKQQALEQSFTIDDDINNVKDSLETLLETVKKDAIIMCENLAQKVVGDQPKFFN--- 656
           + +++QQ   ++  +  +I++++  +  LLE  ++    M ++  +K++ + P  F    
Sbjct: 580 IRDIEQQIDWENIGVQGNIDSIRGEISKLLERAQQQTDDMYKDCVEKILDETPGHFQLAA 639

Query: 657 SMLSELNDMFSKVDEHTDRLKEGLSQITAENNNLKAYLDTHFFRNNHQEILNVHADKTYH 716
             +SE+  + +    H D L E LS ++ E NNL+ YL+ HFF+NNH+EIL  H D+TYH
Sbjct: 640 EKVSEVEKLIATC--HRD-LTENLSDVSEEFNNLRQYLNDHFFKNNHEEILVSHIDRTYH 696

Query: 717 QLNLSSKHLMSKITNIISDHVEQNRTLLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNH 776
            +  S+  L  +   ++ +H+E+N+ L++++LKTAT +VI +EM  FEP +K WE SF +
Sbjct: 697 HIQTSADDLFQQFKEMMDNHLEKNKDLMLESLKTATYDVIRKEMQLFEPQKKKWEDSFKY 756

Query: 777 INVCDSLSNKFKDDTTESLNSLKSHMESTVRESSLIADKIKDNLCHFQDRNDIANMTTNI 836
           IN CDS++  F++     L  +KS + S+    +    K+K+ +   +    + + +   
Sbjct: 757 INKCDSINFAFQNGVKSPLLGIKSTLGSSQEAINKTITKVKEQMDEHESPASMLSNSRVF 816

Query: 837 NGTVDDIKNKHSVLRDELEKNVSFIHASSEGFKAIDSSLKRIMNFRMP--EGKTETLADD 894
           +     I NK S+L + L+K+V      ++    +  ++  +++ R    EG+     D 
Sbjct: 817 SEQFSGILNKQSLLHESLKKSVIITSDHADAVDKLKEAIDHVVSERGSSMEGERVEHVDG 876

Query: 895 LIKHIDSSSVAPVASSGKTPLRPL-LKSETKQRSLSKSVSPAKSSHATIINSPLKRKSSD 953
           +++ +D  ++  +    ++PLRP   K    +R+     SP KS    + +SP K+    
Sbjct: 877 ILRRMDEQNLLYL---DRSPLRPANFKMNKSERNSPNRSSPCKS----VSHSPCKQPVCH 929

Query: 954 SRI 956
            RI
Sbjct: 930 PRI 932

>ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {ON}
           some similarities with uniprot|P27895 Saccharomyces
           cerevisiae YEL061C CIN8 Kinesin motor protein involved
           in mitotic spindle assembly and chromosome segregation
          Length = 974

 Score =  883 bits (2282), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/945 (51%), Positives = 665/945 (70%), Gaps = 54/945 (5%)

Query: 2   SATNGSPEGDELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITAR 61
           S   G  + +ELNITVAVR RGRNE+EI+AKSSVVV+ PDV+G++EV+INT+ D+GITA+
Sbjct: 4   SPAGGGEDAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQ 63

Query: 62  MNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEK 121
           MNSKTY VDKVFGPSA+Q L+FKEIA+P+F DF+KGYNCT+LVYGMTSTGKTYTMTGDEK
Sbjct: 64  MNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEK 123

Query: 122 LYDGELSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNS 181
           LY+ ELS++AGIIPR+LFKLF+TL++++ DY+VKCSF+ELYNEELKDLLDD  ++  ++ 
Sbjct: 124 LYNDELSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVEN--SSM 181

Query: 182 RKLRIYDSLNSSNNVTNVNSRSSSRSNSPTVNLEA---KRRIRAGALYKPKPKLPTQSQS 238
           RKLRIYDS   S + +N  SR +SR+NSP +  +    +RR+R          +P  S  
Sbjct: 182 RKLRIYDS--GSGSNSNSGSRKNSRNNSPKLVTDPMINRRRMRT---------VPLSSSL 230

Query: 239 NGQQQQQQQQQQQQQQQQQTQGQVN----------------EQSSAIYIQHLQEFHITDA 282
             QQ Q QQ+++QQ Q ++ Q +                  +  S +YIQ+LQ+FHIT A
Sbjct: 231 AKQQHQWQQRREQQHQLREQQQREQQAQQQQKEQQQREQQQDSPSGVYIQNLQDFHITSA 290

Query: 283 KEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGETFRVSKINLVDLAGSEN 342
           ++GL+LLQKGL +RQVA+TKMND SSRSHTIFT+TLY+   GE F+VSK+NLVDLAGSEN
Sbjct: 291 RDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMFKVSKMNLVDLAGSEN 350

Query: 343 ISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTA 402
           ISRSGAQ+QRAKEAGSINQSLLTLGRVINSLADK+AH+PFRESKLTRLLQDSLGGNTKTA
Sbjct: 351 ISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFRESKLTRLLQDSLGGNTKTA 410

Query: 403 LIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMKDILVKNISHELAKLKSDFLS 462
           LIATISPAKINSEET STL+YA+KAKNIKN+PQL SF+MKDILVKNI+ ELAK+KSD LS
Sbjct: 411 LIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKDILVKNITAELAKVKSDLLS 470

Query: 463 TKSKEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSSQNQLLHKDKKSSQDTIESQR 522
           TK +EG+YMS  +Y E+ ND+E+YKTEIQES+R IE+LSSQN LL KDKK+S +  E QR
Sbjct: 471 TKLREGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQNSLLLKDKKASNEVNELQR 530

Query: 523 LQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRNMQGALKTHEDHEQRLQSDIQ 582
           ++++N++  M  L EK++ +HK E EL +M   LK  +   Q  +K +   E+++   +Q
Sbjct: 531 IKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSVIKEYGQREKQISERMQ 590

Query: 583 KMLYDNILEYRRKIETKLDNLKQ--------QALEQSFTIDDDINNVKDSLETLLETVKK 634
            +L    L++R+ +   +++++            EQ+  I  ++N ++  +  LL   +K
Sbjct: 591 MILGQEFLQFRQMLVNNIEDIRTNHSGNDILHEGEQN-GIQQNLNVLRQEVVELLGLAQK 649

Query: 635 DAIIMCENLAQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKEGLSQITAENNNLKAYL 694
            A  M ++  +K++ + P  F ++ ++++ +   V+ +  RL E LS I+   NNLK Y 
Sbjct: 650 RAEKMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRLTENLSDISEGYNNLKQYF 709

Query: 695 DTHFFRNNHQEILNVHADKTYHQLNLSSKHLMSKITNIISDHVEQNRTLLMDTLKTATTE 754
           + HFF+NNH+E+LN H DKTY QL  S+  L+ K   ++ DH++ N+TL+M +L++ATTE
Sbjct: 710 NDHFFKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDHLKDNKTLMMKSLQSATTE 769

Query: 755 VITQEMSHFEPVRKTWEQSFNHINVCDSLSNKFKDDTTESLNSLKSHMESTVRESSLIAD 814
            I +EM  FEP RK WE+SF+ IN CDS+SN F  D   +L+ +KS   S+    S    
Sbjct: 770 AIDKEMQLFEPQRKKWEESFDLINNCDSISNGFNGDMRSALSDIKSTFGSSTDVISRSVS 829

Query: 815 KIKDNLCHFQDRNDIANMTTNINGTVDDIKNKHSVLRDELEKNVSFIHASSEG-FKAIDS 873
           K+KD +  ++D + I +    +   + DI NK S LR+ L K++     SS+G   A D 
Sbjct: 830 KVKDEVKGYEDASTILDGNEVVKRQIADIINKDSSLRNGLYKSIK----SSQGHISAFDE 885

Query: 874 SLKRIMNFRMPEGKTETLADDLIKHIDSSSVAPVA-SSGKTPLRP 917
             +RI N    E    TL  + I     ++  P+  +S ++PL+P
Sbjct: 886 LKERIRNTIASE--NSTLHQNKI-----ATTPPLGQNSERSPLKP 923

>Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON}
           YEL061C (REAL)
          Length = 998

 Score =  858 bits (2217), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/934 (50%), Positives = 639/934 (68%), Gaps = 32/934 (3%)

Query: 7   SPEGDELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKT 66
           S   +ELNITVAVRCRGRNE+EI  KSSVVVN PD+ G+ EVSINT+GD GITA+MN+K 
Sbjct: 31  SVPNEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKR 90

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           YTVDKVFGP A Q L+F+E+A P+F DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLY+GE
Sbjct: 91  YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 150

Query: 127 LSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDS------GGNN 180
           L++AAGIIPRVL KLFDTLE+Q+SDY+VKCSFIELYNEELKDLLD+  +        G  
Sbjct: 151 LNDAAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEELKDLLDNNSNGSSNNGFDGQF 210

Query: 181 SRKLRIYDSLNSSNNVTNVNSRSSSRSN----------SPTVNLEAKRRIRAGAL----- 225
            +KLRI+DS  ++N  +N  S S S S           +P   L  ++R+R  +L     
Sbjct: 211 MKKLRIFDSSTANNTTSNSASSSRSNSRNSSPRSLNDLTPKAAL-LRKRLRTKSLPNTIK 269

Query: 226 -YKPKPKLPTQSQSNGQQQQQQQQQQQQQQQQQTQGQVNEQSSAIYIQHLQEFHITDAKE 284
             + +  + +++ S+                Q++    N+QS+ IYIQ+LQEFHIT+A E
Sbjct: 270 QQQQQQAMNSRNNSSSNSGSAANNSSSNTNGQRSPMTQNDQSNGIYIQNLQEFHITNALE 329

Query: 285 GLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGETFRVSKINLVDLAGSENIS 344
           GL LLQ+GL HRQVASTKMND SSRSHTIFT+TLYK    E FR+SK+NLVDLAGSENI+
Sbjct: 330 GLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSENIN 389

Query: 345 RSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALI 404
           RSGA NQRAKEAGSINQSLLTLGRVIN+L D++ HIPFRESKLTRLLQDSLGGNTKTALI
Sbjct: 390 RSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFRESKLTRLLQDSLGGNTKTALI 449

Query: 405 ATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMKDILVKNISHELAKLKSDFLSTK 464
           ATISPAK+ SEET STLEYA+KAKNIKNKPQLG+FMMKDILVKNI+ ELAK+KSD LSTK
Sbjct: 450 ATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDLLSTK 509

Query: 465 SKEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSSQNQLLHKDKKSSQDTIESQRLQ 524
           SKEGIYMS  HY  + +D+E++K E+QE +REIE L+S+N LL KDK  S++TI+SQ  Q
Sbjct: 510 SKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQ 569

Query: 525 IRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRNMQGALKTHEDHEQRLQSDIQKM 584
           + +L++++++L  ++D +HK E+E++    KL+     MQ AL+ ++  E  L    +  
Sbjct: 570 MESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETH 629

Query: 585 LYDNILEYRRKIETKLDNLKQQALEQSFTIDDDINNVKDSLETLLETVKKDAIIMCENLA 644
           +   I   +  +  +LDN++Q+ + Q   I  +++ VK+ + TL+ET+++ A +M ++  
Sbjct: 630 ISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCV 689

Query: 645 QKVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKEGLSQITAENNNLKAYLDTHFFRNNHQ 704
           +K++ + PKFFN ++ +++ +  +       + E LS I+ ENNNLK YL  HFF+NNHQ
Sbjct: 690 KKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQ 749

Query: 705 EILNVHADKTYHQLNLSSKHLMSKITNIISDHVEQNRTLLMDTLKTATTEVITQEMSHFE 764
           E+LN H D TY  +   +   +      ++DH+E+N+ L+M  +  AT+ VI QEM  FE
Sbjct: 750 ELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFE 809

Query: 765 PVRKTWEQSFNHINVCDSLSNKFKDDTTESLNSLKSHMESTVRESSLIADKIKDNLCHFQ 824
           P R  WE SF+ IN CDS++N+F ++   +L+ +K  ++++    +     +K  +   +
Sbjct: 810 PRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNESISVMKGQVEESE 869

Query: 825 DRNDIANMTTNINGTVDDIKNKHSVLRDELEKNVSFIHASSEGFKAIDSSLKRIM-NFRM 883
           +   +    T  N     + +KH +L+D +E +++  H+       I ++++ IM N   
Sbjct: 870 NAISLLKNNTKFNDQFKQLISKHIILKDNIESSITSTHSHITNVDDIYNTIEDIMTNHGN 929

Query: 884 PEGKT-ETLADDLIKHIDSSSVAPVASSGKTPLR 916
            E  T + + D+++K I +        S + PLR
Sbjct: 930 KENATKDEMIDNILKEIPN-------LSKRLPLR 956

>Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON}
           YEL061C (REAL)
          Length = 999

 Score =  849 bits (2193), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/967 (50%), Positives = 649/967 (67%), Gaps = 45/967 (4%)

Query: 3   ATNGSPEGDELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARM 62
             +G P  +ELNITVAVRCRGRNE+EI  KSSVVVN PD+ G+ EVSINT+GD GITA+M
Sbjct: 26  GCHGVP-NEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQM 84

Query: 63  NSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKL 122
           N+K YTVDKVFGP A Q L+F E+A P+F DFIKGYNCT+LVYGMTSTGKTYTMTGDEKL
Sbjct: 85  NAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKL 144

Query: 123 YDGELSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSG----- 177
           Y+GELS+AAGIIPRVL KLFDTLE+Q++DY+VKCSFIELYNEELKDLLD+  ++      
Sbjct: 145 YNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNNSSNNGF 204

Query: 178 -GNNSRKLRIYDSLNSSNNVTNVNSRSSSRSNSPTVNLEAKRRIRAGALYKPKPKLPTQS 236
            G   +KLRI+DS  ++N  +N  S S S S + +         +A  L K   +L T+S
Sbjct: 205 EGPFMKKLRIFDSNTANNTTSNSASSSRSNSRNSSPRSLNDLTPKAALLRK---RLRTKS 261

Query: 237 QSNGQQQQQQQQQQQQQQQ---------------------QQTQGQVNEQSSAIYIQHLQ 275
             N  +QQ QQQ    +                       Q++    N+QS+ IYIQ+LQ
Sbjct: 262 LPNTIKQQHQQQTTNSRNNSSSNPGSTNNNIPGNINTNNSQRSSMAPNDQSNGIYIQNLQ 321

Query: 276 EFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGETFRVSKINLV 335
           EFHIT+A EGL LLQ+GL HRQVASTKMND SSRSHTIFT+TLYK    E FR+SK+NLV
Sbjct: 322 EFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLV 381

Query: 336 DLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESKLTRLLQDSL 395
           DLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+LADK+ HIPFRESKLTRLLQDSL
Sbjct: 382 DLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFRESKLTRLLQDSL 441

Query: 396 GGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMKDILVKNISHELAK 455
           GGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQLG+F+MKDILVKNI+ ELAK
Sbjct: 442 GGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAK 501

Query: 456 LKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSSQNQLLHKDKKSSQ 515
           +KSD LSTKSKEGIYMS  HY  + +D+E+YK E+QE +R+IE LSS+N LL KDK  S+
Sbjct: 502 IKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIESLSSKNSLLLKDKLKSK 561

Query: 516 DTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRNMQGALKTHEDHEQ 575
           DTI+SQ  Q+ +L+ +++ L  ++D +HK E+E++    KL+     MQ AL+ ++  E 
Sbjct: 562 DTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRREL 621

Query: 576 RLQSDIQKMLYDNILEYRRKIETKLDNLKQQALEQSFTIDDDINNVKDSLETLLETVKKD 635
            L    +  +   I   +  + ++L  ++Q  + Q   I  +++ +K+ + TL+ET+++ 
Sbjct: 622 DLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEK 681

Query: 636 AIIMCENLAQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKEGLSQITAENNNLKAYLD 695
           A +M ++  +K++ + PKFFN ++ +++ +        + + E LS I+ ENNNLK YL 
Sbjct: 682 AELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLK 741

Query: 696 THFFRNNHQEILNVHADKTYHQLNLSSKHLMSKITNIISDHVEQNRTLLMDTLKTATTEV 755
            HFF+NNHQE+LN H D TY  +   +   +    N ++DH+E+N+ L+M  L  AT+ V
Sbjct: 742 NHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAV 801

Query: 756 ITQEMSHFEPVRKTWEQSFNHINVCDSLSNKFKDDTTESLNSLKSHMESTVRESSLIADK 815
           I QEM  FEP R  WE SF+ IN CDS++N+F ++   +L+ +K+ ++++    +     
Sbjct: 802 INQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISV 861

Query: 816 IKDNLCHFQDRNDIANMTTNINGTVDDIKNKHSVLRDELEKNVSFIHASSEGFKAIDSSL 875
           +K  +   ++   +       N     + NKH++L+D +E +++  H+       I  ++
Sbjct: 862 MKGQVEESENAVSLLKNNKKFNDQFKQLVNKHTILKDNIENSITSTHSHITNIDDIYDTI 921

Query: 876 KRIM-NFRMPEGKTET-LADDLIKHIDSSSVAPVASSGKTPLRPLLKSETKQRSLSKSVS 933
           + IM N+   E   +  + D+++K I S        S + PLR    S T   S    +S
Sbjct: 922 ENIMKNYGNKENAVKNEMIDNILKEIPS-------LSKRVPLRL---SNTNGNSAQNILS 971

Query: 934 PAKSSHA 940
           P K  HA
Sbjct: 972 PKK--HA 976

>NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {ON}
            Anc_6.16
          Length = 1069

 Score =  821 bits (2120), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/953 (47%), Positives = 637/953 (66%), Gaps = 52/953 (5%)

Query: 13   LNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVDKV 72
            LNITVAVRCRGRNE+EIK KSSV+V  PD+ G+NEVSINT+ D+GITA+MNSKTYTVDKV
Sbjct: 52   LNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYTVDKV 111

Query: 73   FGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSEAAG 132
            FGPSA+Q L+F E+A+P+F DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLY+GELSE+AG
Sbjct: 112  FGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSESAG 171

Query: 133  IIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRK---LRIYDS 189
            IIPR+LFKLFDTLE+ + DY+VKCSFIELYNE+LKDLL+D  +S  N+      LRI+DS
Sbjct: 172  IIPRILFKLFDTLEMNQEDYVVKCSFIELYNEDLKDLLNDNNNSINNSKSNINKLRIFDS 231

Query: 190  LNSSN-NV--TNVNSRSSSRSNSPTVNLEA-----------KRRIRAGALYKPK-PKLPT 234
              +SN NV  +N +SR++SR+NSP +N              +R++++     P+   + T
Sbjct: 232  STASNVNVPGSNASSRANSRNNSPRLNPSTSNVGTTNNNYLRRKLKSSRYSNPENSNIFT 291

Query: 235  QSQSNGQQQQQQQQQQQQQQQQQTQGQVN---------------------EQSSAIYIQH 273
             + S+  +   +       + Q +    N                     + ++ IYIQ+
Sbjct: 292  SNASSSVKNMTKNSFLSNSKNQTSNLNTNSNTRTNPPKLPTSSLETPPQDDNNNGIYIQN 351

Query: 274  LQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGETFRVSKIN 333
            LQEFHI++AKEGL LLQKGL +RQVASTKMND SSRSHTIFT+TLYK   G  FR+SK+N
Sbjct: 352  LQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQGTLFRLSKMN 411

Query: 334  LVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESKLTRLLQD 393
            LVDLAGSENI+RSGA NQRAKE GSINQSLLTLGRVINSLAD+N HIPFRESKLTRLLQD
Sbjct: 412  LVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHIPFRESKLTRLLQD 471

Query: 394  SLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMKDILVKNISHEL 453
            SLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQLGS + KDIL+KNI+ EL
Sbjct: 472  SLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSIISKDILLKNITTEL 531

Query: 454  AKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSSQNQLLHKDKKS 513
            +++KSD LSTKSKEGIYMS  HY ++MN+++N+KTE  ES+R IE+LSSQN LL KDK++
Sbjct: 532  SQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNHKTEADESKRIIERLSSQNALLLKDKRT 591

Query: 514  SQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRNMQGALKTHEDH 573
            S +  E QR+++   Q S++ L EKI++++  E  L + + KL+ +    +  ++ +E  
Sbjct: 592  SNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQMLVSSVSKLQTSCDTFKKMIENYECQ 651

Query: 574  EQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQALEQSFTIDDDINNVKDSLETLLETVK 633
            +  ++S I+++L D++L  R  ++   + +K       F I  +++ +++ +  +L T +
Sbjct: 652  QIDVKSKIEQILEDDLLSLRNLLQDHQNKIKTLNSGTDFDIGSNLDMIQNEVIKMLGTTQ 711

Query: 634  KDAIIMCENLAQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKEGLSQITAENNNLKAY 693
            + A    +   +  +   P+ F  +  ++ND+  K+  H   + + LS I+ E NNLK Y
Sbjct: 712  EKAEKTYKQFIEGFLKQTPENFKKIGEDINDINIKIQNHHAAVAQNLSDISEEYNNLKQY 771

Query: 694  LDTHFFRNNHQEILNVHADKTYHQLNLSSKHLMSKITNIISDHVEQNRTLLMDTLKTATT 753
            L+ + F+NNH++++N H + T   L  S+  L +   ++++ H+E NR L++++ K AT 
Sbjct: 772  LNENLFQNNHEDLINAHINSTSQTLTNSADVLFNTFKDMMNKHLESNRNLMLNSFKAATD 831

Query: 754  EVITQEMSHFEPVRKTWEQSFNHINVCDSLSNKFKDDTTESLNSLKSHMESTVRESSLIA 813
            EVI +EM  F P +K WE+S + IN CDSL+N F+ + T+ L+  +S + +++ +    +
Sbjct: 832  EVINKEMELFIPRKKKWEESIDLINQCDSLNNGFQKEVTDGLSYTRSKITASINQMYDNS 891

Query: 814  DKIKDNLCHFQDRNDIANMTTN--------INGTVDDIKNKHSVLRDELEKNVSFIHASS 865
             ++K  +    D     ++ T         I    +++  K+S+ +D +E ++    AS 
Sbjct: 892  TRLKTEMS--ADNGGYNSINTKNVVEDNQIIRTQFNELARKNSIFQDNVENSLKCAVASV 949

Query: 866  EGFKAIDSSLK-RIMNFRMPEGKTETLADDLIKHIDSSSVAPVASSGKTPLRP 917
                 ++ S+K  + + R+  G TE       K  ++    P    G  PL+P
Sbjct: 950  NNLNHLEDSIKMAVRDTRIKGGPTEGEVGVPFKK-ENGKEGPTK-PGLQPLQP 1000

>KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16
           YEL061C
          Length = 963

 Score =  805 bits (2080), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/988 (46%), Positives = 624/988 (63%), Gaps = 85/988 (8%)

Query: 8   PEGDELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTY 67
           P+ +ELNITVAVRCRGRN++EI AKSSVVV  PD++G+ EV+INTS DIG TA+MNSKTY
Sbjct: 12  PQEEELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTY 71

Query: 68  TVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGEL 127
           TVDKVFGPSA QSL+F EIA+P+F DFIKGYNCTMLVYGMTSTGKTYTMTGDEKLY+ EL
Sbjct: 72  TVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEEL 131

Query: 128 SEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKLRIY 187
           S++AGIIPR+LFKLF+TLE    D++VKCSF+ELYNEELKDLL    ++   N +KLRI+
Sbjct: 132 SDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGNFKKLRIF 191

Query: 188 DSLNSSNNVTNVNSRSSSRSNSPTVN----LEAKRRIRAGALYKPKPKLPTQSQS----- 238
           DSL         +SRS+SR+NSP ++       K+++R  AL + +    ++  S     
Sbjct: 192 DSLGR-------DSRSNSRNNSPKMSNNNTTFLKKKLRNEALLRSRNIASSKRSSMQTIR 244

Query: 239 ------------------NGQQQQQQQQQQQQQQQQQTQGQVNEQSSAIYIQHLQEFHIT 280
                             +G      +       +   Q    +Q++ IYIQ+LQEFHIT
Sbjct: 245 NTTTTKASATTTTTTMFSSGNNDSANKFSPADNDKSTIQS---DQTAGIYIQNLQEFHIT 301

Query: 281 DAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGETFRVSKINLVDLAGS 340
            AKEG++LLQKGL +RQVASTKMND SSRSHTIFT+TL+K   GE FR+SK+NLVDLAGS
Sbjct: 302 TAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAGS 361

Query: 341 ENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTK 400
           ENI+RSGA NQRAKEAGSINQSLLTLGRVINSLADKN H+PFRESKLTRLLQDSLGGNTK
Sbjct: 362 ENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTK 421

Query: 401 TALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMKDILVKNISHELAKLKSDF 460
           TALIATISPAK+  EET STLEYA+KAKNIKNKPQLGSF+MKDIL+KNI+ EL K+KSD 
Sbjct: 422 TALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDL 481

Query: 461 LSTKSKEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSSQNQLLHKDKKSSQDTIES 520
           LSTKSK+GIYM   HY E+  D++NYKTEIQE +R IE L+SQN LL KDK++  +  E 
Sbjct: 482 LSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNEL 541

Query: 521 QRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRNMQGALKTHEDHEQRLQSD 580
           QR++I+ +  SM  LY KI+ +   E EL   I         +   +   ++ E  + S 
Sbjct: 542 QRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSK 601

Query: 581 IQKMLYDNILEY-RRKIETKLDNLKQQALEQSFTIDDDINNVKDSLETLLETVKKDAIIM 639
             K L D+ L Y  +K+  +++N K Q + Q+FT+D+++  +K  +  LL T + +    
Sbjct: 602 F-KTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKF 660

Query: 640 CENLAQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKEGLSQITAENNNLKAYLDTHFF 699
            +    K + D P  F+ +   + ++ +    +  ++ E LS ++ E NN K ++   F+
Sbjct: 661 YQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFY 720

Query: 700 ---RNNHQEILNVHADKTYHQLNLSSKHLMSKITNIISDHVEQNRTLLMDTLKTATTEVI 756
              + +  E+LN + + T   +  SS  +MS I N++++H+  N+ L++++L   TTE++
Sbjct: 721 NQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELM 780

Query: 757 TQEMSHFEPVRKTWEQSFNHINVCDSLSNKFKDDTTESLNSLKSHMESTVRESSLIADKI 816
           + E+   +P    WE+S   IN  D+L+N+F D+   S+ ++   ++ T   +  I + I
Sbjct: 781 SNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQT---NDSINNNI 837

Query: 817 KDNLCHFQDRNDIANMTTNINGTVDD---IKNKHSVLRDELEKNVSFIHASSEGFKAIDS 873
           K    HF+  NDIA+     N  +DD   IKN    +    EKN        EG+   + 
Sbjct: 838 KKINEHFK-TNDIAHSN---NLMIDDNNIIKNNFKSIE---EKNSRLHEFVKEGYLVTNE 890

Query: 874 SLKRIMNFRMPEGKTETLADDLIKHIDSSSVAPVASSGKTPLRPLLKSETKQRSLSKSVS 933
           S+K++                    +D+S            +R +LK    ++ + ++ S
Sbjct: 891 SMKKL------------------NELDTS------------IRTVLKDIDYEKDIKETNS 920

Query: 934 PAKSSHATIINSPLKRKSSDSRIFPGNS 961
           P K SH    N  +   +   R F  N+
Sbjct: 921 PLKPSHKHDYNHTIPLDNDKKRSFLNNA 948

>NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {ON}
           Anc_6.16
          Length = 1004

 Score =  806 bits (2081), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/830 (51%), Positives = 583/830 (70%), Gaps = 35/830 (4%)

Query: 1   MSATNGSPEGD-ELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGIT 59
           ++ T   PE D ELNITVAVRCRGRNE+EI +KS VVV  PD+ GA E+SINT+G+ GIT
Sbjct: 16  LTTTREPPEEDTELNITVAVRCRGRNEREINSKSPVVVTVPDITGAQEISINTTGETGIT 75

Query: 60  ARMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGD 119
           A+MNSKTYTVDKVFGP+ADQ L+F+E+A+P+F DF+KGYNCT+LVYGMTSTGKTYTMTGD
Sbjct: 76  AQMNSKTYTVDKVFGPAADQDLIFQEVAEPLFRDFVKGYNCTVLVYGMTSTGKTYTMTGD 135

Query: 120 EKLYDGE--LSEAAGIIPRVLFKLFDTLEVQE--------SDYMVKCSFIELYNEELKDL 169
           EKLY     LS+AAGIIPR+LFKLFDTL+           +D++VKCSF+ELYNE+LKDL
Sbjct: 136 EKLYQNGTMLSDAAGIIPRILFKLFDTLDNHRHSDVTGSTTDFVVKCSFVELYNEDLKDL 195

Query: 170 LD-DGQDSGGN----NSRKLRIYDSLNSSNNVTNVNSRSSS-------RSNS--PTVNLE 215
           L+ D  D         SRKLRI+DS N++NN +N N+ S +       R++S  P  N  
Sbjct: 196 LNYDSNDEQQQQQQLGSRKLRIFDSTNNNNNNSNSNASSRASSRNNSPRTSSILPNAN-- 253

Query: 216 AKRRIRAGALYKPKPKLPTQSQSNGQQQQQQQQQQQQQQQQQTQGQVNEQSSAIYIQHLQ 275
                 A  L   K  +     SN + +     +     +  +    +E ++ IYIQ+LQ
Sbjct: 254 ------ATNLAMRKKSIRYNYNSNNKAKSSNNTRPNTNDEPSSIAGPDENTNGIYIQNLQ 307

Query: 276 EFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGETFRVSKINLV 335
           EFHIT+AKEGL LLQKGL HRQVASTKMND SSRSHTIFT+TLYK      FR+SK+NLV
Sbjct: 308 EFHITNAKEGLSLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKEHKDNLFRLSKMNLV 367

Query: 336 DLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESKLTRLLQDSL 395
           DLAGSENI+RSGA NQRAKE GSINQSLLTLGRVINSLADK+ H+PFRESKLTRLLQDSL
Sbjct: 368 DLAGSENINRSGAMNQRAKETGSINQSLLTLGRVINSLADKSPHVPFRESKLTRLLQDSL 427

Query: 396 GGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMKDILVKNISHELAK 455
           GGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQLGS ++KDIL+KNI+ ELAK
Sbjct: 428 GGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSVILKDILLKNITSELAK 487

Query: 456 LKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSSQNQLLHKDKKSSQ 515
           +KSD +STKSK+GIYMSH HY E++ ++E+ KTE+QES+R IEKLSSQN +L KDK+S+ 
Sbjct: 488 VKSDLMSTKSKDGIYMSHEHYQELIMELESSKTEVQESKRMIEKLSSQNSMLLKDKRSAN 547

Query: 516 DTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRNMQGALKTHEDHEQ 575
           +  E QR+++ NL+ SM  L EK+++++  E +L   I +L+ +   +   +K ++  + 
Sbjct: 548 EVNELQRIKLNNLKDSMSNLNEKLEIQNGKETKLMEQIGQLEKSREKLNSLVKNYQTKQS 607

Query: 576 RLQSDIQKMLYDNILEYRRKIETKLDNLKQQALEQSFTIDDDINNVKDSLETLLETVKKD 635
           +L++ I  +L +N+ E ++ + +  D ++Q   E +F ++ ++  +KD + ++LE  +  
Sbjct: 608 QLKTQISNILNENLFELKKILNSHKDAIRQS--EGNFDVEMNLKVIKDEITSMLEKTQHK 665

Query: 636 AIIMCENLAQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKEGLSQITAENNNLKAYLD 695
             +M +   ++ +   P     +   +  +   V  + + + E LS I+ E NNLK YLD
Sbjct: 666 TEMMYKEFIEEFLEQTPINLQKIFEHVTQVEFMVTGYYNEITENLSDISEEYNNLKQYLD 725

Query: 696 THFFRNNHQEILNVHADKTYHQLNLSSKHLMSKITNIISDHVEQNRTLLMDTLKTATTEV 755
             FF+NNH+++LN+H + T   L  SS  L +K   ++  H+ +N+ L++D  +TAT +V
Sbjct: 726 NDFFQNNHEDLLNIHINATSDILAQSSAELFNKFKIMMDAHLMENKKLMIDNFRTATNDV 785

Query: 756 ITQEMSHFEPVRKTWEQSFNHINVCDSLSNKFKDDTTESLNSLKSHMEST 805
           IT+EM  F+P R  WE+S   IN CDS++N F  + T  ++ +K+++ S+
Sbjct: 786 ITKEMELFKPKRNKWEESIELINRCDSINNGFHHNMTGQVSKIKTNLASS 835

>CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} similar
           to uniprot|P27895 Saccharomyces cerevisiae YEL061c CIN8
           Kinesin-like protein
          Length = 988

 Score =  770 bits (1989), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/801 (51%), Positives = 548/801 (68%), Gaps = 27/801 (3%)

Query: 11  DELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVD 70
           +ELNI VAVRCRGRNE+EIKAKSSVVV+ PD    NEVSINT+ D+GI A+MNSKTYTVD
Sbjct: 30  EELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVD 89

Query: 71  KVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSEA 130
           KVFGPSA Q LV++EIA+P+F DFIKGYNCT+LVYGMTSTGKTYTMTGDEKL++GEL +A
Sbjct: 90  KVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGDA 149

Query: 131 AGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKLRIYDSL 190
           AGIIPRVLF+LFDTLE  + DY+VKCSF+ELYNEELKDLLD    +  ++++KLRI+DS 
Sbjct: 150 AGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTNTATNSDNKKLRIFDS- 208

Query: 191 NSSNNVTNVNSRSSSRSNSPTVNLEAKRRIRAGALYKPKPKLPTQSQS---NGQQQQQQQ 247
             + N T+ +  SS  S+       A    RA  L +   +  T   S   N    +  +
Sbjct: 209 --NVNGTSASGSSSRSSSRNNSPRSAPDNSRAQMLRRKLGRHNTTGNSKISNNNHNKFSR 266

Query: 248 QQQQQQQQQQTQGQVN---------------------EQSSAIYIQHLQEFHITDAKEGL 286
            +Q  Q+  +     N                     +QS++IYIQ+L+EFHIT A EGL
Sbjct: 267 FKQTSQESTRAHASNNHQNVHIPNNNSNNTNQQQSPIDQSASIYIQNLEEFHITSAMEGL 326

Query: 287 RLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGETFRVSKINLVDLAGSENISRS 346
           +LLQKGL  RQVASTKMND SSRSH+IFT+TLYK  NGE FRVSK+NLVDLAGSENISRS
Sbjct: 327 QLLQKGLKQRQVASTKMNDFSSRSHSIFTITLYKEQNGELFRVSKMNLVDLAGSENISRS 386

Query: 347 GAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIAT 406
           GA NQRAKEAGSINQSLLTLGRVINSLADK+ HIPFRESKLTRLLQDSLGGNTKTALIAT
Sbjct: 387 GAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIPFRESKLTRLLQDSLGGNTKTALIAT 446

Query: 407 ISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSK 466
           ISPAK+ SEET STLEYA+KAKNIKNKPQLG+F+MKDILV++I+ ELAK+KSD LSTKSK
Sbjct: 447 ISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVRSITSELAKIKSDLLSTKSK 506

Query: 467 EGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSSQNQLLHKDKKSSQDTIESQRLQIR 526
           EG+YMSH HY ++  DIE YKTE++ES+R IE L++QN +L +++ S +D     +  I 
Sbjct: 507 EGVYMSHEHYKDLHYDIECYKTELEESKRAIESLTAQNAMLQQERLSLKDDNACYKANIA 566

Query: 527 NLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRNMQGALKTHEDHEQRLQSDIQKMLY 586
           +L+ ++  L   +  +   E  + +++  ++ A   M+  +   E  +Q LQ  I   + 
Sbjct: 567 SLKDNVVTLQSSLKEQITKETNIRSLLKDVQGANEEMKKTIHLFEFKQQELQQSISTFIS 626

Query: 587 DNILEYRRKIETKLDNLKQQALEQSFTIDDDINNVKDSLETLLETVKKDAIIMCENLAQK 646
           D I   R  ++  ++ L+     +   I  ++  ++  +  +++  +++A        + 
Sbjct: 627 DEISNIRDTLKKHIEYLQNNGDLKDTEISGNLMRLEKEVVKVIKAAEEEASKSYGECVKM 686

Query: 647 VVGDQPKFFNSMLSELNDMFSKVDEHTDRLKEGLSQITAENNNLKAYLDTHFFRNNHQEI 706
           ++ + P+ F S+   L+++    +E+  ++ E LS ++ E NNLK YL  +FF+NNH+E+
Sbjct: 687 MLKETPRLFESVSGRLDNISKLAEENHSKIAETLSDVSEEYNNLKQYLTNNFFKNNHEEL 746

Query: 707 LNVHADKTYHQLNLSSKHLMSKITNIISDHVEQNRTLLMDTLKTATTEVITQEMSHFEPV 766
           L+ H   TY QL  +S  LM   T ++  H+++N+  +++ +   T EVI  E+  F   
Sbjct: 747 LSHHVQNTYAQLEENSAQLMQNFTMMLDKHIQENKRHMLENILGVTDEVINNELQMFGEQ 806

Query: 767 RKTWEQSFNHINVCDSLSNKF 787
           R  WE+S   IN CDS+++ F
Sbjct: 807 RAKWEKSSALINQCDSVNHSF 827

>TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON}
           Anc_6.16 YEL061C
          Length = 1097

 Score =  749 bits (1935), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/868 (47%), Positives = 564/868 (64%), Gaps = 91/868 (10%)

Query: 10  GDELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTV 69
           G+ELNITVAVRCRGRNE+E++AKSSVVV+ PD++G+NEVSINTS ++GI A MNSKTYTV
Sbjct: 8   GEELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTV 67

Query: 70  DKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSE 129
           DKVFGPSA Q L+FKEIA+P+F DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLYDGELS+
Sbjct: 68  DKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSD 127

Query: 130 AAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKLRIYDS 189
           +AGIIPRVLFKLF++ E+   DY++KCSF+ELYNE+LKDLLDD  D   N  +KLRI+DS
Sbjct: 128 SAGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDSVD---NTYKKLRIFDS 184

Query: 190 LNS----------------------------SNNVTNVNSRSSSRSNSPTVNLEAKRRIR 221
           ++S                             N   N + R SS +N  T+ L+ +   R
Sbjct: 185 MSSYSNSTATSNNNTSNNTRNNSRNNSRSNSRNTSRNNSPRPSSSTNLSTIALKRRTATR 244

Query: 222 AGAL---------------------YKPKPKLPTQSQSNGQQQQQQQ------------- 247
             +L                     +K +P    + QS  Q QQ  +             
Sbjct: 245 PSSLSSLNPTANSSIYSNNTNNKIRFKDQPANQLRLQSKLQAQQNIELQQIHSQNIQQQQ 304

Query: 248 --------QQQQQQQQQQTQGQVNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVA 299
                   Q Q+ ++Q     +  + ++ IYIQ+LQEF+I +A +G++LLQKGL HR+VA
Sbjct: 305 SQSITSNLQSQENKEQLTNSEKAPDNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVA 364

Query: 300 STKMNDVSSRSHTIFTLTLYKNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSI 359
           STKMNDVSSRSHTIFT+TLYK  NG  +RVSK+NLVDLAGSENI++SGAQ+QRAKEAGSI
Sbjct: 365 STKMNDVSSRSHTIFTITLYKEHNGGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSI 424

Query: 360 NQSLLTLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSS 419
           NQSLLTLGRVINSLADK+ HIPFRESKLTRLLQDSLGGNTKT LI+TISPAKIN +ETSS
Sbjct: 425 NQSLLTLGRVINSLADKSIHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSS 484

Query: 420 TLEYATKAKNIKNKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEV 479
           TLEYA+KAKNIKNKP LGSF+MKD+L+KNI+ EL K+KSD +ST+ K+G+YMS  HY E+
Sbjct: 485 TLEYASKAKNIKNKPHLGSFIMKDVLLKNITTELNKIKSDLMSTRLKDGVYMSQQHYKEL 544

Query: 480 MNDIENYKTEIQESRREIEKLSSQNQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKI 539
            ND+E+YKTE+QES+R  E+L SQN  L KDKK+S +  E QR+QI      +  LYE +
Sbjct: 545 NNDLESYKTEVQESKRANERLISQNGSLLKDKKASNELNELQRIQIEKKNEKIKELYEIL 604

Query: 540 DLKHKNEIELTNMIMKLKDAVRNMQGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETK 599
           D  +K E  L  +I +LK+   +MQ  ++ + + +  ++   +K+L +     + ++   
Sbjct: 605 DEHYKREDILVELIRQLKNVGTSMQSTIENYRERDLEIEESTKKILENEFKFLKNELSQI 664

Query: 600 L--------DNLK---------QQALEQSFTIDDDINNVKDSLETLLETVKKDAIIMCEN 642
           L        DNLK          +A++ S     +I+ ++++   +L+ V++ +  +  +
Sbjct: 665 LSNINGNIIDNLKSSIISNNSSIEAIDSS-NFQKNIDIIENTTLKILKQVQEKSQHIYSS 723

Query: 643 LAQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKEGLSQITAENNNLKAYLDTHFFRNN 702
             ++++ D P   N    E+N +  + ++  +++ E LS ++ E NN K YL+  F +NN
Sbjct: 724 CIERILSDIPNILNKFKIEINSIDFQYNDQFNKITENLSDLSEEYNNFKEYLNNSFLQNN 783

Query: 703 HQEILNVHADKTYHQLNLSSKHLMSKITNIISDHVEQNRTLLMDTLKTATTEVITQEMSH 762
           ++ IL  H +    Q+   S +L+  I   I++    N  L  + L     +++ +E   
Sbjct: 784 YELILKNHLESGQSQIESFSNNLLLNINKQINEFKLHNSKLYEEKLNNIKNDIVKKETES 843

Query: 763 FEPVRKTWEQSFNHINVCDSLSNKFKDD 790
            +P ++ W +S   IN  D ++N F +D
Sbjct: 844 IKPYKEKWVKSIEIINSTDKINNTFHND 871

>KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6.16
           YEL061C
          Length = 950

 Score =  690 bits (1780), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/955 (42%), Positives = 587/955 (61%), Gaps = 61/955 (6%)

Query: 9   EGDELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYT 68
           E D++NITVAVRCRGRN++EI+AKS +VV  PDV    EVSINTSG  GI A++ +KTYT
Sbjct: 21  EKDDINITVAVRCRGRNKREIEAKSPIVVTVPDVTTTPEVSINTSGGSGIEAQLQAKTYT 80

Query: 69  VDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKL-YDGEL 127
           VDKV+GP + Q LVF++ A+P+FHDF++GYNCTMLVYGMTSTGKTYTMTGD ++  +G++
Sbjct: 81  VDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEGDV 140

Query: 128 SEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQD--SGG------- 178
           +  AGI PR+L KLF+ L+    DY+VKCSF+ELYNE+L+DLL +GQD  S G       
Sbjct: 141 NGQAGIAPRILVKLFECLQ---DDYVVKCSFVELYNEDLRDLLSEGQDDFSNGTENSSKQ 197

Query: 179 ----NNSRKLRIYDSLNSSNNVTNVNSRSSSRSNSPTVNLEAKRRIRAGALYKPKPKLPT 234
               N S+KLRI+DS NS             RSNSP  N              P  K  +
Sbjct: 198 PESLNASKKLRIFDSNNS-------------RSNSPVTNTN-----------NPTHKARS 233

Query: 235 QSQSNGQQQQQQQQQQQQQQQQQTQGQ--VNEQSSAIYIQHLQEFHITDAKEGLRLLQKG 292
                  +  +++            G+  V    + IYIQ+L++FHI+ AKEGL+LLQ+G
Sbjct: 234 DYLKKKLKSNRKKSLDDMSLNANAGGKTHVPPTQTGIYIQNLKDFHISTAKEGLQLLQRG 293

Query: 293 LSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGETFRVSKINLVDLAGSENISRSGAQNQR 352
           L  RQVA+TK+NDVSSRSHTIFT+TLYK F  + +R+SKINLVDLAGSEN++++GA N R
Sbjct: 294 LQRRQVATTKLNDVSSRSHTIFTITLYKKFKDDLYRLSKINLVDLAGSENVNKAGALNLR 353

Query: 353 AKEAGSINQSLLTLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKI 412
           AKE+GSINQSLLTLGRVINSLADK+AHIPFRESKLTRLLQDSLGGNTKT LIATISPAKI
Sbjct: 354 AKESGSINQSLLTLGRVINSLADKSAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKI 413

Query: 413 NSEETSSTLEYATKAKNIKNKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMS 472
            +EET STLEYA+KAKNIKNKPQLGSF++KDIL+K++S EL K+++D   TKSKEGIY+S
Sbjct: 414 AAEETCSTLEYASKAKNIKNKPQLGSFIIKDILLKDVSQELIKMRADLWCTKSKEGIYVS 473

Query: 473 HLHYNEVMNDIENYKTEIQESRREIEKLSSQNQLLHKDKKSSQDTIESQRLQIRNLQSSM 532
             +Y E+++D++N+KTE+ E +R  + L  +N+LL K+KKS  +  +S + ++ NL+S +
Sbjct: 474 QKNYKEMVDDLDNFKTELTELKRTNDSLVQENELLGKEKKSGAERADSLKSELDNLRSQL 533

Query: 533 DYLYEKIDLKHKNEIELTNMIMKLKDAVRNMQGALKTHEDHEQRLQSDIQKMLYDNILEY 592
             +  K+   +    +L+  +  +      ++  ++ ++   +  +   Q++L D +   
Sbjct: 534 KSVTNKLAQTNTQNTKLSEQVTDMNRIQTELKSLIEVYQQKHETSKHKFQRLLKDELATL 593

Query: 593 RRKIETKLDNLKQQALEQSFTIDDDINNVKDSLETLLETVKKDAIIMCENLAQKVVGDQP 652
             KI ++ D LK      ++ I   I++++  +  LLET K++A  + ++    ++ + P
Sbjct: 594 TAKILSQWDTLK-NVNSGNYQIHTHIDSIRGEVMNLLETTKENAETLYKSCIDDLLKETP 652

Query: 653 KFFNSMLSELNDMFSKVDEHTDRLKEGLSQITAENNNLKAYLDTHFFRNNHQEILNVHAD 712
           K F  +   + D+    +EH   +    S ++ E N  K YLD  FF+NNH E++  H D
Sbjct: 653 KIFQLISDNVGDIRGMTEEHYTEMARNFSDLSEEFNTFKQYLDGQFFQNNHIEMIQTHQD 712

Query: 713 KTYHQLNLSSKHLMSKITNIISDHVEQNRTLLMDTLKTATTEVITQEMSHFEPVRKTWEQ 772
                +   S  L+  + N I +++  N  ++ +++     +VI +EM  F P +  WE+
Sbjct: 713 IVASNMQKMSDDLLQSVQNSIQNYLSTNAQMVTNSINDVAMDVINKEMDLFAPKKSKWEE 772

Query: 773 SFNHINVCDSLSNKFKDDTTESLNSLKSHM----ESTVRESSLIADKIKDNLCHFQDRND 828
           S + IN  DSLSNKF+++ T+S++ + S +    ES  R  S I   I +N  + Q++ +
Sbjct: 773 SIDLINQSDSLSNKFRNNMTKSVDDIASVIRNSNESMDRSISTIKKHIIENDINSQEQIN 832

Query: 829 IANMTTNINGTVDDIKNK--HSVLRDELEKNVSFIHASSEGFKAIDSSLKRIMNFRMPEG 886
              + TN    + +  N   H V  D           S +G + +D S++ +++      
Sbjct: 833 SNELLTNSFKAIQEKSNNILHLVTGDL----TVTAQESMDGIQNLDRSIRTLIHGDQYIH 888

Query: 887 KTETLADDLIKHIDSSSVAPVASSGKTPLRPLLKSETKQRSLSKSVSPAKSSHAT 941
            T+ +      HI   +  P   S   PL+P   S   + S S   SP K S  +
Sbjct: 889 STKGV------HIPPQNRGPELHSTLIPLKP-SSSNLNRLSDSTKSSPRKRSQGS 936

>YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}
           CIN8Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 1000

 Score =  600 bits (1548), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/687 (47%), Positives = 466/687 (67%), Gaps = 14/687 (2%)

Query: 256 QQTQGQVNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFT 315
           Q++    N+Q++ IYIQ+LQEFHIT+A EGL LLQKGL HRQVASTKMND SSRSHTIFT
Sbjct: 303 QRSSMAPNDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFT 362

Query: 316 LTLYKNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD 375
           +TLYK    E FR+SK+NLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L D
Sbjct: 363 ITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVD 422

Query: 376 KNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQ 435
           K+ HIPFRESKLTRLLQDSLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQ
Sbjct: 423 KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQ 482

Query: 436 LGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEIQESRR 495
           LGSF+MKDILVKNI+ ELAK+KSD LSTKSKEGIYMS  HY  + +D+E+YK E+QE +R
Sbjct: 483 LGSFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKR 542

Query: 496 EIEKLSSQNQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMK 555
           EIE L+S+N LL KDK  S++TI+SQ  QI +L++++D+L  ++D +HK EIE+++   K
Sbjct: 543 EIESLTSKNALLVKDKLKSKETIQSQNCQIESLKTTIDHLRAQLDKQHKTEIEISDFNNK 602

Query: 556 LKDAVRNMQGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQALEQSFTID 615
           L+     MQ AL  ++  E  L    +  +   I + +  +  +L+ ++Q+++ Q   I 
Sbjct: 603 LQKLTEVMQMALHDYKKRELDLNQKFEMHITKEIKKLKSTLFLQLNTMQQESILQETNIQ 662

Query: 616 DDINNVKDSLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSELNDMFSKVDEHTDR 675
            +++ +K+ + TL+ T+++ A +M ++  +K++ + PKFFN ++ +++ +     +    
Sbjct: 663 PNLDMIKNEVLTLMRTMQEKAELMYKDCVKKILNESPKFFNVVIEKIDIIRVDFQKFYKN 722

Query: 676 LKEGLSQITAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKHLMSKITNIISD 735
           + E LS I+ ENNN+K YL  HFF+NNHQE+LN H D TY  +   +   +     +++D
Sbjct: 723 IAENLSDISEENNNMKQYLKNHFFKNNHQELLNRHVDSTYENIEKRTNEFVENFKKVLND 782

Query: 736 HVEQNRTLLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLSNKFKDDTTESL 795
           H+++N+ L+M  L TAT+ VI QEM  FEP R  WE SF+ IN CDS++N+F +    +L
Sbjct: 783 HLDENKKLIMQNLTTATSAVIDQEMDLFEPKRVKWENSFDLINDCDSMNNEFYNSMAATL 842

Query: 796 NSLKSHMESTVRESSLIADKIKDNLCHFQDRNDIANMTTNINGTVDDIKNKHSVLRDELE 855
           + +KS ++++    +     +K  +   ++   +    T  N   + + NKH++L+D ++
Sbjct: 843 SQIKSTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFEQLINKHNMLKDNIK 902

Query: 856 KNVSFIHASSEGFKAIDSSLKRIM-NFRMPEGKT-ETLADDLIKHIDSSSVAPVASSGKT 913
            +++  H+       I ++++ IM N+   E  T + + ++++K I +        S K 
Sbjct: 903 NSITSTHSHITNVDDIYNTIENIMKNYGNKENATKDEMIENILKEIPN-------LSKKM 955

Query: 914 PLRPLLKSETKQRSLSKSVSPAKSSHA 940
           PLR    S     S+   +SP K  HA
Sbjct: 956 PLRL---SNINSNSVQSVISPKK--HA 977

>Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON}
           YEL061C (REAL)
          Length = 1002

 Score =  598 bits (1541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/686 (47%), Positives = 469/686 (68%), Gaps = 26/686 (3%)

Query: 263 NEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNF 322
           N+QS+ IYIQ+LQEFHIT+A EGL+LLQKGL HRQVASTKMND SSRSHTIFT+TLYK  
Sbjct: 312 NDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 371

Query: 323 NGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPF 382
             E FR+SK+NLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L DK+ HIPF
Sbjct: 372 QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPF 431

Query: 383 RESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMK 442
           RESKLTRLLQDSLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQLG+F+MK
Sbjct: 432 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMK 491

Query: 443 DILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSS 502
           DILVKNI+ ELAK+KSD LSTKSKEGIYM+  HY  + +D+E+YK E+QE +REIE L+S
Sbjct: 492 DILVKNITMELAKIKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNEVQECKREIESLTS 551

Query: 503 QNQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRN 562
           +N LL K+K  S++TI+SQ  QI +L++++D+L  ++D +HK E+E++    KL+     
Sbjct: 552 KNSLLVKEKLKSKETIQSQNSQIESLKATIDHLRTQLDKQHKTELEISGFNSKLQKLTEV 611

Query: 563 MQGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQALEQSFTIDDDINNVK 622
           MQ AL+ ++  E  L    +  +   I   +  + ++L  L+Q+ + Q   I  +++ +K
Sbjct: 612 MQMALQDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTLQQRNILQETDIQPNLDIIK 671

Query: 623 DSLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKEGLSQ 682
           + + TL+ET+++ A +M ++  +K++ + PKFFN+++ +++ +    +     + E LS 
Sbjct: 672 NEVLTLMETMQEKAELMYKDCVKKILNESPKFFNAIVEKIDIIGVDFERFYKNIAENLSD 731

Query: 683 ITAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKHLMSKITNIISDHVEQNRT 742
           I+ ENNNLK Y   HFFRNNHQE+L+ H D TY ++   +   +      ++DH+E+N+ 
Sbjct: 732 ISEENNNLKQYFTNHFFRNNHQELLSHHVDSTYEKIEKKTNQFVENFKKALNDHLEENKK 791

Query: 743 LLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLSNKFKDDTTESLNSLKSHM 802
           L+M  L T T+ VI QEMS FEP R  WE SF+ IN CDS++N+F +    +L+ +KS +
Sbjct: 792 LIMKNLTTTTSAVIDQEMSLFEPKRVKWEHSFDLINECDSMNNEFYNSMATTLSQIKSTV 851

Query: 803 ESTV----RESSLIADKIKDNLCHFQDRNDIANMTTNI--NGTVDDIKNKHSVLRDELEK 856
           +++     +  S++  +++      +  N I+ +  NI  N     + NKH++L+D +E 
Sbjct: 852 DTSSNSMNKSISVMKGQVE------ESENAISLLKNNIKFNDQFKQLINKHTILKDNIES 905

Query: 857 NVSFIHASSEGFKAIDSSLKRIM-NFRMPEGKT-ETLADDLIKHIDSSSVAPVASSGKTP 914
           +++  ++       I +++++IM N+   E  T + + ++L+  I +        S + P
Sbjct: 906 SITSTNSHITNIDDIYNTIEKIMNNYGNKENATKDEMIENLLNEIPN-------LSKRMP 958

Query: 915 LRPLLKSETKQRSLSKSVSPAKSSHA 940
           LR    S T   S+   +SP K  HA
Sbjct: 959 LRI---SNTNSNSMQNIISPKK--HA 979

>Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON}
           (9109..12123) [3015 nt, 1005 aa]
          Length = 1004

 Score =  548 bits (1412), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 274/553 (49%), Positives = 408/553 (73%), Gaps = 3/553 (0%)

Query: 264 EQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFN 323
           ++ + IYIQ+L+EFHIT AKEG+ LLQ+GL +RQVASTKMND SSRSHTIFT+ LYK  +
Sbjct: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHD 357

Query: 324 GETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFR 383
           G+ FR+SK+NLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKN HIPFR
Sbjct: 358 GKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFR 417

Query: 384 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMKD 443
           ESKLTRLLQDSLGGNTKTALIATISPAK+NSEET STLEYA KAK+IKNKPQLGS + KD
Sbjct: 418 ESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITKD 477

Query: 444 ILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSSQ 503
           ILVKNI+ ELAK+K+D LSTKS++G+YMS +HY E+ ND+E+YKTE+QE +R I+ L++Q
Sbjct: 478 ILVKNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLTTQ 537

Query: 504 NQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRNM 563
           N LL KDKK+S +    Q++++++++ S+ +L++ I+ +H+ E  L ++I+KLK     M
Sbjct: 538 NGLLLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSIEM 597

Query: 564 QGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQALEQSFTIDDDINNVKD 623
           Q  +K H + EQ  Q+ ++++  + +L  +  +   L+ + ++ +  +  +  +I  +KD
Sbjct: 598 QATIKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVINNTDLGMNIEKIKD 657

Query: 624 SLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKEGLSQI 683
            ++++++T + +A  + ++  ++++ + P    S+  ++  M    D + ++L   +S++
Sbjct: 658 EVKSIIDTTQAEANHVYKDCMEQLMKESPILLGSLNDDIIKMQKISDLYNEQLSISISEL 717

Query: 684 TAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKHLMSKITNIISDHVEQNRTL 743
             E+N+LK YL+  FF+++H+EILN H +KTY  +  +S  ++ ++   +  ++E++R +
Sbjct: 718 NIEHNDLKQYLNGSFFKSDHEEILNEHIEKTYDNIRRASTGIVEQLKTGLELYLEESRNI 777

Query: 744 LMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLSNKFKDDTTESLNSLKSHME 803
           ++D+LK  T++++  EM  F P +K WE SF  IN CDSL+NK+  D +  L+++K+ + 
Sbjct: 778 IIDSLKNTTSDIVKSEMELFAPKKKKWEDSFEMINKCDSLNNKYFGDISALLSNMKTSVT 837

Query: 804 STVRESSLIADKI 816
           ST   S L+ D +
Sbjct: 838 ST---SDLVDDHV 847

>Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa]
           {ON} complement(169349..172237) [2889 nt, 963 aa]
          Length = 962

 Score =  517 bits (1331), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 322/959 (33%), Positives = 544/959 (56%), Gaps = 45/959 (4%)

Query: 1   MSATNGSPEGDELNITVAVRCRGR--NEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGI 58
           MS ++G  +  E NI V  R +G+  NEK    +  +++  P +I           D  +
Sbjct: 1   MSLSDGVKDKVECNIKVVARFKGQIDNEKGDDVRDQIIIEEPGLIKF------KGKDDAV 54

Query: 59  TARMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTG 118
                 + + +D +F     Q  ++ +   PMF DFI GYNC+ LVYG T +GKTYT++G
Sbjct: 55  -----KREFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSG 109

Query: 119 DE-KLYDGELSE-AAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDS 176
           +E  L   E S  + G+IPRVL +LFD L     D++VKCS++E+YNEELKDLL D  +S
Sbjct: 110 EEDSLLHSEASRLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVDQHNS 169

Query: 177 GGNNS-RKLRIYDSLNSSNNVTN-VNSRSSSRSNSPTVNLEAKRRIRAGALYKP--KPKL 232
             + S +KLRI DS   S NV N  NS  ++R NSP   L + + I    + K   +  L
Sbjct: 170 LLSASIKKLRIVDS--GSPNVKNGANSNCNTRDNSP---LTSSKSIPTAIIRKKMGRQSL 224

Query: 233 PTQSQSNGQQQQQQQQQQQQQQQQQTQGQVNEQSSAIYIQHLQEFHITDAKEGLRLLQKG 292
               Q+N     +     +   Q+  Q    E++ A YIQ+L+EFHIT+AKEG++LL +G
Sbjct: 225 TALKQANTLSISRSNSFNEYSPQRHIQ----EKTGAPYIQNLEEFHITNAKEGIQLLHRG 280

Query: 293 LSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGETFRVSKINLVDLAGSENISRSGAQNQR 352
           L +RQ+AS+K    SSR+ TIFT+ LYK   GE FRVSK N VDLAG+E+  +    NQR
Sbjct: 281 LKNRQIASSKNQKYSSRASTIFTIVLYKEEEGEIFRVSKWNFVDLAGAEHSHKIEGTNQR 340

Query: 353 AKEAGSINQSLLTLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKI 412
            K+   INQ +  L +++NSL +K + IPF++SKLT L++D+L GN+K+  I T+   K 
Sbjct: 341 FKDINIINQGIQNLNKIVNSLHEKESVIPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKD 400

Query: 413 NSEETSSTLEYATKAKNIKNKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMS 472
           + +E   TLE+  K +++K  P LG  + K+ L+K+IS+ELAK+KSD LSTKSKEG+YMS
Sbjct: 401 SLDEMIETLEFGNKVRSLKCYPLLGPSINKETLIKSISNELAKVKSDLLSTKSKEGVYMS 460

Query: 473 HLHYNEVMNDIENYKTEIQESRREIEKLSSQNQLLHKDKKSSQDTIESQRLQIRNLQSSM 532
           H HY+ +  D++ +K EI + ++ I++L+ Q+  L KDK++ ++  E QR+++++++ S+
Sbjct: 461 HEHYDVLTKDLDKHKVEIMDLKKVIDELNEQSTTLRKDKRAFEEVNEVQRIKLQSMRDSV 520

Query: 533 DYLYEKIDLKHKNEIELTNMIMKLKDAVRNMQGALKTHEDHEQRLQSDIQKMLYDNILEY 592
             +Y  I+ + + E +L N   KLK+ V NM   +  + D E  +Q+ ++ +  + + + 
Sbjct: 521 SMMYTNIEKQQRREHDLINSTDKLKETVNNMNVTIARYTDRESSVQTQMKTLFNEELSKL 580

Query: 593 RRKIETKLDNLKQQALEQSFTIDDDINNVKDSLETLLETVKKDAIIMCENLAQKVVGDQP 652
           +  +   L   ++  L  +  I++++N   + ++ +L+  + +   +  +  +K+  + P
Sbjct: 581 KSMLLKNLRQFEKNELIDNLEIENNLNKAHEEIKQILQISENEIDSLFLDCIKKMSEESP 640

Query: 653 KFFNSMLSELNDMFSKVDEHTDRLKEGLSQITAENNNLKAYLDTHFFRNNHQEILNVHAD 712
           K F+S + +++ + +   E+ + L E LS ++ E NNLK Y++  FF+NNH+E+L  + +
Sbjct: 641 KLFSSFIQDVSRLENSTSENYNNLAELLSDVSEEFNNLKQYINEKFFKNNHEELLKTYVN 700

Query: 713 KTYHQLNLSSKHLMSKITNIISDHVEQNRTLLMDTLKTATTEVITQEMSHFEPVRKTWEQ 772
           KTYHQ+  SS   + K  +++  ++E N+++L+  +K+AT+EVI  EM+HF P ++ WE+
Sbjct: 701 KTYHQVQKSSDDFLLKFNDLLESYLEGNKSVLLQNIKSATSEVIENEMNHFIPQKEKWEK 760

Query: 773 SFNHINVCDSLSNKFKDDTTESLNSLKSHMESTVRESSLIADKIKDNLCHFQDRNDIANM 832
           S   I      SN+FK      +  L+  ++ T         ++K  +   Q   +I   
Sbjct: 761 SIELIEKSKHSSNEFKTKNRVIVGKLQDTLKGTSESLFDTLSEMKSKINELQKAANIIEN 820

Query: 833 TTNINGTVDDIKNKHSVLRDELEKNVSFIHASSEGFKAIDSSLKRIMNFRMPEGKT--ET 890
              +      I  K+ +L+D L  N++    S   F  +D S++ +    +    T  ++
Sbjct: 821 NEVVTEEFISIMKKNGILKDTLNINMTSTEESIVAFDKLDDSIRNVFKNEIDTNITGYQS 880

Query: 891 LADDLIKHIDSSSVAPVASSGKTPLRPLLKSETKQRSLSKSVSPAKSSH--ATIINSPL 947
           +  ++   +D   + P   + K+P+R             +SVSP+++S    +++NS L
Sbjct: 881 ILKEIFDQLDQQRLTPNMRNRKSPVR-------------QSVSPSRTSPQIQSLMNSDL 926

>TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16
           YEL061C
          Length = 939

 Score =  468 bits (1205), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 257/589 (43%), Positives = 381/589 (64%)

Query: 267 SAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGET 326
           ++IYIQ+L+EFHI +A+EG++LLQKGL +RQVASTKMNDVSSRSHTIFT+ LYK   GE 
Sbjct: 236 ASIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEI 295

Query: 327 FRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESK 386
           F++SK+NLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINS+ADKN HIPFRESK
Sbjct: 296 FKISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRESK 355

Query: 387 LTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMKDILV 446
           LTRLLQDSLGGNTKTALIATISPAK+N+EET STLEYATKAK+IKNKPQLGS +MKD+ +
Sbjct: 356 LTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDVRL 415

Query: 447 KNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSSQNQL 506
           K++++ELAK+K D  STK K+G+YM+  HY ++ ND+E+YKTEIQE  R ++ L  QN L
Sbjct: 416 KDLNNELAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDRIVKSLELQNAL 475

Query: 507 LHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRNMQGA 566
           L KDKK+S +  + Q L +  + +++  +   ++++HK E  L   +   ++    M+  
Sbjct: 476 LLKDKKASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQILVEELAHSREKSLKMKTV 535

Query: 567 LKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQALEQSFTIDDDINNVKDSLE 626
           +K + + E+R+QS+++ +  D +++ +  +   L+ + ++ L     + D+I  +KD + 
Sbjct: 536 IKEYSEKEERIQSNMKSIFNDELIKLKELLIENLNGIAKENLIVQTNVKDNIKLIKDDVI 595

Query: 627 TLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKEGLSQITAE 686
           +++   ++ +  +    +Q+++ + P       S++       + +   L E L  I  +
Sbjct: 596 SIVTESQELSKKLFLEFSQQIIKETPLILEMFSSDVKKNQELNETYFANLFENLESIKQQ 655

Query: 687 NNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKHLMSKITNIISDHVEQNRTLLMD 746
            + L  Y    FF++NH  I+N H + T   +  S   +  +    +    EQN  L+++
Sbjct: 656 YSKLNEYFSNDFFKSNHVTIVNDHVNTTKAIIEKSVSDIFKQFQQNMEAFAEQNEKLILE 715

Query: 747 TLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLSNKFKDDTTESLNSLKSHMESTV 806
            LKT ++++I  EM+ F+  +  W+ SF  IN CD L+N + D     L ++K  ++S+ 
Sbjct: 716 NLKTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNSYHDQMHTYLRNMKGKLQSSD 775

Query: 807 RESSLIADKIKDNLCHFQDRNDIANMTTNINGTVDDIKNKHSVLRDELE 855
                  ++IK N+        + N    I    + I +K   L D L+
Sbjct: 776 EIIKKHMNQIKSNVDSLNSTPKLLNTDRAIGDNYNQIISKRDKLHDHLQ 824

>TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16
           YEL061C
          Length = 982

 Score =  405 bits (1040), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 313/973 (32%), Positives = 537/973 (55%), Gaps = 75/973 (7%)

Query: 14  NITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGI----TARMNSKTYTV 69
           NITVAVRCR   ++E  + S  +++    IG NE    TS ++ +    T R   K YT+
Sbjct: 9   NITVAVRCREPIDEEKHSGSPTIIS----IGDNEDG--TSNEVIVLDESTGR--KKIYTL 60

Query: 70  DKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGD----EKLYDG 125
           D V+G   DQ  +F E   P +  F  GYN +++ YG   +GK YT+ G+    +   + 
Sbjct: 61  DAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNA 120

Query: 126 ELSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSG-------- 177
           E SE  G++PRVL +LF  LE   +D+++KCSF+E+YN+EL+DLL D  ++         
Sbjct: 121 E-SENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLIDTGNNANGNNSNGA 179

Query: 178 -GNNSRKLRIYDSLNSSNNVTNV-NSRSSSRSNSPTVNLE----AKRRIRAGALYKPKPK 231
            G+  +KLRI DS  +SN + +  +S SS+R NSP  N +    A  R R G    P   
Sbjct: 180 TGSTGKKLRIVDS--ASNGLRSAGSSNSSTRDNSPLTNSKKIPTAMMRKRMGKRSLP--- 234

Query: 232 LPTQSQSNGQQQQQQQQQQQQQQQQQTQGQVN-EQSSAIYIQHLQEFHITDAKEGLRLLQ 290
            P  S SN      +    +         Q + E+ ++IYIQ+LQE  IT+ +EG+ +++
Sbjct: 235 -PNNSISNNTANNNRLSLSRTNSFSDYSLQSSHERLNSIYIQNLQEITITEIEEGMAIIK 293

Query: 291 KGLSHRQVAST----KMNDVSSRSHTIFTLTLYKNFN-GETFRVSKINLVDLAGSENISR 345
           KGL +R++AST      N+ S RSH+IF +TLYK     E FR+SK++ V+ AGSE    
Sbjct: 294 KGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFVNFAGSEYGDN 353

Query: 346 SGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIA 405
           + ++N      G+ N +L +  ++IN + + + +  F +SKLT+LLQ++  G T+T  IA
Sbjct: 354 NTSKN------GAFNSNLQSFNKMINGMVNNSTYASFLDSKLTQLLQNNFDGITRTLFIA 407

Query: 406 TISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMKDILVKNISHELAKLKSDFLSTKS 465
            I+P K   + T S L  ATK K IKN+P+ GS + K+ L+K +S+EL K KSD LS KS
Sbjct: 408 NIAPLKKQLDATCSVLTMATKIKEIKNEPKKGSVITKESLIKILSNELVKTKSDLLSYKS 467

Query: 466 KE-GIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSSQNQLLHKDKKSSQDTIESQRLQ 524
            + GIYM   HY+E+   +E+YK +IQ S+  I +L+ +   +  +K++ ++  E QR++
Sbjct: 468 NDNGIYMDEKHYSELTKTLESYKEKIQNSKNSINELTKKGNEIRIEKRTFEEINERQRIK 527

Query: 525 IRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRNMQGALKTHEDHEQRLQSDIQKM 584
           ++NL+ ++  L   ++ + K E EL N+ +KL   + NMQ +++ + D E  LQ+ + K+
Sbjct: 528 LQNLRETISNLNCALEKQSKRESELENIKIKLHSILGNMQKSVEKYSDKEIHLQNKL-KL 586

Query: 585 LYD-NILEYRRKIETKLDNLKQQALEQSFTIDDDINNVKDSLETLLETVKKDAIIMCENL 643
           LYD  +++ +  +E+   ++K +  + +  ++ +I+N+K  +  +    +     +  N 
Sbjct: 587 LYDKELVKLKNSLESNFADIKNRMPDDNDNMNTNIDNIKAEILKIANQSQSKVKELLTNS 646

Query: 644 AQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKEGLSQITAENNNLKAYLDTHFFRNNH 703
           A +V+   PK+F  + + L ++   V+ + ++  E LS I+ E NNL  Y++ +F +++H
Sbjct: 647 ANQVLDTSPKYFEQLDTNLKNLEESVEINHNKYSELLSDISEEFNNLNNYINDNFLKSSH 706

Query: 704 QEILNVHADKTYHQLNLSSKHLMSKITNIISDHVEQNRTLLMDTLKTATTEVITQEMSHF 763
           +E+++ + ++TYH++   S         ++  +VE+N   L  ++ + T+E++  E++ F
Sbjct: 707 EELIDTYINRTYHEVQGISVEFTENFKKLLDIYVEKNTKSLSKSITSLTSEIVENELTQF 766

Query: 764 EPVRKTWEQSFNHI--NVCDSLSNKFKDDTTESLNSLKSHMESTVRESSLIAD---KIKD 818
            P +K WE + N I  N  +S++ K K+  +E L  L S   ST   S L  +    IK 
Sbjct: 767 NPEKKKWELASNEIIENFNESIT-KNKNKNSEILAKLLSESTST---SELFINNMSSIKK 822

Query: 819 NLCHFQDRNDIANMTTNINGTVDDIKNKHSVLRDELEKNVSFIHASSEGFKAIDSSLKRI 878
           N+   ++ ++I N    I     +I NK+  L+D +  N +    S + F  +  +++ +
Sbjct: 823 NVEIVEEFSEIFNSNDLIKSEFLEIINKNKKLKDLITDNFNSSENSIDSFDNLKEAMQNV 882

Query: 879 MNFRMPEGKT-ETL-ADDLIKHIDSSSVAPVASSGKTPLRPLLKSETKQRSLSKS-VSPA 935
               M E  + +TL   ++ + ++   +   +SS K   +         ++LS S +SP 
Sbjct: 883 FKNEMKESYSNDTLNLKEIFEQMEQQKLGVNSSSKKKAYK---------QNLSPSKISPI 933

Query: 936 KSSHATIINSPLK 948
           KSS  T +NSPLK
Sbjct: 934 KSS--TKLNSPLK 944

>SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1112

 Score =  368 bits (945), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 237/590 (40%), Positives = 328/590 (55%), Gaps = 109/590 (18%)

Query: 8   PEGDELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTY 67
           P+    NI V VRCR RN++EI  KSSVV++     G + +  N S     +     KTY
Sbjct: 48  PDSPGYNIKVYVRCRSRNKREIGEKSSVVISTMGAQGRDVILSNPSSSSSGSLTNVKKTY 107

Query: 68  TVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE- 126
           T D+VFG  +DQ +VF  +A     + ++GYNCT+  YG T TGKTYTM+GD  +     
Sbjct: 108 TFDRVFGAESDQEVVFNSVAKNYISEMLQGYNCTVFAYGQTGTGKTYTMSGDINILGSTT 167

Query: 127 ---------LSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSG 177
                    LSE AGIIPRVL  LF  L+ + +DY VK SF+ELYNE             
Sbjct: 168 HNHDQSSILLSEHAGIIPRVLVDLFKDLKNESTDYSVKVSFLELYNE------------- 214

Query: 178 GNNSRKLRIYDSLNSSNNVTNVNSRSSSRSNSPTVNLEAKRRIRAGALYKPKPKLPTQSQ 237
                  R+ D L  SN   + N+ S                IR     KP         
Sbjct: 215 -------RLKDLLADSNKEDDNNAES----------------IRIFDNIKP--------- 242

Query: 238 SNGQQQQQQQQQQQQQQQQQTQGQVNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQ 297
                            ++ TQG     S +I ++ ++E +I  A+EGL+LL +G   RQ
Sbjct: 243 -----------------EKNTQG-----SHSIMVKGMEEIYIKSAQEGLKLLTEGSIKRQ 280

Query: 298 VASTKMNDVSSRSHTIFTLTL----YKNFNGETF-RVSKINLVDLAGSENISRSGAQNQR 352
           VASTK ND+SSRSHT+FT+T         +GE + +  K+NLVDLAGSENI+RSGA+N+R
Sbjct: 281 VASTKCNDLSSRSHTVFTITTNVTKVDPLSGEEYVKNGKLNLVDLAGSENINRSGAENKR 340

Query: 353 AKEAGSINQSLLTLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKI 412
           A+EAG IN+SLLTLGRVIN+L D + HIP+RESKLTRLLQDSLGG TKT +IAT+SPAKI
Sbjct: 341 AQEAGLINKSLLTLGRVINALVDHSQHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKI 400

Query: 413 NSEETSSTLEYATKAKNIKNKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMS 472
           + EET STLEYAT+AK+IKN PQ+   M KD  +    HE+ +L+ +  +T++K+GIY++
Sbjct: 401 SMEETVSTLEYATRAKSIKNTPQINQSMTKDSCITEYIHEIDRLRKELRATRTKDGIYIT 460

Query: 473 HLHYN----------EVMNDIENYKTEIQESR----REIEKLSSQNQLLHKDKKSSQDTI 518
              Y+          E    I+N + +I+  +    +++       Q L K   S Q   
Sbjct: 461 QEKYDLYESNCILVGEQKARIDNLEEQIKRFKEKYVQQVNITKETEQKLQKIDLSYQQVW 520

Query: 519 ESQRLQIRNLQSSMDYLYEKI--------DLKHKNEIELTNMIMKLKDAV 560
           E ++L    L+SS+DYL +K         ++ HKN +++ + I+  +D +
Sbjct: 521 EKKQL----LESSLDYLQQKCNSFEHEITEIHHKN-LKILDSIVDERDTI 565

>ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1138

 Score =  363 bits (932), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 228/533 (42%), Positives = 318/533 (59%), Gaps = 60/533 (11%)

Query: 14  NITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVDKVF 73
           NI V VRCR RN++EI  KSSVVV+     G + +  N S  +        KTY  D+VF
Sbjct: 44  NIKVYVRCRSRNQREIDEKSSVVVSTMGRKGKSVILSNPSSPLS----HPKKTYMFDEVF 99

Query: 74  GPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLY---DGE---- 126
           G  +DQ  +F E+A     + ++GYNCT+  YG T TGKTYTM+GD  ++   D +    
Sbjct: 100 GADSDQESIFTEVAKNYIQEMLEGYNCTVFAYGQTGTGKTYTMSGDMSIWGDLDSQDKIL 159

Query: 127 LSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKLRI 186
           L E AGIIPRVL  LF  L  + +++ VK SF+ELYNE LKDLL D  DS  +N   +RI
Sbjct: 160 LGEHAGIIPRVLVNLFKQLSKETTEHSVKISFLELYNERLKDLLADN-DSDEDN---IRI 215

Query: 187 YDSLNSSNNVTNVNSRSSSRSNSPTVNLEAKRRIRAGALYKPKPKLPTQSQSNGQQQQQQ 246
           +D+ N+SN     N  S  + N        K ++RA          PT S +        
Sbjct: 216 FDN-NNSNAHGASNGMSQVKMN--------KSKVRA----------PTLSGATVSSSASN 256

Query: 247 QQQQQQQQQQQTQGQVNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDV 306
                              SS+I ++ ++E +I  A EGL+LL KG   R+VA+TK ND+
Sbjct: 257 SSTSSSSS-----------SSSITVKGMEERYIKSAYEGLQLLTKGSLKRKVAATKCNDL 305

Query: 307 SSRSHTIFTLTLY----KNFNGETF-RVSKINLVDLAGSENISRSGAQNQRAKEAGSINQ 361
           SSRSHTIFT+  +       +GE + ++ K+NLVDLAGSENI+RSGA+N RA+EAG IN+
Sbjct: 306 SSRSHTIFTIVTHVARTDPVSGEQYVKIGKLNLVDLAGSENINRSGAENMRAQEAGLINK 365

Query: 362 SLLTLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTL 421
           SLLTLGRVIN+L + ++HIP+R SKLTRLLQDSLGG TKT +IATISPA+I+ +ET STL
Sbjct: 366 SLLTLGRVINALVEHSSHIPYRGSKLTRLLQDSLGGKTKTCIIATISPARISMDETVSTL 425

Query: 422 EYATKAKNIKNKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMN 481
           EYAT+AK+IKN PQ+   + KD  +    +E+ +L+ +  +++ +EG+Y++   Y+   +
Sbjct: 426 EYATRAKSIKNTPQVNQSLSKDSCIMEYIYEIERLRQELKASRQREGMYITQEQYDLYES 485

Query: 482 D---IENYKTEIQESRREI----EKLSSQNQL---LHKDKKSSQDTIESQRLQ 524
           +   +E  K  IQ    +I    EK   Q +L    H+  + SQ   ++ R+Q
Sbjct: 486 NSLLVEEQKVVIQNMGEQIKRFKEKYVEQTKLSKEAHRQFQESQKVCDTLRIQ 538

>TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7.387
           YBL063W
          Length = 1232

 Score =  346 bits (887), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 301/952 (31%), Positives = 474/952 (49%), Gaps = 222/952 (23%)

Query: 14  NITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSI-----------NTSGDIGIT--- 59
           NI V VRCR R ++EI  KSSVV++    +GAN   +           NT+ + G T   
Sbjct: 51  NIKVYVRCRSRTQREIDEKSSVVIST---LGANGNKVILSPNQSRKLYNTNAN-GSTRTK 106

Query: 60  -----------------ARMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTM 102
                               N +TYT DKVFG  +DQ  +F+ +A    ++ ++GYNCT+
Sbjct: 107 NNTNLNNNIKNATTNSNTGTNGRTYTFDKVFGVESDQETLFESVAKNYIYEMLQGYNCTV 166

Query: 103 LVYGMTSTGKTYTMTGDEKL---YDGE----LSEAAGIIPRVLFKLF------DT----- 144
             YG T TGKTYTM+GD  +    D +    L E AGIIPRVL  LF      DT     
Sbjct: 167 FAYGQTGTGKTYTMSGDLNILGNLDSKDKILLGEHAGIIPRVLVYLFKELSKNDTITNTK 226

Query: 145 ------------------LEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKLRI 186
                             + ++ ++Y VK SF+ELYNE+L DLL + +            
Sbjct: 227 VNNNKNNNNNSNNKNEEQINLKNTEYSVKVSFLELYNEKLTDLLSNYKT----------- 275

Query: 187 YDSLNSSNNVTNVNS-RSSSRSNSPTVNLEAKRRIRAGALYKPKPKLPTQSQSNGQQQQQ 245
            D+LNS++ + N  S  S+  S +  +N+  K +I+   L+    K              
Sbjct: 276 -DALNSNDKLINQTSGNSTPYSITNGLNVNDKFKIKNNNLHDFDGK-------------- 320

Query: 246 QQQQQQQQQQQQTQGQVNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMND 305
                 +    Q +   N   S+I ++ ++E +I  A EGL+LL +G   R+VASTK+ND
Sbjct: 321 ----NVRIMSNQNKSASNCNGSSITVKGMEEIYIKSAHEGLQLLTEGSLKRKVASTKLND 376

Query: 306 VSSRSHTIFTL----TLYKNFNGETF-RVSKINLVDLAGSENISRSGAQNQRAKEAGSIN 360
           +SSRSHTIFT+    T      G+ F +  K+NLVDLAGSENI+RSGA+N+RA+EAG IN
Sbjct: 377 LSSRSHTIFTIITNVTKVDPVTGKHFVKTGKLNLVDLAGSENINRSGAENKRAQEAGLIN 436

Query: 361 QSLLTLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSST 420
           +SLLTLGRVIN+L D++ HIP+RESKLTRLLQDSLGG TKT +IAT+SPAKI+ EET ST
Sbjct: 437 KSLLTLGRVINALVDRSHHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISLEETVST 496

Query: 421 LEYATKAKNIKNKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSH------- 473
           LEYAT+AK+IKN PQ+   + KD  +    +E+ +L+++    ++KEGIY++        
Sbjct: 497 LEYATRAKSIKNTPQINQSLSKDTFIHEYINEIDRLRNELKLARTKEGIYITQDQLDLYE 556

Query: 474 ---LHYNEVMNDIENYKTEIQESR-REIEKLSSQNQLLHK-------DKKSSQDT----- 517
              +   E    I+N + +I+  + + +E+  S   LL+K       ++K S+ T     
Sbjct: 557 SNSILITEQKAKIDNMEDQIKRFKAKYVEETESNRILLNKLEQSEDANQKLSEKTKVIIS 616

Query: 518 ------------------IESQRLQIRN-LQSSMDYLYEKIDLKHKNEIELTNMIM---- 554
                             I S  L++ + LQ+  D    K+DL  K  I+    I     
Sbjct: 617 LFKRYQENFKIFNSNINQIHSSNLEVFDSLQNHKD----KLDLCSKKNIKTLKEIYIAEE 672

Query: 555 KLKDAVRNMQGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQALEQSFTI 614
           K  + +  ++ +L ++ D    + S +   + +N +E+ R +++KL +L           
Sbjct: 673 KYTEQLNTLKASLSSYSDRFMLVFSSVFDEMENNSIEFERNVKSKLSSL----------- 721

Query: 615 DDDINNVKDSLETLLETVKKDAIIMCENLAQKVVGDQ-----PKFFNSMLSELNDMFSKV 669
             D+  V + ++ + ETV+    ++C N+   +  D       + +NS L  L + F+ V
Sbjct: 722 --DLTMVVEEIKNMKETVE----MICNNIL--IASDTWDSSYKEVYNSHLMTLKNCFNMV 773

Query: 670 DEHTDRLKEGLSQITAEN-----NNLKAYLDTHFFRNNHQEILNVHADKTYHQ-LNL--- 720
           +         ++Q+  EN     N++K+    H ++N   +  N      Y Q L +   
Sbjct: 774 EHKC----ANINQLMDENFSKFQNDIKS--GVHNYKNVSSDHTNDMKHTIYEQSLEIEKL 827

Query: 721 ---------SSKHLMSKITNII---SDHVEQNR----TLLMDTLKTATTEVITQEMSHFE 764
                    +SK + S++  +I    D + ++R    T L+DTLK +       E  H E
Sbjct: 828 KEKIIIEQQNSKSVESRLNKVIDYFEDEILKSRRKITTDLIDTLKQS-------EKDHLE 880

Query: 765 PVRKTWEQSFNHINVCDSLSNKFKDDTTESLNSLKSHMESTVRESSLIADKI 816
             ++   ++ + +    +  N+ + D  +S+N+L S      +  SL+A+++
Sbjct: 881 LDKQILNRTLSGLR---NFENEKQSDLQKSINALTSKFSDVFKNVSLVAEQL 929

>TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7.387
           YBL063W
          Length = 1142

 Score =  282 bits (721), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 217/560 (38%), Positives = 284/560 (50%), Gaps = 134/560 (23%)

Query: 14  NITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVDKVF 73
           NI V VRCR RN+KEI  KSSVVV+    +G N         I I+   N   Y  D VF
Sbjct: 9   NIKVYVRCRSRNQKEIDEKSSVVVST---LGQN------GNQIIISNSTNKNKYIFDNVF 59

Query: 74  GPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELS----- 128
           G  +DQ  +F  +A     + I GYNCT+  YG T TGKTYTM+GD  +  G+L+     
Sbjct: 60  GVESDQESIFNSVAYNYIQEMIDGYNCTLFAYGQTGTGKTYTMSGDLNII-GDLNSTKNI 118

Query: 129 ---EAAGIIPRVLFKLFDTLEVQESD--------YMVKCSFIELYNEELKDLLDDGQDSG 177
              E AGIIPRVL +LF +LE   S+        Y VK SF+ELYNE LKDLL    D  
Sbjct: 119 LLGEHAGIIPRVLVQLFTSLEDSISNQKNTSVKGYTVKISFLELYNERLKDLLSADADLP 178

Query: 178 GNNSRKLRIYDSLNSSNNVTNVNSRSSSRSNSPTVNLEAKRRIRAGALYKPKPKLPTQSQ 237
            N                        SS +N P+V+   K       ++  K    +   
Sbjct: 179 PN----------------------SGSSSANDPSVSSNIK-------IFDNKDSSDSSII 209

Query: 238 SNGQQQQQQQQQQQQQQQQQTQGQVNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQ 297
             G Q+                         I+I++  E        GL LL KG   R+
Sbjct: 210 VKGMQE-------------------------IFIKNAME--------GLNLLMKGSLQRK 236

Query: 298 VASTKMNDVSSRSHTIFTLT-----LYKNFNGETFRVSKINLVDLAGSENISRSGAQNQR 352
           V STK+ND+SSRSHTIFT+T     L    N E  ++ K+NLVDLAGSENI++SG   +R
Sbjct: 237 VKSTKLNDLSSRSHTIFTITTNIIKLDNQTNKEYIKIGKLNLVDLAGSENITKSGL--KR 294

Query: 353 AKEAGSINQSLLTLGRVINSLADK--NAH----------------------IPFRESKLT 388
           ++E G IN+SLLTLGRVIN+L+DK  N H                      IP+RESKLT
Sbjct: 295 SQETGLINKSLLTLGRVINALSDKTNNTHGSNNDNNNSSSSSSISNSHHSHIPYRESKLT 354

Query: 389 RLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMKDILVKN 448
           RLLQDSLGG TKT +IATISPAK   +ET STLEYAT+A +IKN P++         + +
Sbjct: 355 RLLQDSLGGMTKTCIIATISPAKTCLDETISTLEYATRAMSIKNNPKINKSQNPSNFIND 414

Query: 449 ISHELAKLKSDFLSTKSKEG---IYMSHLHY---NEVMNDIENYKTEIQESRREIEKLSS 502
             +++ +LK +  ++  K G   I +  L+Y   NE++  IE    +I     +I K   
Sbjct: 415 YINQIDRLKLELQTSTDKIGGIFIPLEKLNYYKSNEIL--IEEQNAKINNMTNQIAKFKK 472

Query: 503 Q-------NQLLHKDKKSSQ 515
           +       N+ L+ D K SQ
Sbjct: 473 KFVEQIQINKQLNTDMKKSQ 492

>Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W
           (REAL)
          Length = 1113

 Score =  253 bits (645), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 148/321 (46%), Positives = 204/321 (63%), Gaps = 37/321 (11%)

Query: 263 NEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLY--- 319
           N  +S+I ++ +QE  I  A EGL LL +G   R+VA+TK ND+SSRSHT+FT+T     
Sbjct: 235 NNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVE 294

Query: 320 ---------KNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVI 370
                    KNF     ++ K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVI
Sbjct: 295 QDSKDHGQNKNF----VKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVI 350

Query: 371 NSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNI 430
           N+L D + HIP+RESKLTRLLQDSLGG TKT +IAT+SPAKI+ EET+STLEYAT+AK+I
Sbjct: 351 NALVDHSNHIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSI 410

Query: 431 KNKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSH-----LHYNEVMNDIEN 485
           KN PQ+   + KD  +K+   E+ KLK+D  ++++K+GI+++         N ++ D +N
Sbjct: 411 KNTPQVNQSLSKDTCLKDYIQEIEKLKNDLKNSRNKQGIFITQDQLDLYESNSILIDEQN 470

Query: 486 YKTEIQESRREIEKLSSQ-------NQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEK 538
            K  I   R +I+K   +       N LL  +K       E     IR+      + Y K
Sbjct: 471 LK--IHNLREQIKKFKEKYLTQLDINNLLQSEK-------EKLVTVIRDFDIDYSHFYSK 521

Query: 539 IDLKHKNEIELTNMIMKLKDA 559
           I   H   +EL N + + +D+
Sbjct: 522 IQQIHYTNLELINQVTQQRDS 542

 Score =  134 bits (336), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 84/194 (43%), Positives = 111/194 (57%), Gaps = 15/194 (7%)

Query: 14  NITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVDKVF 73
           NI V VRCR RN++EI  KSSVV++    +G     I  S     +   + KTY  D+VF
Sbjct: 52  NIHVYVRCRSRNKREIDEKSSVVIS---TLGPQGKEIILSNGSHQSYSSSKKTYQFDQVF 108

Query: 74  GPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE------- 126
           G  +DQ  VF   A     + + GYNCT+  YG T TGKTYTM+GD  +  G+       
Sbjct: 109 GAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINIL-GDVQSTDKL 167

Query: 127 -LSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSG---GNNSR 182
            L E AGIIPRVL  LF  L     +Y VK SF+ELYNE LKDLL D  D      +  R
Sbjct: 168 LLGEHAGIIPRVLVDLFKELSTLNREYSVKISFLELYNENLKDLLSDSDDDDPVVNDTKR 227

Query: 183 KLRIYDSLNSSNNV 196
           ++RI+D+ N+++++
Sbjct: 228 QIRIFDNNNNNSSI 241

>YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}
           KIP1Kinesin-related motor protein required for mitotic
           spindle assembly, chromosome segregation, and 2 micron
           plasmid partitioning; functionally redundant with Cin8p
           for chromosomal but not plasmid functions
          Length = 1111

 Score =  250 bits (639), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 151/348 (43%), Positives = 216/348 (62%), Gaps = 38/348 (10%)

Query: 263 NEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLY--- 319
           N  +S+I ++ +QE  I  A EGL LL +G   R+VA+TK ND+SSRSHT+FT+T     
Sbjct: 235 NNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVE 294

Query: 320 ---------KNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVI 370
                    KNF     ++ K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVI
Sbjct: 295 QDSKDHGQNKNF----VKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVI 350

Query: 371 NSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNI 430
           N+L D + HIP+RESKLTRLLQDSLGG TKT +IATISPAKI+ EET+STLEYAT+AK+I
Sbjct: 351 NALVDHSNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSI 410

Query: 431 KNKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSH-----LHYNEVMNDIEN 485
           KN PQ+   + KD  +K+   E+ KL++D  ++++K+GI+++         N ++ D +N
Sbjct: 411 KNTPQVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQDQLDLYESNSILIDEQN 470

Query: 486 YKTEIQESRREIEKLSSQ-------NQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEK 538
            K  I   R +I+K           N LL  +K       E     I+N        Y +
Sbjct: 471 LK--IHNLREQIKKFKENYLNQLDINNLLQSEK-------EKLIAIIQNFNVDFSNFYSE 521

Query: 539 IDLKHKNEIELTNMIMKLKD-AVRNMQGALKTHEDHEQRLQSDIQKML 585
           I   H   +EL N +++ +D ++ N Q    T+++ + ++   + + L
Sbjct: 522 IQKIHHTNLELMNEVIQQRDFSLENSQKQYNTNQNMQLKISQQVLQTL 569

 Score =  136 bits (342), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 87/206 (42%), Positives = 119/206 (57%), Gaps = 16/206 (7%)

Query: 2   SATNGSPEGDELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITAR 61
           +  NG+   D  NI V VRCR RN++EI+ KSSVV++    +G     I  S     +  
Sbjct: 41  TCNNGAATSDS-NIHVYVRCRSRNKREIEEKSSVVIS---TLGPQGKEIILSNGSHQSYS 96

Query: 62  MNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEK 121
            + KTY  D+VFG  +DQ  VF   A     + + GYNCT+  YG T TGKTYTM+GD  
Sbjct: 97  SSKKTYQFDQVFGAESDQETVFNATAKNYIKEMLHGYNCTIFAYGQTGTGKTYTMSGDIN 156

Query: 122 LYDGE--------LSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDG 173
           +  G+        L E AGIIPRVL  LF  L     +Y VK SF+ELYNE LKDLL D 
Sbjct: 157 IL-GDVQSTDNLLLGEHAGIIPRVLVDLFKELSSLNKEYSVKISFLELYNENLKDLLSDS 215

Query: 174 QD---SGGNNSRKLRIYDSLNSSNNV 196
           +D   +  +  R++RI+D+ N+++++
Sbjct: 216 EDDDPAVNDPKRQIRIFDNNNNNSSI 241

>ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL063W
           (KIP1)
          Length = 1129

 Score =  248 bits (634), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 147/320 (45%), Positives = 216/320 (67%), Gaps = 17/320 (5%)

Query: 268 AIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTL----YKNFN 323
           +I+++ ++E +I  A+EGL+LL  G   R+VA+TK ND+SSRSHTIFT+T         +
Sbjct: 250 SIFVKGMEEMYIRSAQEGLKLLMDGSLKRKVAATKCNDLSSRSHTIFTITTNVTKIHPIS 309

Query: 324 GETF-RVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPF 382
           GE + +V K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D + HIP+
Sbjct: 310 GEQYVKVGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSQHIPY 369

Query: 383 RESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMK 442
           RESKLTRLLQDSLGG TKT +IATISPAKI+ EET STLEYAT+AK+IKN PQ+   M K
Sbjct: 370 RESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTLEYATRAKSIKNTPQVNQLMAK 429

Query: 443 DILVKNISHELAKLKSDFLSTKSKEGIYMSHLHY-----NEVMNDIENYKTE-IQES-RR 495
           +  +     E+ +L+ +  ++ SKEGIY++   +     N ++ + +  K + +QE  RR
Sbjct: 430 ESCIIEYIQEIERLRKELRASHSKEGIYITQEKFETYESNSILVEEQQAKIDNLQEQLRR 489

Query: 496 EIEKLSSQNQLL-HKDKKSSQDTIESQRL--QIRNLQSSMDYLYEKIDLKHKNEIELTNM 552
             EK   Q +L+  KD +  +  + +++   Q ++L   ++ ++ K++      I + N 
Sbjct: 490 LKEKFLEQTKLIKEKDGQIKELDVANRKYLEQSKDLTIYINGIHSKLEDYEHTMIGIHNN 549

Query: 553 IMKLKDAVRNMQGALKTHED 572
            MKL + + + +G +  HED
Sbjct: 550 NMKLLEDINDNRGNI--HED 567

 Score =  160 bits (404), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 122/213 (57%), Gaps = 30/213 (14%)

Query: 4   TNGSPEGDELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGAN--EVSINTSGDIGITAR 61
           + G PE    NI V VRCR RNE+EI+ KSSVV++    +G N  EV +   G       
Sbjct: 47  SEGEPE---YNIKVYVRCRSRNEREIREKSSVVIS---TLGNNGREVILTNPGT------ 94

Query: 62  MNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEK 121
            ++KTYT D+VFG  +DQ  +F ++A    ++ I+GYNCT+  YG T TGKTYTM+GD  
Sbjct: 95  GSNKTYTFDRVFGVESDQESMFNQVARAYINEMIEGYNCTVFAYGQTGTGKTYTMSGDIT 154

Query: 122 LYDGE--------LSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDG 173
           +            LSE AGIIPRVL +LF  L     DY VK SF+ELYNE+L+DLL D 
Sbjct: 155 MMGSSEDDPNFVLLSEHAGIIPRVLVELFRELREVSEDYSVKVSFLELYNEKLRDLLVDD 214

Query: 174 QD--------SGGNNSRKLRIYDSLNSSNNVTN 198
           +D        +G      +RIYDSL +     N
Sbjct: 215 KDVSLEDHNFNGMAPPESIRIYDSLKTDRTSPN 247

>Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  244 bits (623), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 144/311 (46%), Positives = 201/311 (64%), Gaps = 31/311 (9%)

Query: 263 NEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLY--- 319
           N  +S+I ++ +QE  I  A EGL LL +G   R+VA+TK ND+SSRSHT+FT+T     
Sbjct: 234 NNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVE 293

Query: 320 ---------KNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVI 370
                    KNF     ++ K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVI
Sbjct: 294 QDSKDHGQNKNF----VKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVI 349

Query: 371 NSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNI 430
           N+L D + HIP+RESKLTRLLQDSLGG TKT +IATISPAKI+ EET+STLEYAT+AK+I
Sbjct: 350 NALVDHSNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSI 409

Query: 431 KNKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSH-----LHYNEVMNDIEN 485
           KN PQ+   + KD  +K+   E+ KL++D  ++++K+GI+++         N ++ D +N
Sbjct: 410 KNTPQVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQDQLDLYESNSILIDEQN 469

Query: 486 YKTEIQESRREIEKLSSQ-------NQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEK 538
            K  I   R +I+K           N  L  +K+   + I +  +   N  S +  ++  
Sbjct: 470 LK--IHNLRGQIKKFKGNYLNQLDVNNFLQSEKEKLINVIRNFNVDFSNFNSEIQKIHH- 526

Query: 539 IDLKHKNEIEL 549
            +L+  NEI L
Sbjct: 527 TNLELMNEITL 537

 Score =  147 bits (370), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 83/194 (42%), Positives = 114/194 (58%), Gaps = 15/194 (7%)

Query: 14  NITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVDKVF 73
           NI V VRCR RN++EI  KSSVV++    +G     I  S     +   + KTY  D+VF
Sbjct: 51  NIHVYVRCRSRNKREIDEKSSVVIS---TLGPQGKEIILSNGSHQSYSSSKKTYQFDQVF 107

Query: 74  GPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE------- 126
           G  +DQ  VF   A     + + GYNCT+  YG T TGKTYTM+GD  +  G+       
Sbjct: 108 GAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINIL-GDVQSTDNL 166

Query: 127 -LSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQD---SGGNNSR 182
            L E AGIIPRVL  LF  L     +Y VK +F+ELYNE LKDLL D +D   +  ++ R
Sbjct: 167 LLGEHAGIIPRVLVDLFKELSSLNKEYSVKVTFLELYNENLKDLLSDNEDDDPAVNDSKR 226

Query: 183 KLRIYDSLNSSNNV 196
           ++RI+D+ N+++++
Sbjct: 227 QIRIFDNNNNNSSI 240

>NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7.387
          Length = 1102

 Score =  244 bits (622), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 169/458 (36%), Positives = 268/458 (58%), Gaps = 54/458 (11%)

Query: 266 SSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTL----YKN 321
           SS+I ++ ++E +I  A +GL+LL  G   R+VA+TK ND+SSRSHT+FT+T        
Sbjct: 239 SSSIMVKGMEEIYINSAHQGLQLLMDGSIKRKVAATKCNDLSSRSHTVFTITTNITKLDP 298

Query: 322 FNGETF-RVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHI 380
            +GE + +  K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D   HI
Sbjct: 299 VSGEQYVKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHTQHI 358

Query: 381 PFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFM 440
           P+RESKLTRLLQDSLGG TKT +IATISPAKI+ +ET STLEYAT+AK+IKN PQ+   M
Sbjct: 359 PYRESKLTRLLQDSLGGKTKTCIIATISPAKISMDETISTLEYATRAKSIKNTPQVNQSM 418

Query: 441 MKDILVKNISHELAKLKSDFLSTKSKEGIYMSHLHY-----NEVMND-----IENYKTEI 490
            KD  +    HE+ +L+ +  +++ K+GI ++   +     N ++ D     I+N + +I
Sbjct: 419 SKDSCINEYVHEIERLRQELKTSRQKDGISITQDQFDLYESNGILVDEQKTKIQNMEEQI 478

Query: 491 QESRREIEKLSSQNQ-LLHKDKKSSQDTIE--SQRLQ----IRNLQSSMDYLYEKIDLKH 543
           Q  + +  K +  N+ L  + K++   TI+  SQR Q    + N QS+ ++  E++   H
Sbjct: 479 QRFKDKYVKQTELNKNLESRLKQNELQTIQLKSQRTQLLSLLENFQSNSNHYIERVTKIH 538

Query: 544 KNEIELTNMIMKLKDA--------VRNMQGALKTHEDHEQRLQSDIQKML--YDN----- 588
            +   L   + + +          V+++  A+    D ++ L S+++ +L  Y++     
Sbjct: 539 DSNTHLIQQLAQQRSELHNGSITYVKSVTEAMSGISDQQKEL-SELRNVLQSYNDKFKHV 597

Query: 589 ILEYRRKIETKLDNLKQQALEQSFTID-----DDINNVKDSLETLLETVKKDAIIMCENL 643
           I     ++E K+ + ++  LE   +++     D I  ++D + T  E +KK         
Sbjct: 598 ITGIFTELEDKVKDTRKSTLEPLTSMNLRLILDMIGELRDDISTRFEMLKKPR------- 650

Query: 644 AQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKEGLS 681
                 D  K F +    +   FS ++E+ D +++ L+
Sbjct: 651 ----TEDTTKIFKAHQDIIETCFSHINEYCDSMEKVLT 684

 Score =  155 bits (392), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 84/190 (44%), Positives = 116/190 (61%), Gaps = 16/190 (8%)

Query: 15  ITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVDKVFG 74
           I V VRCR RNE+EI+ KSSVV++    +GA + +     +  +      +TYT D+VFG
Sbjct: 61  IKVYVRCRSRNEREIQEKSSVVIS---TLGAPQSTQLLLSNPLLPLAYAKRTYTFDRVFG 117

Query: 75  PSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE-------- 126
             +DQ  VF + A    H+ ++GYNCT+  YG T TGKTYTM+GD  +  G+        
Sbjct: 118 AESDQESVFNDAAKNYIHEMLEGYNCTVFAYGQTGTGKTYTMSGDLNILGGDLDSNTMVL 177

Query: 127 LSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKLRI 186
           L E AGIIPRVL +LF  L+  E  Y VK SF+ELYNE LKDLL   Q    N    +RI
Sbjct: 178 LGEHAGIIPRVLVELFRWLDGNEG-YSVKVSFLELYNERLKDLLASEQSEEEN----IRI 232

Query: 187 YDSLNSSNNV 196
           +D++++S+++
Sbjct: 233 FDNVSASSSI 242

>Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  244 bits (622), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 135/263 (51%), Positives = 184/263 (69%), Gaps = 25/263 (9%)

Query: 263 NEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLY--- 319
           N  +S+I ++ +QE  I  A EGL LL +G   R+VA+TK ND+SSRSHT+FT+T     
Sbjct: 235 NNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIIE 294

Query: 320 ---------KNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVI 370
                    KNF     ++ K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVI
Sbjct: 295 QDSKEHGQNKNF----VKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVI 350

Query: 371 NSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNI 430
           N+L D + HIP+RESKLTRLLQDSLGG TKT +IAT+SPAKI+ EET+STLEYAT+AK+I
Sbjct: 351 NALVDHSNHIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSI 410

Query: 431 KNKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSH-----LHYNEVMNDIEN 485
           KN PQ+   + KD  +K+   E+ KL++D  ++++K+GI+++         N ++ D +N
Sbjct: 411 KNSPQVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQDQLDLYESNSILIDEQN 470

Query: 486 YKTEIQESRREIEKLSSQ--NQL 506
            K  I   R +I+K   +  NQL
Sbjct: 471 LK--IHNLREQIKKFKEKYLNQL 491

 Score =  151 bits (382), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 89/203 (43%), Positives = 117/203 (57%), Gaps = 15/203 (7%)

Query: 5   NGSPEGDELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNS 64
           N S    E NI V VRCR RN +EI  KSSVV++    +G     I  S     +   + 
Sbjct: 43  NNSNATSESNIHVYVRCRSRNRREIDEKSSVVIS---TLGPQGKEIILSNGSHQSYSSSK 99

Query: 65  KTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYD 124
           KTY  D+VFG  +DQ +VF   A     + + GYNCT+  YG T TGKTYTM+GD  +  
Sbjct: 100 KTYQFDQVFGAESDQEMVFHATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINIL- 158

Query: 125 GE--------LSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQ-- 174
           G+        L E AGIIPRVL  LF  L     +Y VK SF+ELYNE LKDLL D +  
Sbjct: 159 GDVQSTDNLLLGEHAGIIPRVLVDLFKELSSLNKEYSVKVSFLELYNENLKDLLSDNEDD 218

Query: 175 DSGGNNSRK-LRIYDSLNSSNNV 196
           D   N+S+K +RI+D+ N+++++
Sbjct: 219 DPTANDSKKQIRIFDNNNNNSSI 241

>Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} similar
           to Ashbya gossypii ACR228C
          Length = 1134

 Score =  242 bits (618), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 121/219 (55%), Positives = 164/219 (74%), Gaps = 5/219 (2%)

Query: 263 NEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTL---- 318
           N    +I ++ ++E +I  A+EGL+LL +G   R+VA+T+ ND+SSRSHTIFT+T     
Sbjct: 249 NSSGHSIMVKGMEEMYIRSAQEGLKLLMEGSLKRKVAATRCNDLSSRSHTIFTITTNVTK 308

Query: 319 YKNFNGETF-RVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKN 377
               +GE + ++ K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D +
Sbjct: 309 IHPISGEQYVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHS 368

Query: 378 AHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLG 437
            HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK + EET+STLEYAT+AK+IKN PQ+ 
Sbjct: 369 QHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKTSMEETASTLEYATRAKSIKNTPQIN 428

Query: 438 SFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSHLHY 476
             M K+  +     E+ KL+ +  +  +KEGIY++   Y
Sbjct: 429 QLMAKESCILGYIKEIEKLRKNLKANHAKEGIYITEEKY 467

 Score =  158 bits (399), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 90/195 (46%), Positives = 115/195 (58%), Gaps = 25/195 (12%)

Query: 14  NITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVDKVF 73
           NI V VRCR RN +EIK KSSVVV+     G   +  N S         N+KTYT D+VF
Sbjct: 56  NIKVYVRCRSRNVREIKEKSSVVVSTLGSQGREIILSNQSTG-------NNKTYTFDQVF 108

Query: 74  GPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE------- 126
           G  +DQ  +F ++A     + ++GYNCT+  YG T TGKTYTM+GD  +           
Sbjct: 109 GVESDQESLFDKVARAYITEMLEGYNCTVFAYGQTGTGKTYTMSGDISVVGASLEDPNYV 168

Query: 127 -LSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLL--------DDGQDSG 177
            LSE AGIIPRVL +LF  L+ +  DY VK SF+ELYNE+L+DLL        D+G   G
Sbjct: 169 LLSEHAGIIPRVLVELFQQLQRESEDYSVKVSFLELYNEKLRDLLVEDKEPLIDEGGIGG 228

Query: 178 G--NNSRKLRIYDSL 190
           G  N+   +RIYD+L
Sbjct: 229 GVANSPETIRIYDNL 243

>TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7.387
           YBL063W
          Length = 1105

 Score =  239 bits (610), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 147/323 (45%), Positives = 204/323 (63%), Gaps = 33/323 (10%)

Query: 269 IYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNF------ 322
           I ++ ++EF+I  A EGL LL  G   R+VA+TK ND+SSRSHT+FT+T   N       
Sbjct: 248 IMVKGMEEFYIKSAHEGLELLMTGSLKRKVAATKCNDLSSRSHTVFTIT--TNVARTDPV 305

Query: 323 -NGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIP 381
            N +  ++ K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D + HIP
Sbjct: 306 SNEQYIKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDNSQHIP 365

Query: 382 FRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMM 441
           +RESKLTRLLQDSLGG TKT +IATISPAKI+ +ET STLEYAT+AK+IKN PQ+   M 
Sbjct: 366 YRESKLTRLLQDSLGGKTKTCIIATISPAKISMDETVSTLEYATRAKSIKNTPQVNQSMS 425

Query: 442 KDILVKNISHELAKLKSDFLSTKSKEGIYMSHLHY-----NEVMNDIENYKTEIQESRRE 496
           K+  +    HE+ +L+ +  +++ KEG+Y++   +     N ++  +E  K  IQ    +
Sbjct: 426 KNSCLGEYIHEIERLRQELKASRQKEGMYITEDQFQLYESNSIL--VEEQKVRIQNMEDQ 483

Query: 497 IEKLSS---QNQLLHKD--KKSSQDTIESQRLQI------RNLQSSMDYLYEKIDLK--- 542
           I K  +   +   L KD  K+  Q  +  ++L I       N QS      E +D     
Sbjct: 484 ILKFKAKYVEQTNLSKDAEKRLKQSQLLCKKLSIEKAEMSENFQSFRQTCTEYVDSVEDI 543

Query: 543 HKNEIELTNMIMKLKDAVRNMQG 565
           H++ +EL   I  LKD   ++ G
Sbjct: 544 HRSNLEL---IRSLKDERDDLFG 563

 Score =  152 bits (385), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 85/193 (44%), Positives = 115/193 (59%), Gaps = 18/193 (9%)

Query: 14  NITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVDKVF 73
           N+ V VRCR RNE+EI+ KSSVV++     G   +  N +G +  + R    TYT D+VF
Sbjct: 41  NMRVYVRCRSRNEQEIEEKSSVVISTLGAKGREVILSNGAGSLSHSKR----TYTFDQVF 96

Query: 74  GPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKL---YDGE---- 126
           G  +DQ  VF E+A     + ++GYNCT+  YG T TGKTYTM+GD  +    D +    
Sbjct: 97  GAESDQETVFDEVAKDYISEMLEGYNCTVFTYGQTGTGKTYTMSGDISILGDLDSQDKIL 156

Query: 127 LSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKLRI 186
           L E +GIIPRVL  LF  L  + ++Y VK SF+ELYNE+LKDLL + +    N    +RI
Sbjct: 157 LGEHSGIIPRVLVDLFKQLSQETNEYTVKVSFLELYNEKLKDLLAESEQEEEN----IRI 212

Query: 187 YD---SLNSSNNV 196
           +D     N + NV
Sbjct: 213 FDNNSGFNCNKNV 225

>NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {ON}
           Anc_7.387
          Length = 1186

 Score =  236 bits (603), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 122/216 (56%), Positives = 161/216 (74%), Gaps = 5/216 (2%)

Query: 263 NEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTL----TL 318
           N  SS+I ++ ++E +I  A EGL+LL  G   R+VASTK ND+SSRSHT+FT+    T 
Sbjct: 283 NNASSSIMVKGMEEIYIKSAHEGLQLLMDGSLKRKVASTKCNDLSSRSHTVFTIATNITK 342

Query: 319 YKNFNGETF-RVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKN 377
               +GE + +  K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D +
Sbjct: 343 IDPISGEQYIKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHS 402

Query: 378 AHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLG 437
            HIP+RESKLTRLLQDSLGG TKT +IATISPAKI+ EET STLEYA +AK+IKN PQ+ 
Sbjct: 403 QHIPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTLEYAIRAKSIKNTPQIN 462

Query: 438 SFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSH 473
             M KD  +     E+ +L+ +  +++ K+GI ++ 
Sbjct: 463 QSMSKDTCINEYVSEIERLRLELKTSRQKDGICITQ 498

 Score =  145 bits (365), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 106/187 (56%), Gaps = 16/187 (8%)

Query: 14  NITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVDKVF 73
           NI V VRCR R+E+EIK KSSVV++     G   +  N S  +        K+Y+ D+VF
Sbjct: 108 NIKVYVRCRSRSEREIKEKSSVVISTLGPQGNQVILSNPSSPLSYPK----KSYSFDRVF 163

Query: 74  GPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDG-------E 126
           G  +DQ  VF + A     + + GYNCT+  YG T TGKTYTM+GD  +           
Sbjct: 164 GAESDQETVFNDAAKNYISEMLSGYNCTVFAYGQTGTGKTYTMSGDLNILGNLESKDMIL 223

Query: 127 LSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKLRI 186
           L E AGIIPRVL  LF  L + E+DY VK SF+ELYNE LKDL    +         +RI
Sbjct: 224 LGEHAGIIPRVLVNLFKMLAL-ENDYSVKISFLELYNERLKDLFAQNESE----EETIRI 278

Query: 187 YDSLNSS 193
           +D+ N++
Sbjct: 279 FDNNNNA 285

>KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa]
           {ON} Anc_7.387 YBL063W
          Length = 1151

 Score =  234 bits (597), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 143/313 (45%), Positives = 206/313 (65%), Gaps = 22/313 (7%)

Query: 263 NEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKN- 321
           N   S+I ++ ++E +I  A EGL+LL +G   R+VASTK ND+SSRSHTIFT+T     
Sbjct: 248 NNTYSSIMVKGMEEIYIKSAHEGLQLLTEGSLKRKVASTKCNDLSSRSHTIFTITTNITK 307

Query: 322 ---FNGETF-RVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKN 377
               +GE + ++ K+NLVDLAGSENISRSGA+N RA+EAG IN+SLLTLGRVIN+L D +
Sbjct: 308 IDPVSGEQYVKIGKLNLVDLAGSENISRSGAENMRAQEAGLINKSLLTLGRVINALVDHS 367

Query: 378 AHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLG 437
            HIP+RESKLTRLLQDSLGG TKT +IAT+SPAKI+ EET STLEYAT+AK+IKN PQ+ 
Sbjct: 368 QHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISMEETISTLEYATRAKSIKNTPQIN 427

Query: 438 SFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSHLHY-----NEVMND-----IENYK 487
             M KD+ +     E+ +L+ +  +++ K+G+Y++   +     N ++ D     I N +
Sbjct: 428 QSMSKDVCINEYVQEIERLRQELKASRQKDGVYITQEQFDLYESNGILVDEQKAKIVNME 487

Query: 488 TEIQESRREIEKLSSQNQLLHKDKKSSQ----DTIESQRLQIR---NLQSSMDYLYEKID 540
            +I++ + +    ++ N+ L    K+SQ    D ++ Q   I      QS+      +I+
Sbjct: 488 EQIKKFKEKYVNQTAINKELETSLKNSQELSNDLLDKQASLISIFGEYQSNFKLFETEIN 547

Query: 541 LKHKNEIELTNMI 553
             H+N + L ++I
Sbjct: 548 TIHENNLNLIDLI 560

 Score =  152 bits (385), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 91/205 (44%), Positives = 121/205 (59%), Gaps = 22/205 (10%)

Query: 14  NITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVDKVF 73
           NI V VRCR RN++EI+ KSSVV++     G   V  + S  +  T     KTY  D+VF
Sbjct: 59  NIQVYVRCRSRNQREIEEKSSVVISTMGAQGKEVVLSDPSSVLSHTK----KTYIFDQVF 114

Query: 74  GPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGD-EKLYDGE------ 126
           G  +DQ +VF   A    H+ ++GYNCT+  YG T TGKTYTM+GD   L D E      
Sbjct: 115 GVESDQEVVFNATAQNYIHEMLQGYNCTIFAYGQTGTGKTYTMSGDINILGDLESQDKIL 174

Query: 127 LSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKLRI 186
           L E AGIIPRVL  LF  L  + ++Y VK SF+ELYNE LKDLL   +++       +RI
Sbjct: 175 LGEHAGIIPRVLVNLFQYLTRESTEYSVKISFLELYNERLKDLLSQSKET----EESIRI 230

Query: 187 YDSLNSSNNVTNVNSR--SSSRSNS 209
           +D     N++ + NS+   SSR+N+
Sbjct: 231 FD-----NHIPSGNSKIQKSSRNNT 250

>Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar to
           Ashbya gossypii ADR145C
          Length = 662

 Score =  179 bits (454), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 126/386 (32%), Positives = 190/386 (49%), Gaps = 87/386 (22%)

Query: 57  GITARMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTM 116
           G+     S+++  D VFG ++ Q  V+  +A+ M   F  GYN T+L YG T +GK+YTM
Sbjct: 77  GVQGESPSRSFHFDYVFGTNSTQDDVYDFVAEEMLDQFFTGYNSTILAYGQTGSGKSYTM 136

Query: 117 TGDEKLYDGELSEAAGIIPRVLFKLFDTLEVQES----DYMVKCSFIELYNEELKDLLDD 172
            G          +  G+IPR+  ++F+ + + +S    +Y+V  SF+E+Y E        
Sbjct: 137 FGP--------IDNRGLIPRICHEIFERIGLLKSSADIEYVVSVSFLEIYLE-------- 180

Query: 173 GQDSGGNNSRKLRIYDSLNSSNNVTNVNSRSSSRSNSPTVNLEAKRRIRAGALYKPKPKL 232
                       ++YD L  S N          +S SP                      
Sbjct: 181 ------------KVYDLLGESIN----------KSASP---------------------- 196

Query: 233 PTQSQSNGQQQQQQQQQQQQQQQQQTQGQVNEQSS-AIYIQHLQEFHITDAKEGLRLLQK 291
                             ++  +++T   ++E S+  +Y+Q      ++D  E L  +  
Sbjct: 197 ------------------KKTSEKRTSLTIHESSTFGVYVQSATVISVSDGDELLHCIHL 238

Query: 292 GLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGE-TFRVSKINLVDLAGSENISRSGAQN 350
           G S R  +ST MN  SSRSH I  + L K  N E + + S + LVDLAGSE +S++ A  
Sbjct: 239 GESQRCKSSTDMNFESSRSHAIVKINLLKRDNLEGSIQKSDLFLVDLAGSEKVSKTNAVG 298

Query: 351 QRAKEAGSINQSLLTLGRVINSLADKN---AHIPFRESKLTRLLQDSLGGNTKTALIATI 407
              +EA  IN SL +LG VIN+L  K+    HIP+R+S+LTRLL+DSLGGN+KT LI   
Sbjct: 299 ATLEEAKKINLSLSSLGNVINALTQKDKKRTHIPYRDSQLTRLLRDSLGGNSKTTLILNC 358

Query: 408 SPAKINSEETSSTLEYATKAKNIKNK 433
           +  K N  ET +TL + ++AK I+NK
Sbjct: 359 ACDKSNEAETLTTLRFGSRAKQIENK 384

>ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL079W
           (SMY1)
          Length = 635

 Score =  177 bits (450), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 136/437 (31%), Positives = 204/437 (46%), Gaps = 99/437 (22%)

Query: 4   TNGSPEGDELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMN 63
           ++ + EG +  + V VR R   E    A          V+ A+E ++  +G     A   
Sbjct: 12  SSAADEGADDKMKVVVRLRPLPEGGSAA----------VVAADEGTVEFAG-----AADE 56

Query: 64  SKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLY 123
           ++ +  D VFG  A Q  VF  +A+ M   F  GYN T+L YG T +GK+YTM G     
Sbjct: 57  ARAFRFDYVFGTDARQEEVFDYVAEEMLDQFFTGYNSTILAYGQTGSGKSYTMFGPPG-- 114

Query: 124 DGELSEAAGIIPRVLFKLFDTLEV----QESDYMVKCSFIELYNEELKDLLDDGQDSGGN 179
                   G+IPR+  ++F+ + +     + +Y+V  SF+E+Y E               
Sbjct: 115 ------HRGLIPRICQQIFERIGLLKNCADIEYVVSVSFLEIYLE--------------- 153

Query: 180 NSRKLRIYDSLNSSNNVTNVNSRSSSRSNSPTVNLEAKRRIRAGALYKPKPKLPTQSQSN 239
                ++YD L  S N  +   ++S +  S TV+                       +SN
Sbjct: 154 -----KVYDLLGESINKASSPKKNSDKRASLTVH-----------------------ESN 185

Query: 240 GQQQQQQQQQQQQQQQQQTQGQVNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVA 299
                                     +  +Y++      ++D  E L  +  G + R   
Sbjct: 186 --------------------------TFGVYVEGATIVSVSDGDELLNCIHLGEAQRYKG 219

Query: 300 STKMNDVSSRSHTIFTLTLYKNFNGE-TFRVSKINLVDLAGSENISRSGAQNQRAKEAGS 358
           ST MN  SSRSH I  + L K  N E   + S + LVDLAGSE ++++ A     +EA  
Sbjct: 220 STDMNLESSRSHAIVKINLLKRDNLEGNIQKSDLFLVDLAGSEKVAKTNAVGATLEEAKK 279

Query: 359 INQSLLTLGRVINSLA--DKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEE 416
           IN SL +LG VIN+L   +K  HIP+R+S+LTRLL+DSLGGN+KT LI   +  K N  E
Sbjct: 280 INLSLSSLGNVINALTQKEKRTHIPYRDSQLTRLLRDSLGGNSKTTLILNCACDKSNESE 339

Query: 417 TSSTLEYATKAKNIKNK 433
           T +TL + ++AK+IKNK
Sbjct: 340 TLTTLRFGSRAKHIKNK 356

>KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 668

 Score =  152 bits (383), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 110/375 (29%), Positives = 176/375 (46%), Gaps = 89/375 (23%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  D VF P  +   V++ +A PM     +G+NCT+  YGMT +GKTYTM+G +      
Sbjct: 106 FNFDHVFSPEMNNDRVYETMALPMIDKLFEGFNCTIFAYGMTGSGKTYTMSGSK------ 159

Query: 127 LSEAAGIIPRVLFKLFDTLEV--QESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKL 184
                GIIP  +  +FD + V      + V+ S++E+YNE                    
Sbjct: 160 --SGPGIIPMCVDTIFDRINVGLPRKKFTVRVSYLEIYNE-------------------- 197

Query: 185 RIYDSLNSSNNVTNVNSRSSSRSNSPTVNLEAKRRIRAGALYKPKPKLPTQSQSNGQQQQ 244
           RI+D LN     T +NS     S++ T +L+ +  ++ G                     
Sbjct: 198 RIFDLLNLPQGKT-LNSNIMVPSSTLTNDLKLRDDLKYG--------------------- 235

Query: 245 QQQQQQQQQQQQQTQGQVNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMN 304
                                   + +  L E +++  KE ++ +  G  +R+   T  N
Sbjct: 236 ------------------------VKVVGLVERNVSSNKELMKCISIGDHNRKTGETDFN 271

Query: 305 DVSSRSHTIFTLTLY--KNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQS 362
             SSRSH +  + ++      GE   +S ++L DLAGSE   R+  Q +R KE   IN+S
Sbjct: 272 TRSSRSHAVVLIRVFCTDEITGEQV-MSTLSLCDLAGSE---RATGQQERRKEGAYINKS 327

Query: 363 LLTLGRVINSLADKNA-------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSE 415
           LL LG VI+ L+ +++       HIP+R+SKLTR+LQ +L G++  A I T+      S 
Sbjct: 328 LLALGTVISKLSMESSGLSTNVGHIPYRDSKLTRILQPALSGDSLVATICTVDTRPETST 387

Query: 416 ETSSTLEYATKAKNI 430
           E+ +T+ +A++AKNI
Sbjct: 388 ESINTIRFASRAKNI 402

>SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 504

 Score =  145 bits (367), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 82/175 (46%), Positives = 117/175 (66%), Gaps = 8/175 (4%)

Query: 270 YIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKN---FNGE- 325
           +++ L EF +   +E L  +++G   R V  T MN+ SSRSH IFT+++ ++     G+ 
Sbjct: 198 FVEGLNEFKVCKVEEILEYMKQGDRLRTVGVTNMNNSSSRSHAIFTISIKQSETTLAGDL 257

Query: 326 TFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAH--IPFR 383
           T R S I LVDLAGSE +S +GA+  R KE  +IN+SL TLGRV++ LA KN    IP+R
Sbjct: 258 TERRSSIKLVDLAGSERVSTTGARGDRLKEGSNINKSLTTLGRVVSVLAKKNRPKLIPYR 317

Query: 384 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGS 438
           +S LT +L+++LGGN+KT +IA +SP   + EET STL YAT AK +KN  ++ S
Sbjct: 318 DSALTWVLKENLGGNSKTVMIACVSPC--DYEETISTLRYATTAKEVKNTARVNS 370

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 84/182 (46%), Gaps = 23/182 (12%)

Query: 14  NITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVDKVF 73
           NI VAVR R    +E        V  P      +  I+TS  +        K +T D  F
Sbjct: 4   NIKVAVRLRSPLPREHGQPIITQVTSPTSFVIQQ-HISTSSLLATEEFTQGKIFTFDHCF 62

Query: 74  ----GPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDE--------- 120
                 S DQ +++  I        + GYN  +L YG T +GK++TM G E         
Sbjct: 63  KYSENASHDQEVIYDTIGREYLLHTLDGYNTCILAYGQTGSGKSFTMMGPEVSKHFHNNQ 122

Query: 121 KLYDGELSEAA-GIIPRVLFKLFDTLEVQESD-------YMVKCSFIELYNEELKDLL-D 171
              D  + ++A GIIPRV   LFD   +  S+       + + CS++E+YNE+++DLL +
Sbjct: 123 TALDRAIEDSAIGIIPRVCCDLFDICNMCNSEEDGIKTQFEIYCSYLEIYNEQVRDLLSE 182

Query: 172 DG 173
           DG
Sbjct: 183 DG 184

>KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 678

 Score =  145 bits (366), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 115/386 (29%), Positives = 178/386 (46%), Gaps = 97/386 (25%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  DKVF P  +   V++EI  PM     +GYN T+  YGMT +GKT+TM+G        
Sbjct: 140 FWFDKVFSPQTNNYGVYEEIGKPMIDKLFQGYNATIFAYGMTGSGKTFTMSGTR------ 193

Query: 127 LSEAAGIIPRVLFKLFDTL---EVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRK 183
             + AG+I   + ++F  +    V    Y V+ S++E+YNE                   
Sbjct: 194 --DEAGLILLSVEQIFSQIMKESVNNKSYEVRVSYLEIYNE------------------- 232

Query: 184 LRIYDSLNSSNNVTNVNSRSSSRSNSPTVN-LEAKRRIRAGALYKPKPKLPTQSQSNGQQ 242
            +IYD LN            S++S   T    ++K    AGA      +LP +       
Sbjct: 233 -KIYDLLNYP----------SAKSPGGTYGSFQSKNVPGAGA------ELPVR------- 268

Query: 243 QQQQQQQQQQQQQQQTQGQVNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTK 302
                               ++    + +  L E  +  +++ LR ++ G S+R+   T 
Sbjct: 269 --------------------DDARHGVRVVGLTEQQVHSSEDVLRKIELGNSNRRTGETD 308

Query: 303 MNDVSSRSHTIFTL--TLYKNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSIN 360
            N  SSRSH I T+  T  +  +G T   S ++L DLAGSE   R+  Q++R KE   IN
Sbjct: 309 YNTRSSRSHAIVTIKVTCTELLSG-TDTTSTLSLCDLAGSE---RAAGQHERRKEGAFIN 364

Query: 361 QSLLTLGRVINSLAD----------------KNAHIPFRESKLTRLLQDSLGGNTKTALI 404
           +SLL LG VI+ L+                  N+H+P+R+SKLTR+LQ +L G++    I
Sbjct: 365 KSLLALGTVISKLSAVSGASGGGAATPPPTFGNSHVPYRDSKLTRILQPALSGDSIVTTI 424

Query: 405 ATISPAKINSEETSSTLEYATKAKNI 430
            TI        ET +T+ +A++AKN+
Sbjct: 425 CTIDTKPDAMSETVNTIRFASRAKNV 450

>YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON}
           KIP2Kinesin-related motor protein involved in mitotic
           spindle positioning, stabilizes microtubules by
           targeting Bik1p to the plus end; Kip2p levels are
           controlled during the cell cycle
          Length = 706

 Score =  144 bits (363), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 123/401 (30%), Positives = 178/401 (44%), Gaps = 107/401 (26%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  D VF        V++  + PM    + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYERTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 127 LSEAAGIIPRVLFKLFDTLEVQ----ESDYMVKCSFIELYNEELKDLLDDG-QDSGGNNS 181
           L    G+IP  +  LF  +  Q    +  + V  S++E+YNE + DLL+ G ++SG   S
Sbjct: 219 L----GLIPLSVSYLFTNIMEQSMNGDKKFDVIISYLEIYNERIYDLLESGLEESGSRIS 274

Query: 182 RKLRIYDSLNSSNNVTNVNSRSSSRSNSPTVNLEAKRRIRAGALYKPKPKLPTQSQSNGQ 241
              R+Y                 S+SNS  + +E K  IR  + Y               
Sbjct: 275 TPSRLY----------------MSKSNSNGLGVELK--IRDDSQY--------------- 301

Query: 242 QQQQQQQQQQQQQQQQTQGQVNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVAST 301
                                      + +  L E     ++E LR +  G   R++  T
Sbjct: 302 --------------------------GVKVIGLTERRCESSEELLRWIAVGDKSRKIGET 335

Query: 302 KMNDVSSRSHTIFTLTLYK-NFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSIN 360
             N  SSRSH I  + L   N    T R S ++L DLAGSE   R+  Q +R KE   IN
Sbjct: 336 DYNARSSRSHAIVLIRLTSTNVKNGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFIN 392

Query: 361 QSLLTLGRVINSL-ADK---------------------NA---------HIPFRESKLTR 389
           +SLL LG VI+ L ADK                     NA         HIP+R+SKLTR
Sbjct: 393 KSLLALGTVISKLSADKMNSVGSNIPSPSASGSSSSSGNATNNGTSPSNHIPYRDSKLTR 452

Query: 390 LLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNI 430
           LLQ +L G++    I T+      + ET +TL +A++AKN+
Sbjct: 453 LLQPALSGDSIVTTICTVDTRNDAAAETMNTLRFASRAKNV 493

>KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W
          Length = 473

 Score =  140 bits (354), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 81/173 (46%), Positives = 111/173 (64%), Gaps = 8/173 (4%)

Query: 270 YIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFN---GET 326
           +++ LQEF +    E L  L++G   + V +T +N+ SSRSHTIFT+ + +  N   G  
Sbjct: 169 FVEGLQEFEVNSVDEILDYLRQGSERKTVGATLVNEQSSRSHTIFTINVEQKENSPLGHV 228

Query: 327 F-RVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAH--IPFR 383
             R S I L+DLAGSE  + SGA  +R KE  +IN+SL TLGRVI  LA K     IP+R
Sbjct: 229 LERRSSIRLIDLAGSERANASGATGERLKEGSNINKSLSTLGRVIAMLAKKKQPRLIPYR 288

Query: 384 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQL 436
           ++ LT +L++SLGGN+KT +IA +SP     EET STL YAT A+++K   QL
Sbjct: 289 DAALTWVLKESLGGNSKTCMIACVSPCDF--EETMSTLRYATLARSVKTFAQL 339

 Score = 74.3 bits (181), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 62/112 (55%), Gaps = 21/112 (18%)

Query: 78  DQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSEAAGIIPRV 137
           DQ+ +++++A       + GYN  +  YG T +GK++TMTG         +E  GI+PR+
Sbjct: 62  DQAQLYEQLARDYLLHALDGYNTCIFAYGQTGSGKSHTMTGS--------AELPGIVPRM 113

Query: 138 LFKLFDTLEVQESD-------YMVKCSFIELYNEELKDLLDDGQDSGGNNSR 182
             +LF+  E+ ES        + ++CS++E+YNE ++DLL      G N  R
Sbjct: 114 CQELFEVREMYESSDDQASTQFKIRCSYLEIYNETVRDLL------GANKCR 159

>TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.678
           YPL155C
          Length = 696

 Score =  143 bits (361), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 117/425 (27%), Positives = 183/425 (43%), Gaps = 103/425 (24%)

Query: 35  VVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDF 94
           +V   P  I  NE  +    D    A  +   + +D++F        ++ E+  P+    
Sbjct: 77  IVAIRPKPISNNEKKVWNIVDNKRIAHDDVGEFRLDRIFDCDVSNLEIYSELCKPLIDKL 136

Query: 95  IKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSEAAGIIPRVLFKLFDTLE----VQES 150
             GYN T+  YGMT +GKT+TM+G +        E  G+IP  +  LF+T+     + + 
Sbjct: 137 AMGYNATLFAYGMTGSGKTFTMSGTQ--------EDTGLIPLSISHLFNTINEENLLGKK 188

Query: 151 DYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKLRIYDSLNSSNNVTNVNSRSSSRSNSP 210
            Y +  S++E+YNE+L DLLD                       NV  VN   SS   +P
Sbjct: 189 KYEMLVSYMEIYNEKLYDLLD----------------------TNVEGVNFGYSSNLQTP 226

Query: 211 -----TVNLEAKRRIRAGALYKPKPKLPTQSQSNGQQQQQQQQQQQQQQQQQTQGQVNEQ 265
                + N     RIR  A Y                                       
Sbjct: 227 PRFGNSFNSAQDLRIRDDAQY--------------------------------------- 247

Query: 266 SSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYK-NFNG 324
              I +  L E   +   + ++ ++ G  +++++ T+ N  SSRSH+I  + L   +   
Sbjct: 248 --GIKVVGLSEHRCSSKDDLMKWVRIGDKNKKISETEYNSRSSRSHSILLVRLIATDLET 305

Query: 325 ETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK-------- 376
                S ++L DLAGSE   ++ +Q +R KE   IN+SLL LG VI  L+ +        
Sbjct: 306 GIVTTSTLSLCDLAGSE---KATSQQERRKEGAFINKSLLALGTVIAKLSSESNQHRNAD 362

Query: 377 -----------NAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYAT 425
                      N+HIP+R+SKLTR+LQ +L GN+    I T+      S ET +TL +A+
Sbjct: 363 NVNHQETSNPNNSHIPYRDSKLTRILQPALSGNSIITTICTVDIRSDASSETLNTLRFAS 422

Query: 426 KAKNI 430
           +AKN+
Sbjct: 423 RAKNV 427

>Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {ON}
           YPL155C (REAL)
          Length = 706

 Score =  142 bits (357), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 120/401 (29%), Positives = 172/401 (42%), Gaps = 107/401 (26%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  D VF        V++    PM    + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYERTGKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 127 LSEAAGIIPRVLFKLFDTLEVQESD----YMVKCSFIELYNEELKDLLDDG-QDSGGNNS 181
           L    G+IP  +  LF  +  Q  D    + V  S++E+YNE + DLL+ G ++SG    
Sbjct: 219 L----GLIPLSVSYLFSNIMEQSMDGDKKFDVIISYLEIYNERIYDLLESGLEESGSRPG 274

Query: 182 RKLRIYDSLNSSNNVTNVNSRSSSRSNSPTVNLEAKRRIRAGALYKPKPKLPTQSQSNGQ 241
              R Y                  +SNS  + +E K  IR  + Y               
Sbjct: 275 TPSRSY----------------MGKSNSNAMGVELK--IRDDSKY--------------- 301

Query: 242 QQQQQQQQQQQQQQQQTQGQVNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVAST 301
                                      + +  L E      +E LR +  G   R++  T
Sbjct: 302 --------------------------GVKVIGLTERRCESTEELLRWIGIGDKSRKIGET 335

Query: 302 KMNDVSSRSHTIFTLTLYK-NFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSIN 360
             N  SSRSH I  + L   + N  T R S ++L DLAGSE   R+  Q +R KE   IN
Sbjct: 336 DYNTRSSRSHAIVLIRLTSTDVNNGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFIN 392

Query: 361 QSLLTLGRVINSL-ADKNA------------------------------HIPFRESKLTR 389
           +SLL LG VI+ L ADK                                HIP+R+SKLTR
Sbjct: 393 KSLLALGTVISKLSADKTTSVDSNISTTPTGSSGSSSGSITGNSGIPSNHIPYRDSKLTR 452

Query: 390 LLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNI 430
           LLQ +L G++    I T+      + ET +TL +A++AKN+
Sbjct: 453 LLQPALSGDSIVTTICTVDTRNDAAAETMNTLRFASRAKNV 493

>TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON}
           Anc_3.479 YPR141C
          Length = 676

 Score =  141 bits (355), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 115/374 (30%), Positives = 172/374 (45%), Gaps = 95/374 (25%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           Y+ DKVF  +     +FKE+++ +    + G+N  +  YG T +GKT+TM          
Sbjct: 383 YSFDKVFSQTDTNQEIFKEVSE-LIQSSLDGFNVCIFAYGQTGSGKTFTM---------- 431

Query: 127 LSEAAGIIPRVLFKLFDTLEVQESD---YMVKCSFIELYNEELKDLLDDGQDSGGNNSRK 183
           L+   GIIP     +FD ++    +   Y V C F+E+YN+E                  
Sbjct: 432 LNPKDGIIPSTAKHIFDWIDNSAKNGWKYNVTCEFLEIYNDE------------------ 473

Query: 184 LRIYDSLNSSNNVTNVNSRSSSRSNSPTVNLEAKRRIRAGALYKPKPKLPTQSQSNGQQQ 243
             IYD L S +N          +SNS                            SNG + 
Sbjct: 474 --IYDLLRSDDN----------KSNS----------------------------SNGPRH 493

Query: 244 QQQQQQQQQQQQQQTQGQVNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKM 303
           +                  ++ S    +++L+   +T  +    +L+  +  R  AST  
Sbjct: 494 KIHH---------------DDASKTTVVENLETITLTSKESVDAVLKNAMKLRATASTSS 538

Query: 304 NDVSSRSHTIFTLTLYKNFN---GETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSIN 360
           N+ SSRSH+IF + ++   N   GE  R   +NL+DLAGSE +S S  Q++R KE   IN
Sbjct: 539 NERSSRSHSIFIIKIH-GINEGLGEE-RNGLLNLIDLAGSERLSVSKVQSERIKETQHIN 596

Query: 361 QSLLTLGRVINSLADKNA---HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEET 417
           +SL  LG V+NSL   +A   HI FR+SKLT LLQ SL GN+KT ++  IS +  +  ET
Sbjct: 597 KSLSFLGNVMNSLGSPDATTRHISFRDSKLTYLLQYSLTGNSKTLMVVNISSSSDHINET 656

Query: 418 SSTLEYATKAKNIK 431
             +L +A K  + K
Sbjct: 657 IKSLNFAKKVNSTK 670

>TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON}
           Anc_8.678 YPL155C
          Length = 637

 Score =  140 bits (352), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 126/419 (30%), Positives = 191/419 (45%), Gaps = 101/419 (24%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +T D+VF  +     +++  + PM    ++G+N T+  YGMT +GKT+TMTG E      
Sbjct: 112 FTFDRVFPANCTNLDIYEASSRPMIDKLLQGFNATVFAYGMTGSGKTFTMTGTE------ 165

Query: 127 LSEAAGIIPRVLFKLFDTLEVQE----SDYMVKCSFIELYNEELKDLLDDGQDSGGNNSR 182
             + AG+IP  +  LF  +        S Y V  S++E+YNE++ DLL D +     NS 
Sbjct: 166 --DEAGLIPLSVTYLFSKILEHSMRGTSKYEVVVSYLEIYNEKIYDLL-DCESENKFNST 222

Query: 183 KLRIYDSLNSSNNVTNVNSRSSSRSNSPTVNLEAKRRIRAGALYKPKPKLPTQSQSNGQQ 242
             R++ S              + RS+   V L    RIR    Y                
Sbjct: 223 PSRMFLS-------------GTPRSSGGPVEL----RIRDDLKY---------------- 249

Query: 243 QQQQQQQQQQQQQQQTQGQVNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTK 302
                                     + I  L E     ++E  R +Q G  +R+ + T 
Sbjct: 250 -------------------------GVRITGLTEKRCESSEELSRWIQIGDKNRKTSETI 284

Query: 303 MNDVSSRSHTIFTLTLYKN--FNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSIN 360
            N  SSRSH I  + L      +GET   S ++L DLAGSE   ++ +Q +R KE   IN
Sbjct: 285 YNTRSSRSHAIVLVRLNNTDLRSGETVS-STLSLCDLAGSE---KAVSQYERRKEGAFIN 340

Query: 361 QSLLTLGRVINSL------------------ADKNAHIPFRESKLTRLLQDSLGGNTKTA 402
           +SLL LG VI+ L                   + N HIP+R+SKLTR+LQ +L GN+   
Sbjct: 341 KSLLALGTVISKLSSESLSKNGPPTFTSTNPTEPNTHIPYRDSKLTRILQPALSGNSIIT 400

Query: 403 LIATISPAKINSEETSSTLEYATKAKN----IKNKPQL--GSFMMKDILVKNISHELAK 455
            I TI      + ET +T+ +A++AKN    +  +P +  GS+  KD  ++N++ +L K
Sbjct: 401 TICTIDTRNEAASETVNTIRFASRAKNVTLQVAKRPAVGTGSYNEKDQTIENLTQQLEK 459

>SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]
           {ON} weakly similar to uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a
           kinesin, colocalizes with Myo2p; kinesin heavy chain
           homolog
          Length = 649

 Score =  138 bits (348), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 110/174 (63%), Gaps = 8/174 (4%)

Query: 267 SAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYK-NFNGE 325
           S IY++ L   ++T  +E L  +++G S R V+ST MN  SSRSH+I  + L K N   E
Sbjct: 195 SGIYVKGLNTNYVTSEQELLDYIKQGESQRNVSSTSMNLESSRSHSIVRINLEKRNALEE 254

Query: 326 TFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD-------KNA 378
             + S + LVDLAGSE + ++ A     +EA  IN SL  LG VIN+L          +A
Sbjct: 255 NIQHSFLYLVDLAGSEKVGKTNAAGVTLEEAKKINSSLSALGNVINALTQVESKSKRTSA 314

Query: 379 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKN 432
           HIP+R+SKLTRLLQDSLGGN+KT LI   S ++ N +ET STL + ++AK IKN
Sbjct: 315 HIPYRDSKLTRLLQDSLGGNSKTTLILNCSTSRFNEQETLSTLRFGSRAKKIKN 368

 Score = 84.0 bits (206), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 78/142 (54%), Gaps = 11/142 (7%)

Query: 63  NSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKL 122
           N + +T D+VF   + Q  V++ +A  M   F +GYN T+L YG T +GK++TM G +  
Sbjct: 71  NDRLFTFDRVFDTGSTQESVYEFVAGDMLKSFFQGYNGTILAYGQTGSGKSHTMFGPK-- 128

Query: 123 YDGELSEAAGIIPRV---LFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGN 179
                 E  G+IPR+   +FK  +T + ++  + V  SF+E+Y E++ DLL    +   +
Sbjct: 129 ------ENRGVIPRICHDIFKQIETPDYEDCIFTVSVSFMEVYLEKIYDLLAQSLEKPAD 182

Query: 180 NSRKLRIYDSLNSSNNVTNVNS 201
               L ++D+ +S   V  +N+
Sbjct: 183 KRISLSLHDTKDSGIYVKGLNT 204

>KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1 Kinesin-related motor protein
           required for mitotic spindle assembly and chromosome
           segregation; functionally redundant with Cin8p
          Length = 456

 Score =  134 bits (337), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 107/165 (64%), Gaps = 5/165 (3%)

Query: 270 YIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGETFRV 329
           ++Q +  F +   +E L  L  G S R VAST+MN  SSRSH IFTL++ +     + R 
Sbjct: 149 FVQDITTFKVNRVEEVLEYLSIGDSKRSVASTRMNMESSRSHAIFTLSIKQQEPDGSIRE 208

Query: 330 SKINLVDLAGSE--NISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAH-IPFRESK 386
           S + LVDLAGSE  N +      +R KE  +IN+SL TLGR I+ LA  + H IP+R+S 
Sbjct: 209 SDLKLVDLAGSERANATMGIDNGKRMKEGANINKSLSTLGRCISQLAKNSKHLIPYRDSL 268

Query: 387 LTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIK 431
           LT +L+++LGGN+KT +IA ISP  I+ EE+ STL YAT AK IK
Sbjct: 269 LTWVLKENLGGNSKTCMIACISP--IDLEESLSTLRYATTAKEIK 311

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 58/109 (53%), Gaps = 9/109 (8%)

Query: 65  KTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYD 124
           +++  D +F  S+ Q+ +  E+        ++GYN  +  YG T +GKTYTM G      
Sbjct: 35  RSFNFDHIFDTSSSQTDIPGELCSKYVLHALEGYNACIFAYGQTGSGKTYTMRGT----- 89

Query: 125 GELSEAAGIIPRVLFKLFDTLEVQESDY-MVKCSFIELYNEELKDLLDD 172
              +   GIIP +   LFD LE+ ++    V  ++ E+YNE+L DLL D
Sbjct: 90  ---NSNPGIIPLLCRDLFDALELDKTTVSSVSITYFEIYNEKLIDLLGD 135

>NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {ON}
           Anc_8.678
          Length = 655

 Score =  137 bits (344), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 108/379 (28%), Positives = 166/379 (43%), Gaps = 76/379 (20%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  D V+ P      +++ I  PM     +G+N T+  YGMT +GKTYTM G       +
Sbjct: 135 FKFDHVYSPHVSNLEIYESINKPMIDKLFQGFNATVFAYGMTGSGKTYTMMGSGGDGGDD 194

Query: 127 LSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKLRI 186
                  +  +  K+ +   V E  + V  S++E+YNE                    RI
Sbjct: 195 DGLIPLSVSYLFSKVIEVGLVGERKFDVLLSYLEIYNE--------------------RI 234

Query: 187 YDSLNSSNNVTNVNSRSSSRSNSPTVNLEAKRRIRAGALYKPKPKLPTQSQSNGQQQQQQ 246
           YD L+S + V                          G    P     +    N      +
Sbjct: 235 YDLLDSESLV--------------------------GGTTTPSRGFGSGGGRNESVSTNE 268

Query: 247 QQQQQQQQQQQTQGQVNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDV 306
            + +            ++    + +  L+E     ++E ++ +++G SHR+ A T  N  
Sbjct: 269 LKIR------------DDSKYGVRVMGLREQRCESSEELMKWIRRGDSHRKTAETDYNAR 316

Query: 307 SSRSHTIFTLTLY-KNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLT 365
           SSRSH I  + L   N    T   S ++L DLAGSE   R+  Q +R KE   IN+SLL 
Sbjct: 317 SSRSHAIVLIRLTNTNVIDGTSISSTLSLCDLAGSE---RATGQQERRKEGAFINKSLLA 373

Query: 366 LGRVINSL--------------ADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAK 411
           LG VI+ L              A+ N HIP+R+SKLTR+LQ +L G++    I TI   K
Sbjct: 374 LGTVISKLSAESTAASHGNSPNANGNGHIPYRDSKLTRILQPALSGDSIVTTICTIDTQK 433

Query: 412 INSEETSSTLEYATKAKNI 430
            ++ ET +TL +A++AKN+
Sbjct: 434 ESAAETLNTLRFASRAKNV 452

>ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {ON}
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 778

 Score =  137 bits (344), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 109/374 (29%), Positives = 172/374 (45%), Gaps = 91/374 (24%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  D++F   + Q  V++    P+    + G+N T+  YG T  GKTYT++G        
Sbjct: 128 FVFDRLFDVDSTQKDVYESTMIPLLDSVLDGFNGTVFAYGATGCGKTYTISGS------- 180

Query: 127 LSEAAGIIPRVLFKLFDTLE-VQESDYM-VKCSFIELYNEELKDLLDDGQDSGGNNSRKL 184
             E  GII + + +LF+ +E ++++ +  +  SF+E+YNE ++DLL         +S+KL
Sbjct: 181 -PENPGIIFQAMQELFNRIENLKDTKHFELSLSFLEIYNESIRDLL-----CPETSSKKL 234

Query: 185 RIYDSLNSSNNVTNVNSRSSSRSNSPTVNLEAKRRIRAGALYKPKPKLPTQSQSNGQQQQ 244
            I +  N S  V+N++                         Y P                
Sbjct: 235 VILEDSNESIRVSNLSH------------------------YNP---------------- 254

Query: 245 QQQQQQQQQQQQQTQGQVNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMN 304
              Q+ +       +G +N  +SA           TDA E        L    +   +  
Sbjct: 255 ---QKVEDVMDLVIKGNMNRTTSA-----------TDANEASSRSHAVLQIHIMQHNRTA 300

Query: 305 DVSSRSHTIFTLTLYKNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLL 364
           D+ S  HT  TL++                +DLAGSE  + +  +  R  E  +IN+SLL
Sbjct: 301 DLKS-DHTFATLSI----------------IDLAGSERAATTKNRGNRLYEGANINRSLL 343

Query: 365 TLGRVINSLA-----DKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSS 419
            LG  IN+L       ++ H+P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +
Sbjct: 344 ALGNCINALCLNDGTRRSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLN 403

Query: 420 TLEYATKAKNIKNK 433
           TL+YA +AK IK K
Sbjct: 404 TLKYANRAKEIKTK 417

>Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {ON}
           YGL216W (KIP3) - kinesin-related protein involved in
           mitosis [contig 192] FULL
          Length = 479

 Score =  132 bits (332), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 113/175 (64%), Gaps = 8/175 (4%)

Query: 270 YIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLY---KNFNGET 326
           +++ L+EF ++  ++ L  +++G   R + ST +N+ SSRSHTIFT+++    K+  G  
Sbjct: 169 FVEGLREFDVSSVEDILNYVKQGNEKRMMGSTLVNEYSSRSHTIFTISIKQKEKSALGHV 228

Query: 327 F-RVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAH--IPFR 383
             R S I L+DLAGSE    +     R KE  +IN+SL TLGRVI+ LA +     IP+R
Sbjct: 229 IERHSSIKLIDLAGSERAKAAKTSGDRLKEGSNINKSLSTLGRVISMLAKRKQPKLIPYR 288

Query: 384 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGS 438
           ++ LT +L++SLGGN+KT +IA +SP   + EET STL YAT A+N+K   QL +
Sbjct: 289 DAALTWVLKESLGGNSKTCMIACVSPC--DYEETLSTLRYATLARNVKTCAQLNA 341

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 87/172 (50%), Gaps = 29/172 (16%)

Query: 14  NITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVDKVF 73
           NI VAVR R   E+E+    S++    D    N + +          +  ++++  D+ F
Sbjct: 4   NIKVAVRLRRPLEREVD--ESIIARVED---GNVIQVKDRNQ-----KNETRSFHFDQCF 53

Query: 74  GPS----ADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSE 129
             S    ADQ  ++++++       + GY+  +  YG T +GK++TMTG          E
Sbjct: 54  AYSENIEADQLELYEQLSREYLLHALDGYHTCVFAYGQTGSGKSHTMTGS--------PE 105

Query: 130 AAGIIPRVLFKLFDTLEVQESD-------YMVKCSFIELYNEELKDLLDDGQ 174
           + GI+ R+  +LF+  E+ ES        + ++CS++E+YNE ++DLL  G+
Sbjct: 106 SPGIVSRMCQELFEVREIYESSDDQVNTQFKIRCSYLEIYNETVRDLLGTGR 157

>ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL155C (KIP2)
          Length = 685

 Score =  134 bits (336), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 111/407 (27%), Positives = 179/407 (43%), Gaps = 100/407 (24%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  D VF        V++ +  P+     +GYN T+  YGMT +GKT+TM+G++      
Sbjct: 146 FQFDHVFTKGVCNQEVYQALGVPIIDKLFEGYNATIFAYGMTGSGKTFTMSGNK------ 199

Query: 127 LSEAAGIIPRVLFKLFDTLEVQESD----YMVKCSFIELYNEELKDLLDDGQDSGGNNSR 182
             +  G+IP+ +  +FD +  +       Y VK S++E+YNE                  
Sbjct: 200 --QEPGLIPQCVGNIFDRISSEHHGASLAYEVKVSYLEIYNE------------------ 239

Query: 183 KLRIYDSLNSSNNVTNVNSRSSSRSNSPTVNLEAKRRIRAGALYKPKPKLPTQSQSNGQQ 242
             +IYD LN  +       R +  +  P+ N     +IR  + Y                
Sbjct: 240 --KIYDLLNYVD-------RQAGSTGQPSRNATG-LKIRDDSKY---------------- 273

Query: 243 QQQQQQQQQQQQQQQTQGQVNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTK 302
                                     + +  L E  ++  ++ ++ +  G  +R+   T 
Sbjct: 274 -------------------------GVKVVDLTEQLVSSHEDVMKWIATGDRNRKTGETD 308

Query: 303 MNDVSSRSHTIFTLTLYK-NFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQ 361
            N  SSRSH I  L L + +    +   S ++L DLAGSE   R+  Q  R KE   IN+
Sbjct: 309 FNTRSSRSHAIVLLRLTRYDLKTGSEATSTLSLCDLAGSE---RAVTQIVRRKEGAFINK 365

Query: 362 SLLTLGRVINSLA------------DKNAHIPFRESKLTRLLQDSLGGNTKTALIATISP 409
           SLL LG VI  L+                HIP+R+SKLTR+LQ +L G++    I TI  
Sbjct: 366 SLLALGTVIAKLSMLGSQANGLQPSPAAGHIPYRDSKLTRILQPALTGDSIITTICTIDS 425

Query: 410 AKINSEETSSTLEYATKAKNIK---NKPQLGSFMMKDILVKNISHEL 453
              +S ET++T+ +A++AKNI     K ++ S   KD +++N+  +L
Sbjct: 426 KAESSTETTNTVRFASRAKNIALNVRKNEMDSHAEKDTIIQNLRKQL 472

>Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C
           (REAL)
          Length = 715

 Score =  134 bits (337), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 117/407 (28%), Positives = 176/407 (43%), Gaps = 113/407 (27%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  D VF        V+++ + PM    + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYEKTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 127 LSEAAGIIPRVLFKLFDTLEVQ----ESDYMVKCSFIELYNEELKDLLDDG-QDSGGNNS 181
           L    G+IP  +  LF  +  Q    +  + V  S++E+YNE + DLL+ G ++SG    
Sbjct: 219 L----GLIPLSVSYLFTNIMEQSMNGDKKFDVVISYLEIYNERIYDLLESGLEESGSRLG 274

Query: 182 RKLRIYDSLNSSNNVTNVNSRSSSRSNSPTVNLEAKRRIRAGALYKPKPKLPTQSQSNGQ 241
              R Y                 S++NS  + +E K  IR  + Y               
Sbjct: 275 TPSRSY----------------MSKNNSNALGVELK--IRDDSQY--------------- 301

Query: 242 QQQQQQQQQQQQQQQQTQGQVNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVAST 301
                                      + +  L E     +++ LR +  G   R++  T
Sbjct: 302 --------------------------GVKVIGLTERRCESSEDLLRWIAVGDKSRKIGET 335

Query: 302 KMNDVSSRSHTIFTLTLYK-NFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSIN 360
             N  SSRSH I  + L   +    T R S ++L DLAGSE   R+  Q +R KE   IN
Sbjct: 336 DYNARSSRSHAIVLIRLTSTDVRDGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFIN 392

Query: 361 QSLLTLGRVINSL-ADK------------------------------------NAHIPFR 383
           +SLL LG VI+ L ADK                                    + HIP+R
Sbjct: 393 KSLLALGTVISKLSADKTNSVGSIIPTTPTSSGNSSSSSSSSSGSIVSNSNTSSNHIPYR 452

Query: 384 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNI 430
           +SKLTRLLQ +L G++    I T+      + ET +TL +A++AKN+
Sbjct: 453 DSKLTRLLQPALSGDSIVTTICTVDTRNDAAAETMNTLRFASRAKNV 499

>Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}
           similar to Ashbya gossypii ACR145W
          Length = 687

 Score =  134 bits (336), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 118/412 (28%), Positives = 180/412 (43%), Gaps = 104/412 (25%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  D VF      S V+  +  P+     +GYN T+  YGMT +GKT+TM+G +      
Sbjct: 145 FQFDHVFTKEVTNSEVYMALGQPIVDKLFQGYNATIFAYGMTGSGKTFTMSGTK------ 198

Query: 127 LSEAAGIIPRVLFKLFD-----TLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNS 181
             +  G+IP  +  +FD     T +  E  Y VK S++E+YNE                 
Sbjct: 199 --QDPGLIPLCVGNMFDRVMEETSKSTEHKYEVKVSYLEIYNE----------------- 239

Query: 182 RKLRIYDSLNSSNNVTNVNSRSSSRSNSPTVNLEAKRRIRAGALYKPKPKLPTQSQSNGQ 241
              +IYD L+ +     V SR   R++S         +IR  + Y  K    T+      
Sbjct: 240 ---KIYDLLSITEANGAVASRQLGRNSSGL-------KIRDDSKYGVKVVDLTE------ 283

Query: 242 QQQQQQQQQQQQQQQQTQGQVNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVAST 301
                       QQ ++ G+V                       ++ +  G  +R+   T
Sbjct: 284 ------------QQVESHGEV-----------------------IKWIAAGDKNRKTGET 308

Query: 302 KMNDVSSRSHTIFTLTLYK-NFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSIN 360
             N  SSRSH I  L L +      T   S ++L DLAGSE   R+  Q  R KE   IN
Sbjct: 309 DFNSRSSRSHAIVLLRLTRCELKTGTEVTSTLSLCDLAGSE---RAVTQLVRRKEGAFIN 365

Query: 361 QSLLTLGRVINSL----------------ADKNAHIPFRESKLTRLLQDSLGGNTKTALI 404
           +SLL LG VI  L                +    HIP+R+SKLTR+LQ +L G++    I
Sbjct: 366 KSLLALGTVIAKLSANSAGSGSGSNGQPPSAMGGHIPYRDSKLTRILQPALTGDSIITTI 425

Query: 405 ATISPAKINSEETSSTLEYATKAKNIK---NKPQLGSFMMKDILVKNISHEL 453
            TI     ++ ET++T+ +A++AKNI     K ++ +   KD +++N+  +L
Sbjct: 426 CTIDSKSESNSETTNTVRFASRAKNISLNVRKNEMDTSNEKDSIIQNLRKQL 477

>ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 654

 Score =  130 bits (328), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 111/395 (28%), Positives = 169/395 (42%), Gaps = 91/395 (23%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  D VF  + +   V+ + + PM     +G N T+  YGMT +GKT+TM G E      
Sbjct: 122 FKYDHVFKTACNNVEVYAQTSKPMIDRVFEGLNATVFAYGMTGSGKTFTMAGTE------ 175

Query: 127 LSEAAGIIPRVLFKLFDTLEVQ----ESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSR 182
             E  G+IP  +  L+  +  +    +S + +  S++E+YNE                  
Sbjct: 176 --ETLGLIPLSVAYLYSRVMEESLQGDSRFEIAVSYLEIYNE------------------ 215

Query: 183 KLRIYDSLNSSNNVTNVNSRSSSRSNSPTVNLEAKRRIRAGALYKPKPKLPTQSQSNGQQ 242
             +IYD L+  N +                                KP   T S+     
Sbjct: 216 --KIYDLLDCENEL--------------------------------KPTAATSSRMFAHM 241

Query: 243 QQQQQQQQQQQQQQQTQGQVNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTK 302
             +  +   + + ++      +    + I  L E     + E L+ ++ G   R+   T 
Sbjct: 242 GTRSSKTPVELKLRE------DSKYGVKIVGLTERRCESSDELLKWIRIGDKSRKTGETT 295

Query: 303 MNDVSSRSHTIFTLTLYKNFNGETFRVSK-INLVDLAGSENISRSGAQNQRAKEAGSINQ 361
            N  SSRSH I  + L K    E   VS  ++L DLAGSE   ++   N+R KE   IN+
Sbjct: 296 YNTRSSRSHAIVMIRLTKTDLKEGTSVSSTLSLCDLAGSE---KAVTHNERRKEGAFINK 352

Query: 362 SLLTLGRVINSLADKN-------------AHIPFRESKLTRLLQDSLGGNTKTALIATIS 408
           SLL LG VI+ L+ ++              HIP+R+SKLTR+LQ +L GN     I TI 
Sbjct: 353 SLLALGTVISKLSAESTSHRNGGSSSPVTGHIPYRDSKLTRILQPALSGNGVVTTICTID 412

Query: 409 PAKINSEETSSTLEYATKAKNIK----NKPQLGSF 439
                S ET +TL +A++AKN+      KP L S 
Sbjct: 413 TRPDASSETLNTLRFASRAKNVSLHIFRKPLLPSM 447

>Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar to
           Ashbya gossypii ACR228C - AER441C - ADR145C
          Length = 478

 Score =  126 bits (316), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 112/174 (64%), Gaps = 7/174 (4%)

Query: 270 YIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYK----NFNGE 325
           YI+ L +  +   +E L+ +++G + R VA T +N+ SSRSH I T+ + +    +F   
Sbjct: 173 YIEGLSDRIVNSCEELLKCIEEGSARRSVAGTAVNENSSRSHAICTINIQQTEIDSFGDT 232

Query: 326 TFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-DKNAHIPFRE 384
             RVS I LVDLAGSE    S  +++R KE  +IN+SL+TL RV+  L+ +K   +P+RE
Sbjct: 233 VERVSSIKLVDLAGSERTKVSKTKDERFKEGTNINKSLMTLRRVVTMLSNNKVTGVPYRE 292

Query: 385 SKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGS 438
           S LTR+L+D+L GN+ T ++A ISP   + EE+ STL YA+ AK+++ +  L +
Sbjct: 293 SLLTRVLRDNLDGNSITCILACISPC--DYEESISTLRYASTAKHVRTEAHLNT 344

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 55/184 (29%), Positives = 89/184 (48%), Gaps = 34/184 (18%)

Query: 14  NITVAVRCRGRNEKEIKAKSSVVVNCPDVI---GANEVSINTSGDIGITARMNSKTYTVD 70
           NI VA+R R +  +E           P VI    +NE+++       +   +   T+  D
Sbjct: 4   NIKVAIRIRDKISRETSR--------PSVIKRKTSNEITLQKDNTANVITTVE-HTFYFD 54

Query: 71  KVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSEA 130
           +VF  S++Q  ++ E+A       ++GY+  ++ YG T  GKTYTM G E        + 
Sbjct: 55  QVFDESSNQKQIYHELAREYILKALEGYHTCVIAYGQTGAGKTYTMMGTE--------QE 106

Query: 131 AGIIPRV---LFKLFDTLEVQESD------YMVKCSFIELYNEELKDLLDDGQDSGGNNS 181
            GIIP V   LFK+ D  + +  D      + V  S+ ++YNE++ D+L     SGG N 
Sbjct: 107 PGIIPLVSHELFKIIDMCQDEGPDEDALVHFKVTVSYFQIYNEQIYDML-----SGGCNV 161

Query: 182 RKLR 185
            ++R
Sbjct: 162 LRVR 165

>TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {ON}
           Anc_3.479 YPR141C
          Length = 704

 Score =  126 bits (317), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 115/377 (30%), Positives = 167/377 (44%), Gaps = 95/377 (25%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  D++F        VF+EI   +    + GYN  +  YG T +GKTYTM          
Sbjct: 403 FKFDRIFNEKETNYDVFQEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM---------- 451

Query: 127 LSEAAGIIPRVLFKLFD---TLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRK 183
           L+   GIIP  +  +F+    L+ +   Y V C F+E+YNE + DLL   +   G+ S  
Sbjct: 452 LNPTDGIIPATITHIFNWTKNLKERGWRYDVSCQFVEIYNETIADLLRREEKPAGSASG- 510

Query: 184 LRIYDSLNSSNNVT---NVNSRSSSRSNSPTVNLEAKRRIRAGALYKPKPKLPTQSQSNG 240
               D  NS+  +    N  ++ ++ +N  TV L +K  +    L K   KL + + +  
Sbjct: 511 ----DDTNSNTKLEIRHNQETKETTITNVTTVPLTSKNTV--DELLKRANKLRSTAST-- 562

Query: 241 QQQQQQQQQQQQQQQQQTQGQVNEQSS---AIYIQHLQEFHITDAKEGLRLLQKGLSHRQ 297
                                 NE+SS   +I+I HL          G  +L        
Sbjct: 563 --------------------ACNERSSRSHSIFIVHLS---------GENVL-------- 585

Query: 298 VASTKMNDVSSRSHTIFTLTLYKNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAG 357
                      RSH I                  +NLVDLAGSE I+ S    +R +E  
Sbjct: 586 --------TGERSHGI------------------LNLVDLAGSERINTSQVIGERLRETQ 619

Query: 358 SINQSLLTLGRVINSLADKNA---HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINS 414
           SIN+SL  LG VI++L   +A   HIPFR SKLT LLQ SL GN+KT +   IS    ++
Sbjct: 620 SINKSLSCLGDVIHALGSADASKRHIPFRNSKLTYLLQYSLTGNSKTLMFVNISGNPNHT 679

Query: 415 EETSSTLEYATKAKNIK 431
            ET ++L +A+K  + K
Sbjct: 680 NETLNSLRFASKVNSTK 696

>Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {ON}
           YPL155C (REAL)
          Length = 704

 Score =  126 bits (316), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 114/400 (28%), Positives = 175/400 (43%), Gaps = 105/400 (26%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  D VF        V++  + PM    + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FEFDHVFASHCTNLEVYERTSKPMIDKLLVGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 127 LSEAAGIIPRVLFKLF-DTLEVQ---ESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSR 182
           L    G+IP  +  LF + +E+    +  + V  S++E+YNE + DLL+ G +       
Sbjct: 219 L----GLIPLSVSYLFSNVMELSMNGDKKFDVIISYLEIYNERIYDLLESGLEE------ 268

Query: 183 KLRIYDSLNSSNNVTNVNSRSSSRSNSPTVNLEAKRRIRAGALYKPKPKLPTQSQSNGQQ 242
                               S SR ++P+       R+  G           +  SNG  
Sbjct: 269 --------------------SLSRPSTPS-------RLYMG-----------KGNSNGLS 290

Query: 243 QQQQQQQQQQQQQQQTQGQVNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTK 302
            + + +   Q                + +  L E     ++E L+ +  G   R++  T 
Sbjct: 291 AELKIRDDTQY--------------GVKVIGLTERRCESSEELLKWIAIGDKSRKIGETD 336

Query: 303 MNDVSSRSHTIFTLTLYK-NFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQ 361
            N  SSRSH I  + L   +    T R S ++L DLAGSE   R+  Q +R KE   IN+
Sbjct: 337 YNARSSRSHAIVLIRLTSTDLESGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINK 393

Query: 362 SLLTLGRVINSL-ADK------NAHIP------------------------FRESKLTRL 390
           SLL LG VI+ L ADK      N H                          +R+SKLTRL
Sbjct: 394 SLLALGTVISKLSADKINPTGSNIHTTPTNTGSSSSGTVTSNNNIPNNHIPYRDSKLTRL 453

Query: 391 LQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNI 430
           LQ +L G++    I T+      + ET +TL +A++AKN+
Sbjct: 454 LQPALSGDSIVTTICTVDTRNDAAAETINTLRFASRAKNV 493

>KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {ON}
           Anc_3.528 YGL216W
          Length = 672

 Score =  123 bits (308), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 79/212 (37%), Positives = 128/212 (60%), Gaps = 20/212 (9%)

Query: 264 EQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTL---TLYK 320
           +Q+S I + +L      + ++ + L+ +G  +R  + T+ N+VSSRSH++  +    + K
Sbjct: 206 DQNSKISVTNLSYHRPENVQDVIDLVIRGNLNRSSSPTEANEVSSRSHSVLQIHVKQVLK 265

Query: 321 NFN--GETFRV-SKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA--D 375
           NF+  G T ++ S ++++DLAGSE    +  +  R  E  +IN+SLL LG  IN+L    
Sbjct: 266 NFDDIGSTNQIDSTLSIIDLAGSERAITTKNRGIRLYEGANINKSLLALGNCINALCINK 325

Query: 376 KNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKP- 434
           K+ HIP+R+SKLTRLL+ SLGGN KT +I  +SP+ ++ +ET +TL+YA +AK IK K  
Sbjct: 326 KSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSLHYDETLNTLKYANRAKEIKTKVI 385

Query: 435 --------QLGSFMMKDILVKNISHELAKLKS 458
                    +GS++    L+     E+ KLK+
Sbjct: 386 RNQTSLNRHVGSYLK---LITEQKQEIDKLKA 414

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 70/138 (50%), Gaps = 18/138 (13%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  DK+F   + Q  +F++   P+    + G+N T+  YG T  GKTYT+ G        
Sbjct: 92  FIFDKLFDDDSTQEQIFEDTTRPLLDSVLDGFNGTVFAYGATGCGKTYTING-------- 143

Query: 127 LSEAAGIIPRVLFKLFDTLEV-----QESDYMVKCSFIELYNEELKDLLDDGQDSGGNNS 181
            SE  GII R + +LF  +E+       S   +  S++E+YNE ++DLL          S
Sbjct: 144 TSEDPGIIFRTMNELFGKIEILLQDSNRSKIEISLSYLEIYNETIRDLL-----KPETPS 198

Query: 182 RKLRIYDSLNSSNNVTNV 199
           +KL I +  NS  +VTN+
Sbjct: 199 KKLIIREDQNSKISVTNL 216

>Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON}
           (54983..56503) [1521 nt, 507 aa]
          Length = 506

 Score =  118 bits (295), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 73/192 (38%), Positives = 108/192 (56%), Gaps = 22/192 (11%)

Query: 268 AIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYK-----NF 322
           ++YI+++ E  +++  + ++ ++ G  +R   ST MN  SSRSH I ++T+ +     N 
Sbjct: 188 SMYIENITEIEVSNIDQMIKCVKMGFRNRTTRSTNMNVNSSRSHAIVSITIKRTDIDLNT 247

Query: 323 NGETFRVSKINLVDLAGSE-NISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK----- 376
           N      S    VDLAGSE + +     N R KE  SIN+SL TL RV+ SL  +     
Sbjct: 248 NSSIISDSICRFVDLAGSERSTATQNCHNDRLKEGNSINKSLSTLRRVLTSLKKREELKY 307

Query: 377 ---------NAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKA 427
                    N  +PFRES LT +L+D+LGGN+KT +IA ISP   N EE++STL YA  A
Sbjct: 308 NSNSNSSAHNIVVPFRESLLTWILKDNLGGNSKTCIIACISPT--NFEESASTLRYADIA 365

Query: 428 KNIKNKPQLGSF 439
           + IK    + ++
Sbjct: 366 QTIKTNSIINTY 377

 Score = 80.1 bits (196), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 43/114 (37%), Positives = 59/114 (51%), Gaps = 16/114 (14%)

Query: 68  TVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGEL 127
             D+ FG    QS  +K   +    D + GYNC +L YG T +GKTYTM G+ K      
Sbjct: 62  CFDEGFGKINSQSEFYKGSINHFVKDALNGYNCCILAYGQTGSGKTYTMMGESK------ 115

Query: 128 SEAAGIIPRVLFKLFDTLE----------VQESDYMVKCSFIELYNEELKDLLD 171
           ++  G+IPR    LF  +E           Q S+Y V CS  E+YNE++ DLL+
Sbjct: 116 NDTRGVIPRFCEDLFHEIESIKIKDSSDLSQRSEYKVVCSIFEIYNEQIIDLLE 169

>Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]
           {ON} YGL216W (KIP3) - 1:1 [contig 188] FULL
          Length = 819

 Score =  118 bits (296), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 107/174 (61%), Gaps = 9/174 (5%)

Query: 269 IYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLY-KNFNGET- 326
           I + +L    ++  ++ + L+ KG ++R  ++T  N+ SSRSH +  + +  +N   E  
Sbjct: 241 ITVANLSHHPLSTVEDVMDLVIKGNTNRTTSATDANETSSRSHAVLQVHITQRNRTAELT 300

Query: 327 --FRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-----DKNAH 379
              + + ++L+DLAGSE  S +  + +R  E  +IN+SLL LG  IN+L          H
Sbjct: 301 EDHKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCVSGRKRGGYH 360

Query: 380 IPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 433
           +P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YAT+AK IK K
Sbjct: 361 VPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSNHYDETLNTLKYATRAKEIKTK 414

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 61/113 (53%), Gaps = 10/113 (8%)

Query: 61  RMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDE 120
           R   + +  D+VF   + Q  V++    P+    + G+N T+  YG T  GKTYT++G  
Sbjct: 119 RSGEQKFVFDRVFDMDSSQIEVYEATTRPLLDSVLDGFNGTVFAYGATGCGKTYTVSGT- 177

Query: 121 KLYDGELSEAAGIIPRVLFKLFDTL-EVQESD-YMVKCSFIELYNEELKDLLD 171
                   E  GII   + +LF  + E+Q++  + +  S++E+YNE ++DLL+
Sbjct: 178 -------PENPGIIFLTMQELFAKMEELQDTKRFELSASYLEIYNETIRDLLE 223

>Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  118 bits (295), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 69/177 (38%), Positives = 108/177 (61%), Gaps = 12/177 (6%)

Query: 267 SAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKN----- 321
           S I + +L   H T  ++ + L+ +G  +R  + T+ N+VSSRSH +  + + +      
Sbjct: 267 SHIKVANLSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNKLVD 326

Query: 322 -FNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA----DK 376
             +  TF  + ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L      +
Sbjct: 327 LTSQHTF--ATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGSR 384

Query: 377 NAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 433
           + HIP+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 385 SCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 70.9 bits (172), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 58/106 (54%), Gaps = 10/106 (9%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  DK+F  ++ QS V+KE   P+    + G+N T+  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQSRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 205

Query: 127 LSEAAGIIPRVLFKLFDTLE--VQESDYMVKCSFIELYNEELKDLL 170
                GII   + +LF+ +     E ++ +  S++E+YNE ++DLL
Sbjct: 206 -PSQPGIIFLAMEELFNKIADLRDEKNFEISLSYLEIYNERIRDLL 250

>Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  118 bits (295), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 107/175 (61%), Gaps = 12/175 (6%)

Query: 269 IYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKN------F 322
           I + +L   H T  ++ + L+ +G  +R  + T+ N+VSSRSH++  + + +        
Sbjct: 269 IKVANLSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHSVLQIHIMQTNKLVDLT 328

Query: 323 NGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA----DKNA 378
           +  TF  + ++++DLAGSE  S +  +  R  E  +IN+SLL LG  IN+L      +  
Sbjct: 329 SQHTF--ATLSIIDLAGSERASATRNRGIRLHEGANINRSLLALGNCINALCLNDGSRTC 386

Query: 379 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 433
           HIP+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 387 HIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 67.8 bits (164), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 56/106 (52%), Gaps = 10/106 (9%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  DK+F  ++ Q  V+KE   P+    + G+N T+  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQVRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 205

Query: 127 LSEAAGIIPRVLFKLFDTLE--VQESDYMVKCSFIELYNEELKDLL 170
                GII   + +LF+ +     E ++ +  S++E+YNE + DLL
Sbjct: 206 -PSQPGIIFLAMEELFNKISDLKDEKNFEISLSYLEIYNERISDLL 250

>Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  117 bits (294), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 68/175 (38%), Positives = 106/175 (60%), Gaps = 12/175 (6%)

Query: 269 IYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKN------F 322
           I + +L   H T  ++ + L+ +G  +R  + T+ N+VSSRSH +  + + +        
Sbjct: 269 IKVANLSYHHPTTVEDVMNLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNKLVDLT 328

Query: 323 NGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA----DKNA 378
           +  TF  + ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L      +  
Sbjct: 329 SQHTF--ATLSVIDLAGSERAAATRNRGLRLHEGANINRSLLALGNCINALCLNDGSRTC 386

Query: 379 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 433
           HIP+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 387 HIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 71.2 bits (173), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 59/106 (55%), Gaps = 10/106 (9%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  DK+F  ++ Q+ V+KE   P+    + GYN T+  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQTQVYKETTSPLLDSVLDGYNSTVFAYGATGCGKTYTVSGT------- 205

Query: 127 LSEAAGIIPRVLFKLFDTLE--VQESDYMVKCSFIELYNEELKDLL 170
                G+I   + +LF+ ++    E ++ +  S++E+YNE ++DLL
Sbjct: 206 -PSQPGVIFLAMEELFNKIDDLKDEKNFEISLSYLEIYNERIRDLL 250

>NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}
           Anc_3.528
          Length = 784

 Score =  116 bits (291), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 67/164 (40%), Positives = 104/164 (63%), Gaps = 14/164 (8%)

Query: 282 AKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYK-----NFNGE-TFRVSKINLV 335
            +E + L+ KG  +R  + T+ N+VSSRSH +  + + +     +   E TF  + ++++
Sbjct: 280 VQEVIDLVIKGNINRTTSPTEANEVSSRSHAVLQIHIMQTNRTADLTSEHTF--ATLSII 337

Query: 336 DLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA------DKNAHIPFRESKLTR 389
           DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L       +++ HIP+R+SKLTR
Sbjct: 338 DLAGSERAAATKNRGERLYEGANINRSLLALGNCINALCLTDGGTNRSCHIPYRDSKLTR 397

Query: 390 LLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 433
           LL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 398 LLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 60/106 (56%), Gaps = 10/106 (9%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  DK+F   A Q  V++     +    + G+N T+  YG T  GKTYT++G        
Sbjct: 151 FVFDKLFDQDASQETVYQSTTSGLLDSVLDGFNGTVFAYGATGCGKTYTVSGT------- 203

Query: 127 LSEAAGIIPRVLFKLFDTLE-VQESD-YMVKCSFIELYNEELKDLL 170
             E  GII RV+ +LF+ +E ++++  + +  S++E+YNE ++DLL
Sbjct: 204 -PEQPGIIFRVMQELFERMEDLKDTKRFELSLSYLEIYNETIRDLL 248

>ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1
          Length = 478

 Score =  114 bits (284), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 71/178 (39%), Positives = 107/178 (60%), Gaps = 11/178 (6%)

Query: 270 YIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTL-YKNFNGETFR 328
           +++ L+E  + + +E +  + KG  +R V ST MN  SSRSH IF +++  K  + +T  
Sbjct: 179 FVEGLEEIAVHNVEELISCIHKGNENRTVRSTNMNQESSRSHAIFHISVNQKETHKKTGT 238

Query: 329 V----SKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD----KNAHI 380
           V    S   LVDLAGSE +  + A  +  +E  SIN+SL  LGRVI+ LA+    ++  I
Sbjct: 239 VVECHSTCKLVDLAGSERLGSAAADGKIRQEGTSINKSLSILGRVISLLAEGDRQRSQMI 298

Query: 381 PFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGS 438
           P+RES LT +L+++LGGN+ T L+A +SP   N  E+ STL YA+  K +K    + S
Sbjct: 299 PYRESALTWILKENLGGNSNTCLVACVSPE--NYYESLSTLRYASLTKKVKTNATINS 354

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 65/120 (54%), Gaps = 21/120 (17%)

Query: 64  SKTYTVDKVFGPS----ADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGD 119
           +K +  D  FG +     DQS++++ +        ++GYN  +L YG T +GKT+TM G+
Sbjct: 49  AKEFRYDHCFGSTDSVDRDQSIIYESLVRGYVLHTLEGYNSCILAYGQTGSGKTFTMMGE 108

Query: 120 EKLYDGELSEAAGIIPRVLFKLFDTLEV-----QES----DYMVKCSFIELYNEELKDLL 170
           +           GI+PR   +LF+   +     QES    D+ VKCSF E+YNE++ DLL
Sbjct: 109 KG--------NEGIVPRFCRELFEVFHMCHQDDQESDIITDFQVKCSFFEIYNEQVIDLL 160

>KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528
           YGL216W
          Length = 723

 Score =  115 bits (289), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 114/415 (27%), Positives = 211/415 (50%), Gaps = 63/415 (15%)

Query: 286 LRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKN------FNGETFRVSKINLVDLAG 339
           L L+ +G  +R  + T+ N VSSRSH +  + + +          +TF    ++++DLAG
Sbjct: 276 LDLVIRGNDNRTTSPTEANSVSSRSHAVLQIHIMQRNKLVDLKEHQTF--GTLSIIDLAG 333

Query: 340 SENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD-----KNAHIPFRESKLTRLLQDS 394
           SE  + +  + +R  E  +IN+SLL LG  IN+L       +N H+P+R+SKLTRLL+ S
Sbjct: 334 SERAAATKNRGRRLHEGANINRSLLALGNCINALCSNDGSHRNQHVPYRDSKLTRLLKFS 393

Query: 395 LGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMKDILVKNISHELA 454
           LGGN KT +I  ISP+  + +ET +TL+YA +AK IK K           +++N    L 
Sbjct: 394 LGGNCKTVMIVCISPSSAHYDETLNTLKYANRAKEIKTK-----------VIRN-HQTLN 441

Query: 455 KLKSDFLSTKSKEGIYMSHLHYNE---VMNDIENYKTEIQESRREIEKLSSQNQLLHKDK 511
           +  + +L   +++   +  L   +   V   I NYK  I++  R IE++       +  K
Sbjct: 442 RHVASYLKMITEQKRTIDELEARQAQMVQVGITNYKLAIEKIERSIEEVVG-----NVCK 496

Query: 512 KSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTN------MIMKLKDAVRNMQG 565
           + S  + ++ +L ++ L  +   L + I ++ +N + + +      +I   +  +R MQ 
Sbjct: 497 QLSSKSFQNIKL-LKALTLTKRTLLQLIVIEVENVLAIVSEWTDQRIIETCERVIRQMQE 555

Query: 566 ALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQALEQSFTIDDDIN--NVKD 623
            +K  ED   R  +  +  L   ++E+ R+I+ K        L +    DD ++  + + 
Sbjct: 556 QVKLLED---RFDTATELNL---VVEHSREIDLK-------RLREMEHWDDTVHLRSFEA 602

Query: 624 SLETLLETVKKDAIIMCENLAQKVVGDQPKF---FN----SMLSELNDMFSKVDE 671
            L+ + E+++K  +I   N+ ++++ D P     FN     ++SE  D+ + ++E
Sbjct: 603 RLDLVYESLQKSILIESSNMTEELMND-PALRARFNFLSKVLVSEDQDIVAALEE 656

 Score = 65.1 bits (157), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 47/158 (29%), Positives = 74/158 (46%), Gaps = 16/158 (10%)

Query: 59  TARMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTG 118
           T   +   +  DK+F     Q  V++     +    + G+N T+  YG T  GKTYT++G
Sbjct: 135 TGSADETKFVFDKLFDTDVSQEDVYRGTTSTLLDSVLDGFNGTVFAYGATGCGKTYTVSG 194

Query: 119 DEKLYDGELSEAAGIIPRVLFKLFDTLEVQES--DYMVKCSFIELYNEELKDLLDDGQDS 176
                     E  GII R + +LF  ++      D+ +  SF+E+YNE + DLL     S
Sbjct: 195 TR--------ENPGIIFRTMEELFVKMDALAGTKDFELTVSFLEIYNETIHDLL-----S 241

Query: 177 GGNNSRKLRIYDSLNSSNNVTNVNSRSSSRSNSPTVNL 214
                +KL I +  N   +V+N+ S  S RS    ++L
Sbjct: 242 PDTPPQKLVIREDSNEKISVSNL-SYHSPRSVQDVLDL 278

>KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 819

 Score =  116 bits (290), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 69/174 (39%), Positives = 104/174 (59%), Gaps = 9/174 (5%)

Query: 269 IYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLY-KNFNGET- 326
           I + +L    +   ++ + L+ KG  +R  ++T  N+ SSRSH +  + +  KN   E  
Sbjct: 241 ITVANLSHHPLFTVEDVMDLVVKGNINRTTSATDANETSSRSHAVLQVHITQKNRTAELT 300

Query: 327 --FRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-----DKNAH 379
              + + ++L+DLAGSE  S +  + +R  E  +IN+SLL LG  IN+L          H
Sbjct: 301 EDHKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCAGGKRGGGFH 360

Query: 380 IPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 433
           +P+R+SKLTRLL+ SLGGN KT +I  ISP   + +ET +TL+YAT+AK IK K
Sbjct: 361 VPYRDSKLTRLLKFSLGGNCKTVMIVCISPTSNHYDETLNTLKYATRAKEIKTK 414

 Score = 67.8 bits (164), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 60/114 (52%), Gaps = 12/114 (10%)

Query: 61  RMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDE 120
           R   + +  D+VF   A Q  V++    P+    + G+N T+  YG T  GKTYT++G  
Sbjct: 119 RSGEQKFVFDRVFDMHASQEEVYEATTRPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT- 177

Query: 121 KLYDGELSEAAGIIPRVLFKLFDTLEVQESD---YMVKCSFIELYNEELKDLLD 171
                  +E  GII   + +LF  +E Q  D   + +  S++E+YNE ++DLL+
Sbjct: 178 -------AENPGIIFLTMQELFAKME-QLKDTKKFELTASYLEIYNESIRDLLE 223

>TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa]
           {ON} Anc_3.528 YGL216W
          Length = 733

 Score =  115 bits (288), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 100/157 (63%), Gaps = 13/157 (8%)

Query: 288 LLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKN------FNGETFRVSKINLVDLAGSE 341
           L+  G ++R  ++T  N+ SSRSH +  + + ++       +  TF  +K++++DLAGSE
Sbjct: 264 LVVLGNTNRTTSATDANETSSRSHAVLQINIVQSSRTAEITSDHTF--AKLSIIDLAGSE 321

Query: 342 NISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-----DKNAHIPFRESKLTRLLQDSLG 396
             + +  + +R +E  +IN+SLL LG  IN+L       +  H+P+R+SKLTRLL+ SLG
Sbjct: 322 RAASTKNRGERLQEGANINRSLLALGNCINALCISDGTRRTCHVPYRDSKLTRLLKFSLG 381

Query: 397 GNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 433
           GN KT +I  +SP+  + +ET +TL+YA +AK IK K
Sbjct: 382 GNCKTVMIVCVSPSSTHYDETLNTLKYANRAKEIKTK 418

 Score = 62.0 bits (149), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 54/106 (50%), Gaps = 10/106 (9%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  DK+F  +A Q  V+      +    + G+N T+  YG T  GKTYT++G        
Sbjct: 129 FVFDKLFDENATQEEVYSGTTSELLDAVLDGFNGTVFAYGATGCGKTYTVSGT------- 181

Query: 127 LSEAAGIIPRVLFKLFDTLEVQES--DYMVKCSFIELYNEELKDLL 170
             E  G+I   + +LF  +E  E    + +  S++E+YNE ++DLL
Sbjct: 182 -PERPGVIFLAMQELFARMEELEDTRKFEISVSYLEIYNETIRDLL 226

>CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216w KIP3
           kinesin-related protein required for nuclear migration
          Length = 705

 Score =  115 bits (287), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 68/175 (38%), Positives = 103/175 (58%), Gaps = 10/175 (5%)

Query: 269 IYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLY-KNFNG--- 324
           I + +L +   T  +E + L+ +G  +R  + T+ N+VSSRSH +  + +  KN      
Sbjct: 272 ITVANLSQHFPTTVQEVMDLVIRGNFNRTTSPTEANEVSSRSHAVLQIHIVQKNRTPDIK 331

Query: 325 ETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA------DKNA 378
           E      ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L           
Sbjct: 332 EEHTFGTLSIIDLAGSERAAATKNRGARLHEGANINRSLLALGNCINALCINGNDERPRC 391

Query: 379 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 433
           H+P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 392 HVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 446

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 54/106 (50%), Gaps = 10/106 (9%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  DK+F   A Q  V++     +    + G+N T+  YG T  GKTYT++G        
Sbjct: 156 FVFDKLFDTDATQREVYQSTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSG-------- 207

Query: 127 LSEAAGIIPRVLFKLFDTLE--VQESDYMVKCSFIELYNEELKDLL 170
             E  GI+ + + +LF  +E       + +  SF+E+YNE ++DLL
Sbjct: 208 TPENPGIVFQAMEELFQKMEDLKDTKSFQISLSFLEIYNERIRDLL 253

>YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}
           KIP3Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 805

 Score =  115 bits (287), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 67/175 (38%), Positives = 106/175 (60%), Gaps = 12/175 (6%)

Query: 269 IYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKN------F 322
           I + +L   H    ++ + L+ +G  +R  + T+ N+VSSRSH +  + + +        
Sbjct: 269 IKVANLSYHHPNTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNKLVDLT 328

Query: 323 NGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA----DKNA 378
           +  TF  + ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L      ++ 
Sbjct: 329 SQHTF--ATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGSRSC 386

Query: 379 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 433
           HIP+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 387 HIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 58/106 (54%), Gaps = 10/106 (9%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  DK+F  ++ Q+ V+KE   P+    + G+N T+  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDETSSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 205

Query: 127 LSEAAGIIPRVLFKLFDTLE--VQESDYMVKCSFIELYNEELKDLL 170
                GII   + +LF+ +     E D+ +  S++E+YNE ++DLL
Sbjct: 206 -PSQPGIIFLAMEELFNKITDLKDEKDFEISLSYLEIYNERIRDLL 250

>TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {ON}
           Anc_3.479 YPR141C
          Length = 739

 Score =  114 bits (285), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 74/182 (40%), Positives = 105/182 (57%), Gaps = 15/182 (8%)

Query: 264 EQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFN 323
           +QS   Y+ +++ F I +  + + L+ K    R  +ST +N  SSRSH IF + L + +N
Sbjct: 557 DQSKITYVTNIKRFKIENISDTIGLINKSKIKRMTSSTGLNSHSSRSHGIFIIYL-EGYN 615

Query: 324 GETFR--VSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL-------- 373
            +T    +SK+NLVDLAGSE I+ S  Q  R KE  SIN+SL  LG VI++L        
Sbjct: 616 HKTNEKCISKLNLVDLAGSERINFSKVQGDRLKETQSINKSLSCLGDVIHALNRGNKNHL 675

Query: 374 ----ADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKN 429
                 K  HIPFR SKLT LL+ SL G++KT +   +S  + +  ET ++L +ATK  N
Sbjct: 676 NSNDLQKTRHIPFRNSKLTYLLKYSLIGDSKTLMFVNVSSNEAHLNETINSLRFATKVNN 735

Query: 430 IK 431
            K
Sbjct: 736 TK 737

 Score = 74.7 bits (182), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 55/164 (33%), Positives = 81/164 (49%), Gaps = 18/164 (10%)

Query: 63  NSKTYTV--DKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDE 120
           N+ TY+   D VF      S VF EI + +    + GYN  +  YG T +GKTYTM    
Sbjct: 438 NNATYSFEFDHVFKQDEGNSEVFNEI-EQLIQSALDGYNVCIFAYGQTGSGKTYTM---- 492

Query: 121 KLYDGELSEAAGIIP---RVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSG 177
                 L+   G+IP   + +F   D+L+    +Y V C FIELYNE + DL  D   + 
Sbjct: 493 ------LNPNDGVIPMTIKYIFNSMDSLKKNGWEYNVSCEFIELYNENIIDLFRDNGPTK 546

Query: 178 GNNSRKLRIYDSLNSSNNVTNVNSRSSSRSNSPTVNLEAKRRIR 221
            + S ++R +D  +    VTN+  R    + S T+ L  K +I+
Sbjct: 547 DSISHEIR-HDDQSKITYVTNI-KRFKIENISDTIGLINKSKIK 588

>NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {ON}
           Anc_3.528
          Length = 868

 Score =  114 bits (285), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 69/185 (37%), Positives = 111/185 (60%), Gaps = 17/185 (9%)

Query: 264 EQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYK--- 320
           ++ S I + +L   +    ++ + L+ +G  +R  +ST+ N+VSSRSH +  + + +   
Sbjct: 302 DKDSKISVSNLSYHYPKSVQDVIDLVIRGNINRSTSSTEANEVSSRSHAVLQIHIMQTNT 361

Query: 321 --NFNGE-TFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA--- 374
             +   E TF  + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L    
Sbjct: 362 KIDLTSEHTF--ATLSIIDLAGSERAAATKNRGERLYEGANINKSLLALGNCINALCIPT 419

Query: 375 ------DKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAK 428
                 +   HIP+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK
Sbjct: 420 NNTRRRNIRYHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAK 479

Query: 429 NIKNK 433
            IK K
Sbjct: 480 EIKTK 484

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 37/113 (32%), Positives = 60/113 (53%), Gaps = 10/113 (8%)

Query: 60  ARMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGD 119
           A+ N   +  DK+F  ++ Q  V+      +    + G+N T+  YG T  GKTYT++G 
Sbjct: 184 AKKNEMKFVFDKIFDENSSQDEVYLGTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSGT 243

Query: 120 EKLYDGELSEAAGIIPRVLFKLFDTLE--VQESDYMVKCSFIELYNEELKDLL 170
           +        E  GII RV+ +LF+ +E    E  + +  S++E+YNE + DLL
Sbjct: 244 Q--------ENPGIIFRVMQELFERMEDLKDEKTFQLSISYLEIYNEMIYDLL 288

>SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 809

 Score =  113 bits (283), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 65/156 (41%), Positives = 96/156 (61%), Gaps = 12/156 (7%)

Query: 288 LLQKGLSHRQVASTKMNDVSSRSHTIFTLTLY-KNFNGE-----TFRVSKINLVDLAGSE 341
           L+ +G  +R  + T  N+ SSRSH +  + +  KN   E     TF  + ++++DLAGSE
Sbjct: 271 LVVRGNMNRTTSPTDANETSSRSHAVLQINVVQKNRTAELSEAHTF--ATLSIIDLAGSE 328

Query: 342 NISRSGAQNQRAKEAGSINQSLLTLGRVINSLA----DKNAHIPFRESKLTRLLQDSLGG 397
             S +  + +R  E  +IN+SLL LG  IN+L         H+P+R+SKLTRLL+ SLGG
Sbjct: 329 RASATKNRGERLHEGANINRSLLALGNCINALCVSGRRSTCHVPYRDSKLTRLLKFSLGG 388

Query: 398 NTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 433
           N KT +I  I+P+  + +ET +TL+YA +AK IK K
Sbjct: 389 NCKTVMIVCIAPSSAHYDETLNTLKYANRAKEIKTK 424

 Score = 65.1 bits (157), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 61/112 (54%), Gaps = 10/112 (8%)

Query: 61  RMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDE 120
           R   + +  DK+F   A Q+ V++    P+    + G+N T+  YG T  GKT+T++G  
Sbjct: 130 RSGEQKFVFDKLFDEDATQTEVYESTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISGT- 188

Query: 121 KLYDGELSEAAGIIPRVLFKLFDTLE-VQESDYM-VKCSFIELYNEELKDLL 170
                   E  G+I   + +LF  +E +++S +  +  S++E+YNE ++DLL
Sbjct: 189 -------PEQPGVIFLTMQELFQRIEDLKDSKHFDLTLSYLEIYNESIRDLL 233

>Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar to
           Ashbya gossypii AER441C
          Length = 833

 Score =  112 bits (281), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 93/307 (30%), Positives = 163/307 (53%), Gaps = 36/307 (11%)

Query: 288 LLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGETFRVSK----INLVDLAGSENI 343
           L+ KG  +R  + T  N+ SSRSH +  + + ++      +  K    ++++DLAGSE  
Sbjct: 265 LVIKGNINRTTSPTDANETSSRSHAVLQIHVVQSSRSVDLKEDKTYATLSIIDLAGSERA 324

Query: 344 SRSGAQNQRAKEAGSINQSLLTLGRVINSLADKN----AHIPFRESKLTRLLQDSLGGNT 399
           S +  + +R  E  +IN+SLL LG  IN+L         H+P+R+SKLTRLL+ SLGGN 
Sbjct: 325 SATKNRGERLHEGSNINKSLLALGNCINALCMTGRRTYCHVPYRDSKLTRLLKFSLGGNC 384

Query: 400 KTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMKDILVKNISHELAKLKSD 459
           KT +I  +SP+  + +ET +TL+YA +AK+IK K           +++N  H L +    
Sbjct: 385 KTVMIVCVSPSSAHYDETLNTLKYANRAKDIKTK-----------VIRN-QHSLDRHVGS 432

Query: 460 FLSTKSKEGIYMSHLHYNEV-MND--IENYK---TEIQESRRE-IEKLSSQNQLLHKDKK 512
           +L   + +   +  L   E  M D  ++ YK    ++Q +  E + +L S  Q+L + ++
Sbjct: 433 YLKMITSQKQEIDELRNREAKMIDLRLQQYKLSRNKLQMAMWEAVNQLKSNYQVLERFQR 492

Query: 513 SSQDTIESQRLQIRN----LQSSMDYLYEKI---DLKHKNEIELTNMIMKLKDAVRNMQG 565
           +   TI+S  L  R+    +QS + +L + +   D++H   +    +  +LK  +R ++ 
Sbjct: 493 AK--TIKSLMLCKRHFLQLVQSEVSHLLQLMDSSDIEHPLILFCRTVSEQLKTKIRELED 550

Query: 566 ALKTHED 572
           +  T +D
Sbjct: 551 SFDTDDD 557

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 77/158 (48%), Gaps = 16/158 (10%)

Query: 46  NEVSINTSGDIGITARMNS-KTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLV 104
           N + + + G+I    R N  + +  DK+F   A Q  VF     P+    I G+N T+  
Sbjct: 108 NTMLVGSRGEIRRRMRRNGEQKFMFDKLFDVEATQQDVFLGTTRPLLDSIIDGFNGTVFA 167

Query: 105 YGMTSTGKTYTMTGDEKLYDGELSEAAGIIPRVLFKLFDTLE--VQESDYMVKCSFIELY 162
           YG T  GKT+T++G          E  GII   + +LF  +E       + +  S++E+Y
Sbjct: 168 YGATGCGKTFTISGT--------PENPGIIFLTMQELFQRIENLKDTKTFQLTVSYLEIY 219

Query: 163 NEELKDLLDDGQDSGGNNSRKLRIYDSLNSSNNVTNVN 200
           NE ++DLL+         S+KL I +  +++  V N++
Sbjct: 220 NEMIRDLLE-----PDTPSQKLIIREDTDNTTTVANLS 252

>TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {ON}
           Anc_3.528 YGL216W
          Length = 847

 Score =  112 bits (279), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 102/176 (57%), Gaps = 13/176 (7%)

Query: 269 IYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKN------F 322
           I + +L        +E +  + +G  +R  + T  N+ SSRSH +  + + +        
Sbjct: 244 ITVSNLSHHKPQTVQEVMDFVIRGNMNRTTSPTDANETSSRSHAVLQIHIAQTDRTPDLI 303

Query: 323 NGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-----DKN 377
           +  TF  + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L       + 
Sbjct: 304 SNSTF--ATLSIIDLAGSERAASTKNRGERLIEGANINKSLLALGNCINALCISDGTRRT 361

Query: 378 AHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 433
            H+P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL YA +AK+IK K
Sbjct: 362 CHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLTYANRAKDIKTK 417

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 57/107 (53%), Gaps = 10/107 (9%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  DK+F  +A+Q+ V+      +    + G+N T+  YG T  GKT+T++G        
Sbjct: 128 FVFDKLFDETANQTNVYNSTTSSLLDSVLDGFNGTVFAYGATGCGKTFTISGT------- 180

Query: 127 LSEAAGIIPRVLFKLFDTLEVQES--DYMVKCSFIELYNEELKDLLD 171
             E  GII   + +LF  +E  +   +  +  S++E+YNE ++DLL+
Sbjct: 181 -PEQPGIIFLTMDELFKRIESLKDTKNIELTLSYLEIYNETIRDLLN 226

>Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON}
           (11134..13554) [2421 nt, 807 aa]
          Length = 806

 Score =  112 bits (279), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 103/176 (58%), Gaps = 9/176 (5%)

Query: 267 SAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGET 326
           S I + +L        ++ + L+ KG  +R  ++T  N+ SSRSH +  + + +      
Sbjct: 260 SKISVANLSHHRPKTVQDVMDLIIKGNINRTTSATDANETSSRSHAVLQIHISQTNRTVD 319

Query: 327 FRVSKI----NLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-----DKN 377
              S +    +++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L       ++
Sbjct: 320 LTSSHVFATLSIIDLAGSERAASTKNRGERLYEGANINKSLLALGNCINALCLNDGTRRS 379

Query: 378 AHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 433
            H+P+R+SKLTRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA +AK IK K
Sbjct: 380 CHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSTHYDETLNTLKYANRAKEIKTK 435

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 59/107 (55%), Gaps = 10/107 (9%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  DK+F   + Q  V++     +    + G+N T+  YG T  GKTYT++G        
Sbjct: 146 FIFDKLFNEGSSQLAVYRSTTSLLLDSVLDGFNGTVFAYGATGCGKTYTISGT------- 198

Query: 127 LSEAAGIIPRVLFKLFDTLE-VQES-DYMVKCSFIELYNEELKDLLD 171
             E  GII   + +LF  +E ++++ ++ +  S++E+YNE ++DLL+
Sbjct: 199 -PEQPGIIFLAMEELFQKIENIKDTKNFELTLSYLEIYNESIRDLLN 244

>TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa]
           {ON} Anc_3.528 YGL216W
          Length = 801

 Score =  111 bits (277), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 104/178 (58%), Gaps = 13/178 (7%)

Query: 269 IYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYK------NF 322
           I + +L  +     +E + L+ +G  +R  +ST  N+ SSRSH +  + L +      + 
Sbjct: 226 ISVSNLSTYSPATIEEVMDLIIQGNLNRTTSSTHANETSSRSHAVLQIHLTQQNKLNNDI 285

Query: 323 NGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL-------AD 375
           N      S ++++DLAGSE  + +  + +   E  +IN+SLL LG  IN+L       + 
Sbjct: 286 NSTEQLFSTLSIIDLAGSERAASTKNRGETLLEGANINKSLLALGNCINALCINTSSHSQ 345

Query: 376 KNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 433
           +  HIP+R+SKLTRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA +AK IK K
Sbjct: 346 QQIHIPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSKHYDETLNTLKYANRAKEIKTK 403

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 45/141 (31%), Positives = 74/141 (52%), Gaps = 15/141 (10%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  DK+   ++ Q  VF+   +P+    + GYN T+  YG T  GKTYT++G        
Sbjct: 110 FIFDKLLDQNSTQQHVFQSTTEPLLDSILDGYNGTVFAYGATGCGKTYTISGT------- 162

Query: 127 LSEAAGIIPRVLFKLFDTLE--VQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKL 184
             E  GII   L  LF+ +E      +  +  S++E+YNE +KDLLD        +S+KL
Sbjct: 163 -PENPGIIFLTLQSLFNKIENLKDTKEISISLSYLEIYNESIKDLLDPTI-----SSKKL 216

Query: 185 RIYDSLNSSNNVTNVNSRSSS 205
            I +  N+  +V+N+++ S +
Sbjct: 217 VIREDANNKISVSNLSTYSPA 237

>AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL216W
           (KIP3)
          Length = 818

 Score =  111 bits (277), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 63/166 (37%), Positives = 100/166 (60%), Gaps = 9/166 (5%)

Query: 277 FHITDAKEG-LRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGETFRVSK---- 331
           +H  +  E  + L+ +G  +R  + T  N+ SSRSH +  + + ++      +  K    
Sbjct: 251 YHTPETVEDVMDLVIRGNVNRTTSPTDANETSSRSHAVLQVHVVQSSRTVDLKEDKMYAT 310

Query: 332 INLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKN----AHIPFRESKL 387
           ++++DLAGSE  S +  + +R  E  +IN+SLL LG  IN+L         H+P+R+SKL
Sbjct: 311 LSIIDLAGSERASATKNRGERLHEGSNINKSLLALGNCINALCMTGRRAVCHVPYRDSKL 370

Query: 388 TRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 433
           TRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA +AK+IK K
Sbjct: 371 TRLLKFSLGGNCKTVMIVCVSPSSAHYDETLNTLKYANRAKDIKTK 416

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 78/158 (49%), Gaps = 16/158 (10%)

Query: 46  NEVSINTSGDIGITARMNS-KTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLV 104
           N + + + G++    R N  + +  DK+F   A Q  VF+    P+    + G+N T+  
Sbjct: 106 NTMLVGSRGEVRRRMRRNGEQKFMFDKLFDVDASQQDVFQCTTMPLLDSILDGFNGTVFA 165

Query: 105 YGMTSTGKTYTMTGDEKLYDGELSEAAGIIPRVLFKLFDTLE--VQESDYMVKCSFIELY 162
           YG T  GKT+T++G          ++ GII   + +LF  +        + +  S++E+Y
Sbjct: 166 YGATGCGKTFTISGT--------PDSPGIIFLTMQELFQRINNLKDTKTFELTVSYLEIY 217

Query: 163 NEELKDLLDDGQDSGGNNSRKLRIYDSLNSSNNVTNVN 200
           NE ++DLL+         S+KL I +  +S+  V N++
Sbjct: 218 NETIRDLLE-----PDTPSQKLIIREDSDSTTTVANLS 250

>KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 769

 Score =  109 bits (273), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 65/176 (36%), Positives = 106/176 (60%), Gaps = 14/176 (7%)

Query: 270 YIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYK-NFNG---- 324
           ++ +L +    + +E + L+ KG  +R  + T  N+ SSRSH +  + + + N       
Sbjct: 241 FVSNLSKHSPENVEEVMDLVIKGNMNRTTSPTDANETSSRSHAVLQIHVAQMNRTADIKQ 300

Query: 325 -ETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKN------ 377
            +TF  + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L   +      
Sbjct: 301 DQTF--ATLSIIDLAGSERAAVTKNRGERLLEGANINRSLLALGNCINALCVSSTRTGFS 358

Query: 378 AHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 433
            H+P+R+SKLTRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA +AK IK K
Sbjct: 359 CHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSGHYDETLNTLKYANRAKEIKTK 414

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 60/114 (52%), Gaps = 12/114 (10%)

Query: 61  RMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDE 120
           R   + +  D++F     Q  V++    P+    + G+N T+  YG T  GKT+T++G  
Sbjct: 118 RFGEQKFIFDRIFDMDVTQQEVYENTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISGT- 176

Query: 121 KLYDGELSEAAGIIPRVLFKLFDTLEVQESD---YMVKCSFIELYNEELKDLLD 171
                  SE  GII   + +LF  +E Q  D   + ++ SF+E+YNE++ DLLD
Sbjct: 177 -------SEQPGIIFLTMQELFIRME-QLKDTKKFQLQLSFLEIYNEQIHDLLD 222

>KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa]
           {ON} Anc_3.479 YPR141C
          Length = 764

 Score =  109 bits (273), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 67/153 (43%), Positives = 95/153 (62%), Gaps = 4/153 (2%)

Query: 279 ITDAKEGL-RLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYK-NFNGETFRVSKINLVD 336
           + ++KE + ++L++    R  AST  N+ SSRSH+IF + L+  N   +      +NLVD
Sbjct: 602 VLESKESVDKVLKRATKLRSTASTLSNEHSSRSHSIFIIELHGVNHKTKEESCGVLNLVD 661

Query: 337 LAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA--HIPFRESKLTRLLQDS 394
           LAGSE +  S    +R +E  +IN+SL  LG VI +L DKN   HIPFR SKLT LLQ S
Sbjct: 662 LAGSERVHSSQVTGERLRETQNINRSLSCLGDVIYALNDKNTKRHIPFRNSKLTYLLQYS 721

Query: 395 LGGNTKTALIATISPAKINSEETSSTLEYATKA 427
           L GN+KT +   ISP+  +  ET ++L +A+K 
Sbjct: 722 LVGNSKTLMFVNISPSSSHINETINSLRFASKV 754

 Score = 70.9 bits (172), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 56/108 (51%), Gaps = 14/108 (12%)

Query: 66  TYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDG 125
           ++  DK+F        VFKE+   +    + GYN  +  YG T +GKTYTM         
Sbjct: 471 SFKFDKIFDTGESNDEVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM--------- 520

Query: 126 ELSEAAGIIPRVLFKLFDTLE-VQES--DYMVKCSFIELYNEELKDLL 170
            L    G+IP  +  +FD +E ++E   +Y + C F+E+YNE + DLL
Sbjct: 521 -LHPNDGVIPATISHIFDWVENLKERGWEYKISCQFVEIYNENIVDLL 567

>Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}
           complement(87351..89429) [2079 nt, 693 aa]
          Length = 692

 Score =  109 bits (272), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 91/149 (61%), Gaps = 6/149 (4%)

Query: 288 LLQKGLSHRQVASTKMNDVSSRSHTIFTLTLY--KNFNGETFRVSKINLVDLAGSENISR 345
           L++K    R  A+T  N+ SSRSH+IF + L    N  GE+     +NLVDLAGSE ++ 
Sbjct: 539 LIKKATKLRATATTAANERSSRSHSIFIIHLRGSNNITGES-SYGILNLVDLAGSERLNS 597

Query: 346 SGAQNQRAKEAGSINQSLLTLGRVINSLADKNA---HIPFRESKLTRLLQDSLGGNTKTA 402
           S  +  R +E  +IN+SL  LG VI++L   +A   HIPFR SKLT LLQ SL GN+KT 
Sbjct: 598 SQVEGARLRETQNINKSLSCLGDVIHALGSSDASKRHIPFRNSKLTYLLQYSLTGNSKTL 657

Query: 403 LIATISPAKINSEETSSTLEYATKAKNIK 431
           +   ISP +   +ET ++L +A+K    K
Sbjct: 658 MFVNISPTQQQIQETLNSLRFASKVNTTK 686

 Score = 68.6 bits (166), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 62/220 (28%), Positives = 97/220 (44%), Gaps = 21/220 (9%)

Query: 12  ELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVDK 71
           EL   + V CR R    +K+   +  N   V   N+   N S +I    R   K +  D+
Sbjct: 345 ELRGNIRVFCRIR--PPLKSVEDINTNHIKVQPFNDNHGNQSMEIVKDHRCIQK-FQFDR 401

Query: 72  VFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSEAA 131
           +F        VF EI   +    + GYN  +  YG T +GKT+TM          L+   
Sbjct: 402 IFDQHEVNKDVFDEIG-QLVQSSLDGYNVCIFAYGQTGSGKTFTM----------LNPND 450

Query: 132 GIIPRVLFKLFD---TLEVQESDYMVKCSFIELYNEELKDLLDDGQ----DSGGNNSRKL 184
           G+IP  +  +FD   +L+ +  +Y V C F+E+YNE + DLL +      D   NN R  
Sbjct: 451 GMIPATIDHIFDWTDSLKERGWEYEVSCQFVEIYNENIIDLLREETSAELDEITNNGRHD 510

Query: 185 RIYDSLNSSNNVTNVNSRSSSRSNSPTVNLEAKRRIRAGA 224
             +DS      +TN+ +      +S    ++   ++RA A
Sbjct: 511 IRHDSDKRITTITNIKTSILKSKDSVDFLIKKATKLRATA 550

>KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]
           {ON} similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141C KAR3 Minus-end-directed microtubule motor that
           functions in mitosis and meiosis localizes to the
           spindle pole body and localization is dependent on
           functional Cik1p required for nuclear fusion during
           mating potential Cdc28p substrate
          Length = 702

 Score =  107 bits (268), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 90/150 (60%), Gaps = 6/150 (4%)

Query: 287 RLLQKGLSHRQVASTKMNDVSSRSHTIFTLTL--YKNFNGETFRVSKINLVDLAGSENIS 344
           R+L++ L  R  A+T  N  SSRSH++F + L  Y   +GE      +NLVDLAGSE I 
Sbjct: 549 RMLRRALKMRSTAATVANSRSSRSHSVFIIKLDGYNTISGEK-STGTLNLVDLAGSERIH 607

Query: 345 RSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA---HIPFRESKLTRLLQDSLGGNTKT 401
               Q +R +E  +IN+SL  LG VI++L   +A   HIPFR SKLT LLQ SL G++KT
Sbjct: 608 SLQPQAERLRETQNINKSLSCLGDVIHALGSADASKRHIPFRNSKLTYLLQYSLMGDSKT 667

Query: 402 ALIATISPAKINSEETSSTLEYATKAKNIK 431
            +   +SP   +  ET ++L +A K  + K
Sbjct: 668 LMFVNVSPCANSMLETLNSLRFAAKVNSTK 697

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 57/195 (29%), Positives = 93/195 (47%), Gaps = 30/195 (15%)

Query: 14  NITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSK--TYTVDK 71
           NI V  R R   E E  + SS+ +         E   + +G   IT + +SK   +T D+
Sbjct: 363 NIRVFCRLRPALENENYSSSSIEI---------EKFSDETGMQSITIKRDSKQHKFTFDR 413

Query: 72  VFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSEAA 131
            F        VF EI   +    + GYN  +  YG T +GKT+TM          L+   
Sbjct: 414 CFSAQETNGDVFSEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTFTM----------LNPND 462

Query: 132 GIIPRVLFKLFDTLE-VQESDYM--VKCSFIELYNEELKDLLD----DGQDSGGNNSRKL 184
           GIIP  L  +F  +E ++E  ++  +   F+E+YNE +KDL      D  D+G +   ++
Sbjct: 463 GIIPSTLNHIFLWVEKLKELGWVYEITSQFVEIYNENIKDLFKENDADVDDTGESLKFEI 522

Query: 185 RIYDSLNSSNNVTNV 199
           R +D+ + + ++TN+
Sbjct: 523 R-HDNESRTTHITNI 536

>SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 706

 Score =  106 bits (265), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 101/170 (59%), Gaps = 6/170 (3%)

Query: 263 NEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTL--YK 320
           +++S   ++ ++    +TD      LL++    R  A+T  N+ SSRSH++F + L  Y 
Sbjct: 529 DQESQTTHVTNVTTCKLTDRDMVDTLLKRAAKLRSTAATGSNERSSRSHSVFIIKLRGYN 588

Query: 321 NFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA-- 378
           +  GE  +   +NLVDLAGSE I+ S     R +E  +IN+SL  LG VI++LA  +A  
Sbjct: 589 SNTGEECQ-GTLNLVDLAGSERINASQVTGDRLRETQNINKSLSCLGDVIHALASPDASK 647

Query: 379 -HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKA 427
            HIPFR SKLT LLQ SL G++KT +   ISP   +  ET ++L +A+K 
Sbjct: 648 RHIPFRNSKLTYLLQYSLLGDSKTLMFVNISPCLDHFNETLNSLRFASKV 697

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 73/153 (47%), Gaps = 19/153 (12%)

Query: 56  IGITARMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYT 115
           + IT       +  DK+F P      +F+EI   +    + GYN  +  YG T +GKTYT
Sbjct: 402 MNITRDSKKHEFKFDKIFDPENSNDDIFEEIRQ-LVQSSLDGYNVCIFAYGQTGSGKTYT 460

Query: 116 MTGDEKLYDGELSEAAGIIPRVL---FKLFDTLEVQESDYMVKCSFIELYNEELKDLL-- 170
           M          L    G+IP  L   F+    L+ +  +Y +   FIE+YNE + DLL  
Sbjct: 461 M----------LHPQNGMIPSTLDHIFQWIHLLKERGWEYEISSQFIEIYNETIIDLLRG 510

Query: 171 --DDGQDSGGNNSRKLRIYDSLNSSNNVTNVNS 201
             +D +D   +   ++R +D  + + +VTNV +
Sbjct: 511 LNNDTEDITESLKHEIR-HDQESQTTHVTNVTT 542

>Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score =  106 bits (265), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 102/372 (27%), Positives = 159/372 (42%), Gaps = 98/372 (26%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTM--TGDEKLYD 124
           +  DK+F        VFKE+   +    + GYN  +  YG T +GKT+TM  TGD     
Sbjct: 436 FKFDKIFDQQNTNEDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTMLNTGD----- 489

Query: 125 GELSEAAGIIPRVL---FKLFDTLEVQESDYMVKCSFIELYNEELKDLLDD---GQDSGG 178
                  GIIP  +   F   + L+ +  DY V C FIE+YNE + DLL +   G+D   
Sbjct: 490 -------GIIPSTISHIFSWINKLKTKGWDYKVNCEFIEIYNENIVDLLRNDSIGKDDTN 542

Query: 179 NNSRKLRIYDSLNSSNNVTNVNSRSSSRSNSPTVNLEAKRRIRAGALYKPKPKLPTQSQS 238
            NS+    +D    +  +TNV S            LE++ R+    + K   KL + + +
Sbjct: 543 TNSKHEIRHDQETKTTMITNVTS----------CQLESEERV--DMILKKANKLRSTAST 590

Query: 239 NGQQQQQQQQQQQQQQQQQTQGQVNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQV 298
              +                    + +S +I++ HL     ++AK G             
Sbjct: 591 ASNEH-------------------SSRSHSIFMIHLSG---SNAKTG------------- 615

Query: 299 ASTKMNDVSSRSHTIFTLTLYKNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGS 358
                      + +  TL L      E   +S++    L  ++NI++S            
Sbjct: 616 -----------AQSYGTLNLVDLAGSERINISQVVGDRLRETQNINKS------------ 652

Query: 359 INQSLLTLGRVINSLADKNA---HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSE 415
               L  LG VI++L   ++   HIPFR SKLT LLQ SL G++KT +   ISP+  +  
Sbjct: 653 ----LSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLMFVNISPSSSHIN 708

Query: 416 ETSSTLEYATKA 427
           ET ++L +A+K 
Sbjct: 709 ETLNSLRFASKV 720

>CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {ON}
           similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141c KAR3 kinesin-related protein
          Length = 692

 Score =  106 bits (264), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 91/149 (61%), Gaps = 4/149 (2%)

Query: 287 RLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGETFRVSKI-NLVDLAGSENISR 345
           ++L++    R  AST  N+ SSRSH+IF + L     G   +   I NLVDLAGSE ++ 
Sbjct: 539 KVLKRANKLRSTASTAANEHSSRSHSIFIIHLEGKNEGTGEKSQGILNLVDLAGSERLNS 598

Query: 346 SGAQNQRAKEAGSINQSLLTLGRVINSLADKNA---HIPFRESKLTRLLQDSLGGNTKTA 402
           S    +R +E  SIN+SL  LG VI++L   +    HIPFR SKLT LLQ SL G++KT 
Sbjct: 599 SMVVGERLRETQSINKSLSCLGDVIHALNSPDGQKRHIPFRNSKLTYLLQYSLIGSSKTL 658

Query: 403 LIATISPAKINSEETSSTLEYATKAKNIK 431
           +   ISPA ++  ET ++L +A+K  N K
Sbjct: 659 MFVNISPAALHLNETINSLRFASKVNNTK 687

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 66/136 (48%), Gaps = 17/136 (12%)

Query: 53  SGDIGITA-RMNSKT--YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTS 109
           +GD G+T  R NS+   +  DK+F        +FKE+   +    + GYN  +  YG T 
Sbjct: 380 NGDQGMTINRGNSQVIPFKFDKIFDQQETNDEIFKEVGQ-LIQSSLDGYNVCIFAYGQTG 438

Query: 110 TGKTYTMTGDEKLYDGELSEAAGIIPRVL---FKLFDTLEVQESDYMVKCSFIELYNEEL 166
           +GKTYTM          L+   GI+P  +   F   D L  +   Y V C FIE+YNE +
Sbjct: 439 SGKTYTM----------LNPGDGIVPATINHIFSWIDKLAARGWSYKVSCEFIEIYNENI 488

Query: 167 KDLLDDGQDSGGNNSR 182
            DLL  G  S  NN R
Sbjct: 489 VDLLRSGAPSQENNDR 504

>Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]
           {ON} complement(235625..237718) [2094 nt, 698 aa]
          Length = 697

 Score =  104 bits (260), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 100/153 (65%), Gaps = 6/153 (3%)

Query: 280 TDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGETFRVSK--INLVDL 337
           ++ +E   L+Q+    R+ A T MN+ SSRSH++F + + + FN ++    K  +NLVDL
Sbjct: 543 SNRRELQELVQRLNKVRRTAKTAMNNRSSRSHSVFIVEV-EGFNKDSEERCKGVLNLVDL 601

Query: 338 AGSENISRSG-AQNQRAKEAGSINQSLLTLGRVINSLADKNA--HIPFRESKLTRLLQDS 394
           AGSE ++RSG    +R +E   IN+SL ++G VI++L   +   HIPFR +KLT LL+ S
Sbjct: 602 AGSERMNRSGLVDKERIEETKQINKSLSSVGDVIHALRQGSGSLHIPFRNTKLTYLLKHS 661

Query: 395 LGGNTKTALIATISPAKINSEETSSTLEYATKA 427
           L G++KT ++ T+SP+  +  ET ++L +ATK 
Sbjct: 662 LQGSSKTLMLVTVSPSNSSRNETMNSLRFATKV 694

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 72/142 (50%), Gaps = 17/142 (11%)

Query: 64  SKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLY 123
           S  +  DK+F        VF E+ + +    + G+N  +  YG T +GKTYTM       
Sbjct: 405 SVNFQFDKIFNYDESNRQVFGEVKE-LVQSALDGHNVCIFTYGQTGSGKTYTM------- 456

Query: 124 DGELSEAAGIIPRVLFKLFD---TLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNN 180
              L+E  GIIP  L  + D   +++     Y +K  F+E+YN+ + DLL+DG+  G + 
Sbjct: 457 ---LNEEDGIIPSTLDHIIDWTSSMKKLGWQYGLKIKFVEIYNDRIFDLLNDGK--GKHK 511

Query: 181 SRKLRIYDSLNSSNNVTNVNSR 202
             ++R +D +     +TNV +R
Sbjct: 512 ECEVR-HDDIGRRTELTNVITR 532

>AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR141C (KAR3)
          Length = 709

 Score =  103 bits (257), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 67/169 (39%), Positives = 101/169 (59%), Gaps = 6/169 (3%)

Query: 268 AIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLY-KNFN-GE 325
             YI ++    +T   +   +L+K    R  A+T+ N+ SSRSH++F + +  +N + GE
Sbjct: 538 GTYITNVTRMKMTSTSQVDTILKKASKMRSTAATRSNERSSRSHSVFMVHINGRNLHTGE 597

Query: 326 TFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA---HIPF 382
           T +  K+NLVDLAGSE I+ S    +R +E  +IN+SL  LG VI +L   +A   +IPF
Sbjct: 598 TSQ-GKLNLVDLAGSERINSSAVTGERLRETQNINKSLSCLGDVIYALNTPDAGKRYIPF 656

Query: 383 RESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIK 431
           R SKLT LLQ SL G++KT +   I P   +  ET ++L +A+K  + K
Sbjct: 657 RNSKLTYLLQYSLVGDSKTLMFVNIPPDPNHISETLNSLRFASKVNSTK 705

 Score = 75.5 bits (184), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 53/170 (31%), Positives = 81/170 (47%), Gaps = 22/170 (12%)

Query: 9   EGDELNITVAVRCRGRNE--KEIKAKSSVVVN-CPDVIGANEVSINTSGDIGITARMNSK 65
           E  EL   + V CR R     E +  S +++    +  GA  ++IN +       R+ S 
Sbjct: 359 ELQELRGNIRVYCRVRPPLLNEPQDMSHILIEKFNEAKGAQSLTINRN-----EGRILSY 413

Query: 66  TYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDG 125
            +  D +F PS     +F+EI   +    + GYN  +  YG T +GKTYTM         
Sbjct: 414 NFQFDMIFEPSHTNKEIFEEIRQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM--------- 463

Query: 126 ELSEAAGIIPRVL---FKLFDTLEVQESDYMVKCSFIELYNEELKDLLDD 172
            L+   G+IP  L   FK    L+ +  +Y ++C +IE+YNE + DLL D
Sbjct: 464 -LNAGDGMIPMTLSHIFKWTANLKERGWNYEMECEYIEIYNETILDLLRD 512

>Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON}
           (11880..13742) [1863 nt, 621 aa]
          Length = 620

 Score =  102 bits (255), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 97/159 (61%), Gaps = 15/159 (9%)

Query: 283 KEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKN--FNGETFRVSKINLVDLAGS 340
           +E L  ++ G  HR+ +ST  N  SSRSH I  + L  +   +GE    S ++L DLAGS
Sbjct: 245 EELLNWIKLGDKHRKTSSTDFNTRSSRSHAIILIRLISSDLSSGEVV-TSTLSLCDLAGS 303

Query: 341 ENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK---------NAHIPFRESKLTRLL 391
           E ++   AQ++R +E   IN+SLL LG VI+ L+ +         N+HIP+R+SKLTR+L
Sbjct: 304 ERVT---AQHERRQEGSFINKSLLALGTVISKLSAEVNNSTESVNNSHIPYRDSKLTRIL 360

Query: 392 QDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNI 430
           Q +L GN+    I TI  +   + E+ +TL +A++AKN+
Sbjct: 361 QPALSGNSIVTTICTIDTSVDATNESVNTLRFASRAKNV 399

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/109 (37%), Positives = 58/109 (53%), Gaps = 12/109 (11%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           YT D VF P A    V+     P+      G+N T+  YGMT +GKTYTM+G     DG 
Sbjct: 104 YTYDNVFHPDASNFDVYAATCKPLIDKLFDGFNSTVFAYGMTGSGKTYTMSG----VDGN 159

Query: 127 LSEAAGIIP----RVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLD 171
               AG+IP     +  K+FD+   +   Y    S++E+YNE++ DLL+
Sbjct: 160 ----AGLIPLSVAYMYSKIFDSTIHENKKYDTLVSYLEIYNEKIYDLLE 204

>KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa]
           {ON} Anc_3.479 YPR141C
          Length = 706

 Score =  103 bits (256), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 88/149 (59%), Gaps = 4/149 (2%)

Query: 287 RLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLY-KNFNGETFRVSKINLVDLAGSENISR 345
           ++L +    R  ASTK N+ SSRSH+IF + L+ KN          +NLVDLAGSE I+ 
Sbjct: 554 KVLHRATKLRSTASTKSNEHSSRSHSIFIIHLHGKNSKTNEDSYGILNLVDLAGSERINS 613

Query: 346 SGAQNQRAKEAGSINQSLLTLGRVI---NSLADKNAHIPFRESKLTRLLQDSLGGNTKTA 402
           S    +R +E   IN+SL  LG VI   NS   K  HIPFR SKLT LL+ SL GN+KT 
Sbjct: 614 SQVSGERLRETQHINKSLSCLGDVIHALNSSEHKERHIPFRNSKLTHLLKYSLSGNSKTL 673

Query: 403 LIATISPAKINSEETSSTLEYATKAKNIK 431
           +   IS +  +  ET ++L +A+K  + K
Sbjct: 674 MFVNISASLNHVNETINSLRFASKVNSTK 702

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 52/170 (30%), Positives = 85/170 (50%), Gaps = 18/170 (10%)

Query: 58  ITARMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMT 117
           IT   N+  Y  DK+F      S +FKE+   +    + GYN  +  YG T +GKT+TM 
Sbjct: 412 ITKNNNTNKYKFDKIFDQFESNSEIFKEVGQ-LVQSALDGYNVCIFAYGQTGSGKTFTM- 469

Query: 118 GDEKLYDGELSEAAGIIP---RVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQ 174
                    L+ + GIIP   R +F   D L+ +  +Y + C F+E+YNE + DLL + Q
Sbjct: 470 ---------LNPSDGIIPSTVRHIFTWIDNLKERGWEYQINCQFVEIYNENIIDLLREKQ 520

Query: 175 DSGGNNSRKLRIYDSLNSSNNVTNVNSRSSSRSNSPTVNLEAKRRIRAGA 224
            S  ++ R    +D  + + ++TNV + +  R  +    L    ++R+ A
Sbjct: 521 TSQKHDIR----HDDESQTTSITNVMTVTLDREETVEKVLHRATKLRSTA 566

>ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 731

 Score =  102 bits (254), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 67/149 (44%), Positives = 91/149 (61%), Gaps = 6/149 (4%)

Query: 288 LLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGETFRVSK--INLVDLAGSENISR 345
           LL+K    R  AST  N+ SSRSH++F + L K  N  T   S   +NLVDLAGSE I+ 
Sbjct: 566 LLRKANRLRSTASTSANERSSRSHSVFIIFL-KGSNHLTGEQSDGILNLVDLAGSERINS 624

Query: 346 SGAQNQRAKEAGSINQSLLTLGRVINSLADKNA---HIPFRESKLTRLLQDSLGGNTKTA 402
           S    +R +E  +IN+SL  LG V+++L   +A   HIPFR SKLT LLQ SL GN+KT 
Sbjct: 625 SQVLGERLRETQNINKSLSCLGDVVHALGSNDAAKRHIPFRNSKLTYLLQYSLTGNSKTL 684

Query: 403 LIATISPAKINSEETSSTLEYATKAKNIK 431
           +   IS  + +  ET ++L +A+K  + K
Sbjct: 685 MFVNISACESHLNETLNSLRFASKVNSTK 713

 Score = 74.7 bits (182), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 76/166 (45%), Gaps = 18/166 (10%)

Query: 14  NITVAVRCRGRNEKEIKAKSSVVVN-CPDVIGANEVSINTSGDIGITARMNSKTYTVDKV 72
           NI V  R R   + E    + + VN   D  G   + I  S + G +   N   +  D++
Sbjct: 377 NIRVFCRIRPPLKYENPNTAHLTVNKFDDENGCQTMEIVKSNNTGNSIPQN---FKFDRI 433

Query: 73  FGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSEAAG 132
           F  +     VF+EI   +    + GYN  +  YG T +GKTYTM          L+   G
Sbjct: 434 FDQNETNENVFEEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM----------LNPRNG 482

Query: 133 IIPRVL---FKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQD 175
           IIP  +   F   + L+ +  +Y + C FIE+YNE + DLL   QD
Sbjct: 483 IIPATISHIFSWIENLKERGWNYEINCQFIEIYNENIADLLRSDQD 528

>Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {ON}
           YPR141C (REAL)
          Length = 731

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 65/146 (44%), Positives = 90/146 (61%), Gaps = 6/146 (4%)

Query: 287 RLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGETFRVS--KINLVDLAGSENIS 344
           R+L++    R  AST  N+ SSRSH+IF + L    N +T   S   +NLVDLAGSE I+
Sbjct: 575 RVLKRANKLRSTASTASNEHSSRSHSIFIIHL-SGLNAKTGAQSYGTLNLVDLAGSERIN 633

Query: 345 RSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA---HIPFRESKLTRLLQDSLGGNTKT 401
            S     R +E  +IN+SL  LG VI++L   ++   HIPFR SKLT LLQ SL G++KT
Sbjct: 634 ISQVVGDRLRETQNINKSLSCLGDVIHALGQPDSAKRHIPFRNSKLTYLLQYSLTGDSKT 693

Query: 402 ALIATISPAKINSEETSSTLEYATKA 427
            +   ISP+  +  ET ++L +A+K 
Sbjct: 694 LMFVNISPSSSHINETLNSLRFASKV 719

 Score = 74.7 bits (182), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 46/141 (32%), Positives = 69/141 (48%), Gaps = 18/141 (12%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  DK+F        VFKE+   +    + GYN  +  YG T +GKT+TM          
Sbjct: 436 FKFDKIFDQRNTNEDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM---------- 484

Query: 127 LSEAAGIIPRVL---FKLFDTLEVQESDYMVKCSFIELYNEELKDLL---DDGQDSGGNN 180
           L+   GIIP  +   F   + L+ +  DY V C FIE+YNE + DLL   ++  D+  N 
Sbjct: 485 LNPGDGIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNENIVDLLRNENNKDDTNTNL 544

Query: 181 SRKLRIYDSLNSSNNVTNVNS 201
             ++R +D    +  +TNV S
Sbjct: 545 KHEIR-HDQETKTTMITNVTS 564

>Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C
           (KIP2) - kinesin-related protein [contig 68] FULL
          Length = 715

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 72/203 (35%), Positives = 109/203 (53%), Gaps = 24/203 (11%)

Query: 268 AIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKN---FNG 324
            + +  L E  +  +++ L+ +  G ++R+   T  N  SSRSH I TL L         
Sbjct: 277 GVRVMGLTEQRVYSSEDVLKWISLGDTNRRTGETDYNTRSSRSHAIVTLNLACTDLVSGA 336

Query: 325 ETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK-------- 376
           ET   S ++L DLAGSE   R+  Q++R KE   IN+SLL LG VI+ L+          
Sbjct: 337 ET--TSTLSLCDLAGSE---RAAGQHERRKEGAFINKSLLALGTVISKLSASSMHTTPSF 391

Query: 377 -NAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNI----- 430
            N+HIP+R+SKLTR+LQ +L G +    I TI        ET +T+ +A++AKN+     
Sbjct: 392 GNSHIPYRDSKLTRILQPALSGESIVTTICTIDTRLDAMSETVNTIRFASRAKNVSMTVK 451

Query: 431 KNKPQLGSFMMKDILVKNISHEL 453
           +N+ +L     KD L+ N+  +L
Sbjct: 452 RNEAELAH--EKDALIHNLRRQL 472

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 58/108 (53%), Gaps = 11/108 (10%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  D VF P ++   V+++I  PM     +GYN  +  YGMT +GKT+TM+G        
Sbjct: 139 FKFDNVFRPQSNNYEVYQQIGKPMIDRLFQGYNAIIFAYGMTGSGKTFTMSGT------- 191

Query: 127 LSEAAGIIPRVLFKLFDTL---EVQESDYMVKCSFIELYNEELKDLLD 171
             E AG+I   +  +F  +    +    + V  S++E+YNE++ DLL+
Sbjct: 192 -PEEAGLISLSVEHIFAQIMSESLANKSFQVTVSYLEIYNEKIYDLLN 238

>NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {ON}
           Anc_3.479 YPR141C
          Length = 698

 Score =  101 bits (251), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 92/150 (61%), Gaps = 8/150 (5%)

Query: 288 LLQKGLSHRQVASTKMNDVSSRSHTIFTLTLY--KNFNGE-TFRVSKINLVDLAGSENIS 344
           +L++    R  AST  N+ SSRSH+IF + L    +  GE ++ +  +NLVDLAGSE I+
Sbjct: 548 ILKRANKLRSTASTGSNEHSSRSHSIFIIHLRGSNSLTGEESYGI--LNLVDLAGSERIN 605

Query: 345 RSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA---HIPFRESKLTRLLQDSLGGNTKT 401
            S     R +E  +IN+SL  LG VI++L   +    HIPFR SKLT LLQ SL GN+KT
Sbjct: 606 SSQVTGDRLRETQNINRSLSCLGDVIHALGGPDQGKRHIPFRNSKLTYLLQYSLTGNSKT 665

Query: 402 ALIATISPAKINSEETSSTLEYATKAKNIK 431
            +   ISP+  +  ET ++L +A+K  + K
Sbjct: 666 LMFVNISPSANHINETINSLRFASKVNSTK 695

 Score = 74.7 bits (182), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 62/212 (29%), Positives = 97/212 (45%), Gaps = 31/212 (14%)

Query: 9   EGDELNITVAVRCRGRNE-KEIKAKSSVVVNCPDVIGANEVSINTSGDI--GITARMNSK 65
           E  EL   + V CR R     I++K +  +   D    N +    S ++  GI    N+ 
Sbjct: 341 ELQELRGKIRVYCRIRPPLPNIESKDTAHIKVEDFDDDNGIQ---SMEVMKGIEVNNNNA 397

Query: 66  T-----YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDE 120
           T     +  DK+F  +   + VFKE+   +    + GYN  +  YG T +GKTYTM    
Sbjct: 398 TQIPQRFKFDKIFNQTDTNADVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM---- 452

Query: 121 KLYDGELSEAAGIIPRVLFKLFD---TLEVQESDYMVKCSFIELYNEELKDLL-----DD 172
                 L    GIIP  +  +F+    L+ +   Y + C F+E+YNE + DLL     DD
Sbjct: 453 ------LRPKDGIIPSTIKHIFNWTKNLKERGWHYEIDCQFVEIYNENIIDLLRSSSNDD 506

Query: 173 GQDSGGNNSRKLRI-YDSLNSSNNVTNVNSRS 203
            ++   N   K  I +D  N +  +TN+ +R+
Sbjct: 507 TRNIDSNIPTKHEIRHDQENRNTTITNIVTRN 538

>TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {ON}
           Anc_3.479 YPR141C
          Length = 724

 Score =  101 bits (251), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 92/149 (61%), Gaps = 6/149 (4%)

Query: 288 LLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGETFRVSK--INLVDLAGSENISR 345
           +L+K    R  A+T  N+ SSRSH++F + L K  N  T   S+  +NLVDLAGSE ++ 
Sbjct: 571 VLKKATKLRATAATNSNERSSRSHSVFMIYL-KGKNEITGDSSEGILNLVDLAGSERLNS 629

Query: 346 SGAQNQRAKEAGSINQSLLTLGRVINSLADKN---AHIPFRESKLTRLLQDSLGGNTKTA 402
           S A   R +E  +IN+SL  LG VI++L   +    HIPFR SKLT LLQ SL G++KT 
Sbjct: 630 SQAVGARLRETQNINKSLSCLGDVIHALGQNDNTKRHIPFRNSKLTYLLQYSLTGSSKTL 689

Query: 403 LIATISPAKINSEETSSTLEYATKAKNIK 431
           +   ISP K +  ET ++L +A+K  + K
Sbjct: 690 MFVNISPTKSHLNETINSLRFASKVNSTK 718

 Score = 82.0 bits (201), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 91/170 (53%), Gaps = 23/170 (13%)

Query: 64  SKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLY 123
           S+ Y  D++F  +   + VFKEI   +    + G+N  +  YG T +GKTYTM       
Sbjct: 427 SQIYKFDRIFDQADSNTEVFKEIG-QLVQSSLDGHNVCIFAYGQTGSGKTYTM------- 478

Query: 124 DGELSEAAGIIPRVLFKLFDTLE-VQESDYM--VKCSFIELYNEELKDLL----DDGQDS 176
              L++  G+IP  +  +FD  E ++E  ++  + C FIE+YNE + DLL     DG ++
Sbjct: 479 ---LNDNDGMIPATISHIFDWTESMKEKGWIYDISCQFIEIYNEGIIDLLRDNSTDGNEA 535

Query: 177 GGNNSRKLRIYDSLNSSNNVTNVNSRSSSRSNSPTVN--LEAKRRIRAGA 224
           G  N  ++R +D    + +VTN+N  + + +N   VN  L+   ++RA A
Sbjct: 536 GSPNKHEIR-HDKETMTTSVTNIN--TIALNNKGIVNNVLKKATKLRATA 582

>KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {ON}
           Anc_8.678 YPL155C
          Length = 658

 Score =  100 bits (249), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 76/223 (34%), Positives = 112/223 (50%), Gaps = 36/223 (16%)

Query: 268 AIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYK-NFNGET 326
            + I  L E     ++E ++ ++ G S+R+ + T+ N  SSRSH +  + L   N    +
Sbjct: 266 GVKITGLNEERCDTSQELMKWIKYGDSNRKTSETEYNLRSSRSHAVILVRLVTHNVIDGS 325

Query: 327 FRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA------------ 374
              S + L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L+            
Sbjct: 326 KTSSTLTLCDLAGSE---RAAGQQERRKEGAFINKSLLALGTVISKLSAESLSNSKHVSN 382

Query: 375 ------------DKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLE 422
                       + N HIP+R+SKLTRLLQ +L GN+    I TI P      ET +TL 
Sbjct: 383 PMGPPASPSLNSNGNNHIPYRDSKLTRLLQPALSGNSAVTTICTIDPRMETYAETINTLR 442

Query: 423 YATKAKNI-------KNKPQLG-SFMMKDILVKNISHELAKLK 457
           +A++AKN+       KN   +  S + KD ++K ++  L K K
Sbjct: 443 FASRAKNVSLRFNIKKNLSTISKSEVEKDKIIKELTFRLEKQK 485

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 54/156 (34%), Positives = 77/156 (49%), Gaps = 21/156 (13%)

Query: 59  TARMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTG 118
           T   N+  Y  D VF P  D   ++K  A P+      G+N T+  YGMT +GKTYTM G
Sbjct: 125 TINTNNDEYKFDHVFSPHVDNFEIYKTTAIPLIDKLFTGFNATLFCYGMTGSGKTYTMMG 184

Query: 119 DEKLYDGELSEAAGIIPRVLFKLFDTLEVQESD--YMVKCSFIELYNEELKDLLDDGQDS 176
           D +  D       GI+P  +  LF+ +    +D  Y V  S++E+YNE++ DLLDD + +
Sbjct: 185 DNENPD-------GIVPLSVSLLFNQVLNSRNDKKYDVILSYLEIYNEKIYDLLDDDRTN 237

Query: 177 ------------GGNNSRKLRIYDSLNSSNNVTNVN 200
                          NS +LRI D L     +T +N
Sbjct: 238 HLLTPSRFTSTPSRLNSSELRIRDDLEYGVKITGLN 273

>KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 690

 Score =  100 bits (249), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 61/139 (43%), Positives = 88/139 (63%), Gaps = 4/139 (2%)

Query: 296 RQVASTKMNDVSSRSHTIFTLTLYKNFNGETFRVSK--INLVDLAGSENISRSGAQNQRA 353
           + +A+T  N+ SSRSH++FT+ ++   N  T   S   +NLVDLAGSE I  S     R 
Sbjct: 549 KSIAATNSNERSSRSHSVFTIRIHGT-NSITGEASDGVLNLVDLAGSERIDTSNVTGDRL 607

Query: 354 KEAGSINQSLLTLGRVINSLADKNA-HIPFRESKLTRLLQDSLGGNTKTALIATISPAKI 412
           +E  +IN+SL  LG VI +L  K+  HIPFR SKLT LLQ SL G++KT +   +SP+  
Sbjct: 608 RETQNINKSLSCLGDVIYALNGKDMKHIPFRNSKLTYLLQYSLIGDSKTLMFVNVSPSSN 667

Query: 413 NSEETSSTLEYATKAKNIK 431
           + +ET ++L +A+K  + K
Sbjct: 668 HVKETLNSLRFASKVNSTK 686

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 60/191 (31%), Positives = 89/191 (46%), Gaps = 22/191 (11%)

Query: 14  NITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVDKVF 73
           NI V  R R   E E++  S + V+  D       + N S  I I+    +  +  DKVF
Sbjct: 358 NIRVYCRIRPPLENEVQDISHIHVSNFD-------NRNGSQAIEISNEDRNSRFLFDKVF 410

Query: 74  GPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSEAAGI 133
             +A    VF+E+   +    + GYN  +  YG T +GKTYTM  D            G+
Sbjct: 411 SSNASNRDVFEEVGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTMMND----------PDGV 459

Query: 134 IPRVLFKLFDT---LEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKLRIYDSL 190
           IP  L  +FD    L+ +  DY  +  FIE+YNE++ DLL       G    ++R +D  
Sbjct: 460 IPMTLDHIFDWTHLLKERGWDYSFEAQFIEIYNEQIVDLLRSLNPEPGPTKYEIR-HDGD 518

Query: 191 NSSNNVTNVNS 201
           +   ++TNV S
Sbjct: 519 SQRTSITNVTS 529

>YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON}
           KAR3Minus-end-directed microtubule motor that functions
           in mitosis and meiosis, localizes to the spindle pole
           body and localization is dependent on functional Cik1p,
           required for nuclear fusion during mating; potential
           Cdc28p substrate
          Length = 729

 Score =  100 bits (248), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 63/144 (43%), Positives = 86/144 (59%), Gaps = 4/144 (2%)

Query: 288 LLQKGLSHRQVASTKMNDVSSRSHTIFTLTLY-KNFNGETFRVSKINLVDLAGSENISRS 346
           +L+K    R  AST  N+ SSRSH+IF + L   N          +NLVDLAGSE I+ S
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNAKTGAHSYGTLNLVDLAGSERINVS 636

Query: 347 GAQNQRAKEAGSINQSLLTLGRVINSLADKNA---HIPFRESKLTRLLQDSLGGNTKTAL 403
                R +E  +IN+SL  LG VI++L   ++   HIPFR SKLT LLQ SL G++KT +
Sbjct: 637 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 404 IATISPAKINSEETSSTLEYATKA 427
              ISP+  +  ET ++L +A+K 
Sbjct: 697 FVNISPSSSHINETLNSLRFASKV 720

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 51/166 (30%), Positives = 77/166 (46%), Gaps = 17/166 (10%)

Query: 9   EGDELNITVAVRCRGRNE-KEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTY 67
           E  EL   + V CR R   K ++   + ++N  +    + V       I  TA+++   +
Sbjct: 379 ELQELRGNIRVYCRIRPALKNLENSDTSLINVNEFDDNSGVQSMEVTKIQNTAQVHE--F 436

Query: 68  TVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGEL 127
             DK+F        VFKE+   +    + GYN  +  YG T +GKT+TM          L
Sbjct: 437 KFDKIFDQQDTNVDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM----------L 485

Query: 128 SEAAGIIPRVL---FKLFDTLEVQESDYMVKCSFIELYNEELKDLL 170
           +   GIIP  +   F   + L+ +  DY V C FIE+YNE + DLL
Sbjct: 486 NPGDGIIPSTISHIFNWINKLKTKGWDYKVNCEFIEIYNENIVDLL 531

>Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar to
           Ashbya gossypii AGR253W
          Length = 711

 Score = 99.4 bits (246), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 62/149 (41%), Positives = 91/149 (61%), Gaps = 6/149 (4%)

Query: 288 LLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGETFRVS--KINLVDLAGSENISR 345
           +L++    R  A T+ N+ SSRSH++F + +    N +T  VS  K+NL+DLAGSE I+ 
Sbjct: 560 MLKRASRMRSTACTRSNERSSRSHSVFMVHI-NGHNDQTGEVSHGKLNLIDLAGSERINS 618

Query: 346 SGAQNQRAKEAGSINQSLLTLGRVINSLADKNA---HIPFRESKLTRLLQDSLGGNTKTA 402
           S     R +E  +IN+SL  LG VI +L   +A   HIPFR SKLT LLQ SL G++KT 
Sbjct: 619 SLVTGDRLRETQNINKSLSCLGDVIYALNSPDAAKRHIPFRNSKLTYLLQYSLIGDSKTL 678

Query: 403 LIATISPAKINSEETSSTLEYATKAKNIK 431
           +   I   + ++ ET ++L +A+K  + K
Sbjct: 679 MFVNIPSDQKHTNETLNSLRFASKVNSTK 707

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 79/174 (45%), Gaps = 21/174 (12%)

Query: 60  ARMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGD 119
            R  S  +  DK+F P    + VF+EI   +    + GYN  +  YG T +GKTYTM   
Sbjct: 410 GRCFSYNFHFDKIFEPHNTNADVFQEICQ-LVQCSLDGYNVCIFAYGQTGSGKTYTM--- 465

Query: 120 EKLYDGELSEAAGIIPRVL---FKLFDTLEVQESDYMVKCSFIELYNEELKDLL------ 170
                  L+   G+IP  L   F+  + L      Y + C +IE+YNE + DLL      
Sbjct: 466 -------LNPGDGMIPMTLSHIFQWTEDLMEHGWRYEMDCEYIEIYNETILDLLREFNSN 518

Query: 171 DDGQDSGGNNSRKLRIYDSLNSSNNVTNVNSRSSSRSNSPTVNLEAKRRIRAGA 224
           D+  D   +   ++R +D  N + ++TNV     +        L+   R+R+ A
Sbjct: 519 DNIDDILESQKHEIR-HDHDNHATSITNVTKMKMTSQEQVDSMLKRASRMRSTA 571

>Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 63/144 (43%), Positives = 86/144 (59%), Gaps = 4/144 (2%)

Query: 288 LLQKGLSHRQVASTKMNDVSSRSHTIFTLTLY-KNFNGETFRVSKINLVDLAGSENISRS 346
           +L+K    R  AST  N+ SSRSH+IF + L   N          +NLVDLAGSE I+ S
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNTKTGAQSYGTLNLVDLAGSERINIS 636

Query: 347 GAQNQRAKEAGSINQSLLTLGRVINSLADKNA---HIPFRESKLTRLLQDSLGGNTKTAL 403
                R +E  +IN+SL  LG VI++L   ++   HIPFR SKLT LLQ SL G++KT +
Sbjct: 637 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 404 IATISPAKINSEETSSTLEYATKA 427
              ISP+  +  ET ++L +A+K 
Sbjct: 697 FVNISPSSSHINETLNSLRFASKV 720

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 54/107 (50%), Gaps = 14/107 (13%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  DK+F      + VFKE+   +    + GYN  +  YG T +GKT+TM          
Sbjct: 436 FKFDKIFDQKDTNADVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM---------- 484

Query: 127 LSEAAGIIPRVL---FKLFDTLEVQESDYMVKCSFIELYNEELKDLL 170
           L+   GIIP  +   F   + L+ +  DY V C FIE+YNE + DLL
Sbjct: 485 LNPGDGIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNENIVDLL 531

>NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa]
           {ON} Anc_3.479
          Length = 763

 Score = 97.4 bits (241), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 90/154 (58%), Gaps = 11/154 (7%)

Query: 288 LLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGETFRVSK--INLVDLAGSENISR 345
           +L++    R  AST  N+ SSRSH+IF + L K  N  T   S   +NLVDLAGSE I+ 
Sbjct: 603 ILRRANKLRSTASTLSNEHSSRSHSIFIIHL-KGTNEITGEKSYGILNLVDLAGSERINS 661

Query: 346 SGAQNQRAKEAGSINQSLLTLGRVINSLAD--------KNAHIPFRESKLTRLLQDSLGG 397
           S    +R +E  +IN+SL  LG VI++L          K  HIPFR SKLT LLQ SL G
Sbjct: 662 SQVTGERLRETQNINRSLSCLGDVIHALTGSEKDKENAKKRHIPFRNSKLTYLLQYSLIG 721

Query: 398 NTKTALIATISPAKINSEETSSTLEYATKAKNIK 431
           N+KT +   ISP+     ET ++L +A+K  + K
Sbjct: 722 NSKTLMFVNISPSINYVNETLNSLRFASKVNSAK 755

 Score = 73.6 bits (179), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 58/115 (50%), Gaps = 14/115 (12%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  DK+F  +     VFKE+   +    + GYN  +  YG T +GKTYTM          
Sbjct: 453 FKFDKIFNQNETNDDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM---------- 501

Query: 127 LSEAAGIIPRVLFKLFD---TLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGG 178
           L    GIIP  +  +F+    L+ +   Y ++C F+E+YNE + DLL +  D+ G
Sbjct: 502 LHPKDGIIPATISHIFNWTNNLKERGWKYEIECEFVEIYNENIVDLLRNEHDNNG 556

>SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {ON}
           similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155C KIP2 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 657

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 62/173 (35%), Positives = 96/173 (55%), Gaps = 13/173 (7%)

Query: 268 AIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTL-YKNFNGET 326
            + +  L E  +  +++ ++ +  G S+R+   T  N  SSRSH I  + L   +     
Sbjct: 272 GVKVIGLTEQEVDTSEDVMKWIALGNSNRKTGETDFNSRSSRSHAIVLIRLTCTDLKSGL 331

Query: 327 FRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA-------- 378
              S ++L DLAGSE   R+ AQ +R KE   IN+SLL LG VI+ L+ ++         
Sbjct: 332 ETTSTLSLCDLAGSE---RATAQRERRKEGAFINKSLLALGTVISKLSAESTQNMGVGGG 388

Query: 379 -HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNI 430
            HIP+R+SKLTR+LQ +L G+     I T+     +S ET +T+ +A++AKNI
Sbjct: 389 HHIPYRDSKLTRILQPALSGDGIVTTICTVDAHAESSAETINTIRFASRAKNI 441

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 61/108 (56%), Gaps = 11/108 (10%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           ++ D VF P+ D   V++E A PM     +G+N T+  YGMT +GKT+TM+G        
Sbjct: 147 FSFDHVFHPTNDNFAVYEETARPMIEKLFQGFNSTIFAYGMTGSGKTFTMSGT------- 199

Query: 127 LSEAAGIIPRVLFKLFDTL---EVQESDYMVKCSFIELYNEELKDLLD 171
            S   G+IP  +  +F  +    +    + VK S++E+YNE++ DLL+
Sbjct: 200 -SNEPGLIPLSVNDIFSNIMSKSLNNQRFDVKVSYLEIYNEKIYDLLN 246

>KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8.678
           YPL155C
          Length = 625

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 66/180 (36%), Positives = 95/180 (52%), Gaps = 21/180 (11%)

Query: 268 AIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKN--FNGE 325
            + +  + E     A+E ++ +  G + R+   T  N  SSRSH I  + L      NG 
Sbjct: 242 GVKVHGVLEQKCDTAEELMKWVSVGEAVRKTGKTDYNMRSSRSHAIIQVKLITTNLLNGT 301

Query: 326 TFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK--------- 376
           T   + ++L DLAGSE  S    Q +R KE   IN+SLL LG VI+ L+ +         
Sbjct: 302 TH-FNTLSLCDLAGSEKASE---QLERRKEGSFINKSLLALGTVISKLSAESNAHDSSRP 357

Query: 377 ------NAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNI 430
                 N+HIP+R+SKLTRLLQ +L  ++    I TI P K    ET +TL +A++AKN+
Sbjct: 358 SSGSLNNSHIPYRDSKLTRLLQPALCNDSVVTAICTIDPTKEAMTETVNTLRFASRAKNV 417

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 56/112 (50%), Gaps = 6/112 (5%)

Query: 60  ARMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGD 119
           A  +   +  D VFGP+A    +F E+   +      G N T+L YG T +GKTYTM G 
Sbjct: 120 AHWDQGDFQFDHVFGPTATNEDLFAELGGGLVEKLFDGCNATLLAYGTTGSGKTYTMVGH 179

Query: 120 EKLYDGELSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLD 171
               DG +      +   +    D  +V+ S   V  S++E+YNE++ DLL+
Sbjct: 180 N---DGIVKMCGDCVFTRMLNAADERQVKRS---VTVSYLEIYNEKICDLLN 225

>CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa]
           {ON} similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155c KIP2 kinesin-related protein
          Length = 672

 Score = 94.4 bits (233), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 98/189 (51%), Gaps = 29/189 (15%)

Query: 268 AIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLY-KNFNGET 326
            + +  L +     ++E L  + KG  +R+ + T+ N  SSRSH I  + L  K+     
Sbjct: 268 GVRVVGLTQKRCDTSEEVLDWINKGNKNRKTSETEFNTRSSRSHAIVMIRLISKDIRTGE 327

Query: 327 FRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVIN--------------- 371
             +  ++L DLAGSE   R   QN+R KE   IN+SLL LG VI+               
Sbjct: 328 QNIRTLSLCDLAGSE---RGVGQNERRKEGAFINRSLLALGTVISRLSAENNGSHHTGRA 384

Query: 372 -----SLADKNA-----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTL 421
                SLA  N      HIP+R+SKLTRLLQ +L G++    + TI  A  +S ET +TL
Sbjct: 385 ANSQQSLASPNGSSSGNHIPYRDSKLTRLLQPALSGDSVVVALCTIDLAHESSSETLNTL 444

Query: 422 EYATKAKNI 430
            +A+++KN+
Sbjct: 445 RFASRSKNV 453

 Score = 77.4 bits (189), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 81/158 (51%), Gaps = 18/158 (11%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +T D VF        ++ +   P+    I+GYN T+  YGMT +GKT+TM+G E      
Sbjct: 133 FTFDHVFSTGCSNFDIYGKTTQPLIDRLIEGYNATIFAYGMTGSGKTFTMSGTE------ 186

Query: 127 LSEAAGIIPRVLFKLFDTL------EVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNN 180
             E  G+IP  +  LF +L      E ++S+  V  S++E+YNE++ DLLD    S   N
Sbjct: 187 --EEKGLIPLSVSYLFSSLLEKTNTENEKSEVWV--SYLEIYNEKINDLLDVASGSNVQN 242

Query: 181 SRKLRIYDSLNSSNNVTNVNSRSSSRSNSPTVNLEAKR 218
           +   R++ S ++S++  ++  R  S      V L  KR
Sbjct: 243 TPS-RLFTSTHTSSS-GDLKIRDDSECGVRVVGLTQKR 278

>TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.678
           YPL155C
          Length = 468

 Score = 92.0 bits (227), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 56/149 (37%), Positives = 89/149 (59%), Gaps = 10/149 (6%)

Query: 286 LRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGETFRVSKINLVDLAGSENISR 345
           L L+ +G  +R+V ST+ N  SSRSH +  L +  +  G   RV  + L DLAGSE   R
Sbjct: 241 LELVAQGNRNRRVRSTQHNTGSSRSHAVLRLRITDSM-GSKARV--LTLCDLAGSE---R 294

Query: 346 SGAQNQRAK-EAGSINQSLLTLG---RVINSLADKNAHIPFRESKLTRLLQDSLGGNTKT 401
           +   ++  + E G+IN+SL+ LG   R++N     + H+P+R+SKLTRLL+ SL GN   
Sbjct: 295 ASVHDRGLRAEGGAINKSLMALGTVVRLLNETGPSSTHVPYRDSKLTRLLKPSLSGNGLV 354

Query: 402 ALIATISPAKINSEETSSTLEYATKAKNI 430
            ++ T+S +  + E++  TL +A +A  +
Sbjct: 355 TMVCTVSLSGTDYEQSLGTLRFARRASGV 383

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 54/111 (48%), Gaps = 25/111 (22%)

Query: 82  VFKEIADPMFH----DFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSEAAGIIPRV 137
           +F     P+ H    D I G   T++ YG T +GKTYTM G         ++A G I  V
Sbjct: 122 IFVRDCKPLVHRVATDCISG---TIIAYGATGSGKTYTMHG---------TKAEGGI--V 167

Query: 138 LFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKLRIYD 188
              + D L     +  +  S++E+YNE L DLL DG       +++LRI D
Sbjct: 168 QLSIRDLLTQLSKNCQITISYLEIYNERLHDLLCDG-------TKELRILD 211

>NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {ON} 
          Length = 685

 Score = 92.8 bits (229), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 69/191 (36%), Positives = 96/191 (50%), Gaps = 31/191 (16%)

Query: 268 AIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLY-KNFNGET 326
            + +  L E     ++E +  + KG   R+ A T  N  SSRSH I  + L   +    T
Sbjct: 280 GVRVIGLTEKRCESSEELMNWIIKGDKIRKTAETDFNARSSRSHAIVLIRLTTSDMKDGT 339

Query: 327 FRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA---DKN------ 377
              S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L+   +KN      
Sbjct: 340 SISSTLSLCDLAGSE---RATGQQERRKEGAFINKSLLALGTVISKLSTESNKNRSPTLP 396

Query: 378 ------------------AHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSS 419
                              HIP+R+SKLTRLLQ +L G++    I TI     +S ET +
Sbjct: 397 SPPLSSSSSSTSINSSVPGHIPYRDSKLTRLLQPALSGDSIVTTICTIDTKNESSAETLN 456

Query: 420 TLEYATKAKNI 430
           TL +A++AKNI
Sbjct: 457 TLRFASRAKNI 467

 Score = 68.6 bits (166), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 74/162 (45%), Gaps = 25/162 (15%)

Query: 15  ITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVDKVFG 74
           ITVA+R +  +     + SS +V     I  ++V                  +  D VF 
Sbjct: 101 ITVAIRPKPTSNPSDVSTSSWLVTDEKTIAHDDVG----------------EFKFDHVFN 144

Query: 75  PSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSEAAGII 134
                  +++ I  PM     +G+N T+  YGMT +GKTYTM G       E  +  G+I
Sbjct: 145 SFVSNLEIYQVINRPMIDKLFQGFNSTIFAYGMTGSGKTYTMMGCP-----EREQKDGLI 199

Query: 135 PRVLFKLFDTL--EVQESD--YMVKCSFIELYNEELKDLLDD 172
           P  +  LF  +  E  + D  + +  S++E+YNE++ DLL D
Sbjct: 200 PLSVSYLFTKIMEETLDGDKKFEIVLSYLEIYNEKIYDLLGD 241

>TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa]
           {ON} Anc_2.633 YKL079W
          Length = 644

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 80/248 (32%), Positives = 121/248 (48%), Gaps = 44/248 (17%)

Query: 254 QQQQTQGQVNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTI 313
           +Q+  + +++ + S+I I++L+  ++T   E L   +KG   R +AS       SRS  I
Sbjct: 174 EQKPLKLRLDSKKSSISIKNLRCVYVTSLLEALSYCEKG---RSLAS-------SRSSVI 223

Query: 314 FTLTLYKNFN-GETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINS 372
             +T+ +  N  E F+     LVDL  S+ I +        +    INQS++TL  V  S
Sbjct: 224 IRITVEQRDNVKEVFKTGSFQLVDLGSSDKIDKQNNLGISPENTKKINQSMVTLENVARS 283

Query: 373 LA------------DKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSST 420
           LA              N +IP++ES LT+LLQ+++GGN KT L+   S AK + EET +T
Sbjct: 284 LAGTEQSVKNGRPRSGNYYIPYKESCLTQLLQETIGGNCKTTLVLMCSTAKQDEEETLNT 343

Query: 421 LEYATKAKNIK-----NKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSHLH 475
           L +    K +K     NK    S  M D+L+K           DF    +KE  Y SH+ 
Sbjct: 344 LNFGANMKLVKNLFQQNKAGTNSKAMLDLLMK-----------DF---DAKEKNYQSHIQ 389

Query: 476 Y--NEVMN 481
               E+MN
Sbjct: 390 LLEKELMN 397

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 51/114 (44%), Gaps = 11/114 (9%)

Query: 60  ARMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGD 119
           A  N K + VD++F P A        I          GYN  ++ YG T +GKT TM G 
Sbjct: 64  AGQNLKLFRVDQIFNPGAQTKDTTSSIIGDSVAQLFNGYNVAIMAYGQTDSGKTSTMFGY 123

Query: 120 EKLYDGELSEAAGIIPRVLFKLFDTLEVQES---DYMVKCSFIELYNEELKDLL 170
            K          G+I  V  ++F T+E       DY +  S IE+  E ++DLL
Sbjct: 124 NK--------GDGVINGVCKQIFTTVETGSENNIDYSISLSIIEVNCESIRDLL 169

>TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {ON} 
          Length = 672

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 63/169 (37%), Positives = 94/169 (55%), Gaps = 5/169 (2%)

Query: 263 NEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLY-KN 321
           N     I + H ++  I  + +  +L++ G + R   ST MN+ SSRSH++F + +   N
Sbjct: 502 NTHKITIKLTHNEDDEIAKSAQIRQLIRNGNNTRNTKSTHMNNASSRSHSVFMMKITGHN 561

Query: 322 FNGETFRVSKINLVDLAGSENISRSG--AQNQRAKEAGSINQSLLTLGRVINSLADKNAH 379
              +     ++NLVDLAGSE + +       +  KE  SIN+SL  L  VI+S+  +  +
Sbjct: 562 RITQEHSTGRLNLVDLAGSERLQQQEQITSQETLKETTSINKSLTCLADVIHSMKHRQPY 621

Query: 380 IPFRESKLTRLLQDSLGGNTKTALIATISPAKINS-EETSSTLEYATKA 427
           IPFR SKLT LL++SL   +KT +   ISP  INS  ET ++L  A K 
Sbjct: 622 IPFRNSKLTYLLKNSLINKSKTLMYVNISP-NINSIRETINSLRLARKV 669

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 55/108 (50%), Gaps = 14/108 (12%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +T DK+FG   D   VF +I + +    + GYN  +  YG T +GKTYTM          
Sbjct: 384 FTFDKIFGMQDDNYEVFDDIKN-LVQSSLDGYNVCIFTYGQTGSGKTYTM---------- 432

Query: 127 LSEAAGIIPRV---LFKLFDTLEVQESDYMVKCSFIELYNEELKDLLD 171
           L+E  GII +    +      L     +Y ++  FIE+YNE ++DLL+
Sbjct: 433 LNEKDGIIMQTIEYIVHFAGNLHKLGWEYELEVEFIEIYNETIRDLLN 480

>Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {ON}
           complement(20458..22401) [1944 nt, 648 aa]
          Length = 647

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 57/174 (32%), Positives = 88/174 (50%), Gaps = 15/174 (8%)

Query: 304 NDVSSRSHTIFTLTLYK-NFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQS 362
           N++  RSHTI  +++ K N   E+  +S + +VDLAGS+ I ++ +     ++A  IN  
Sbjct: 225 NNLIQRSHTIMEVSIEKRNKLDESITMSSLYIVDLAGSDPIGKNSSSGITTEDAKKINHQ 284

Query: 363 LLTLGRVINSLADKNAH-------------IPFRESKLTRLLQDSLGGNTKTALIATISP 409
           + ++  VIN L   N               +P++ S LTRLL D LGGN KT  + T S 
Sbjct: 285 IKSVNDVINGLVVMNREGGIMTDISTLMHKVPYKSSILTRLLLDPLGGNCKTTFLLTSSL 344

Query: 410 AKINSEETSSTLEYATKAKNIKNKPQLGSFMMKDILVKNISHELAKLKSD-FLS 462
            K +  ET STL++    K+    P++  F +      +I     KLK D F+S
Sbjct: 345 KKNDWNETLSTLKFGYNCKSANTNPRINRFGLNSKATMDIFLTDMKLKEDNFIS 398

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 62/111 (55%), Gaps = 16/111 (14%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           Y  DKVF  S D  +  +E  +      ++GYN +++ YG + TGK++ + G+++     
Sbjct: 73  YKFDKVFA-SNDTGVEHQEFIESNLESLLQGYNTSIVTYGQSGTGKSFELYGEQQ----- 126

Query: 127 LSEAAGIIPRVLFKLFDTLEVQESD------YMVKCSFIELYNEELKDLLD 171
                G+I ++L KLF+ ++ +  +      Y VK SF+E+Y E++ DL+D
Sbjct: 127 ----DGLIFQLLTKLFNRIDEEMGNNNKNIHYTVKFSFLEVYQEKMFDLMD 173

>YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Protein
           that interacts with Myo2p, proposed to be involved in
           exocytosis; N-terminal domain is related to the motor
           domain of kinesins
          Length = 656

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 66/129 (51%), Gaps = 12/129 (9%)

Query: 46  NEVSINTSGDIGITARMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVY 105
           N V   T+  +  T +    T+  DKVF  +A Q  V K +  P+ +D + GYN T++ Y
Sbjct: 54  NTVLFRTNNPLHETTKETHSTFQFDKVFDANATQEDVQKFLVHPIINDVLNGYNGTVITY 113

Query: 106 GMTSTGKTYTMTGDEKLYDGELSEAAGIIPRVLFKLFDTLEVQES----DYMVKCSFIEL 161
           G + +GK+Y++ G +        E+ GI+P +   LFDTLE  E      + V     E+
Sbjct: 114 GPSFSGKSYSLIGSK--------ESEGILPNICKTLFDTLEKNEETKGDSFSVSVLAFEI 165

Query: 162 YNEELKDLL 170
           Y E+  DLL
Sbjct: 166 YMEKTYDLL 174

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/137 (33%), Positives = 69/137 (50%), Gaps = 13/137 (9%)

Query: 308 SRSHTIFTLTL-YKNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 366
           SRSH +F L +  +N   +  + S + LVDL G+E   +             +NQS+  L
Sbjct: 233 SRSHLVFQLHVEQRNRKDDILKNSSLYLVDLHGAEKFDKRTESTLSQDALKKLNQSIEAL 292

Query: 367 GRVINSLA---------DKNAHI-PFRESKLTRLLQDSLGGNTKTALIATISPAKINSEE 416
              + SL+          K +H   +RES+LT +L+DSLGGN KT +I T   + + +  
Sbjct: 293 KNTVRSLSMKERDSAYSAKGSHSSAYRESQLTEVLKDSLGGNRKTKVILTCFLSNVPT-- 350

Query: 417 TSSTLEYATKAKNIKNK 433
           T STLE+    + I NK
Sbjct: 351 TLSTLEFGDSIRQINNK 367

>Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa]
           {OFF} YPR141C (KAR3) - kinesin-like nuclear fusion
           protein [contig 452] PARTIAL
          Length = 588

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 61/200 (30%), Positives = 92/200 (46%), Gaps = 34/200 (17%)

Query: 12  ELNITVAVRCRGR----NEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSK-- 65
           EL   + V CR R    NEKE    SS+ ++     G +    + +G   IT +  +K  
Sbjct: 358 ELRGNIRVFCRLRPHLDNEKE--DSSSISID-----GFS----DENGTQCITIKREAKYH 406

Query: 66  TYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDG 125
            +T D+ FG       +F EI   +    + GYN  +  YG T +GKTYTM         
Sbjct: 407 KFTFDRCFGAQESNKDIFHEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM--------- 456

Query: 126 ELSEAAGIIPRVLFKLF---DTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSR 182
            L+   GIIP  L  +F   + L+     Y +   FIE+YNE +KDL  D      + S 
Sbjct: 457 -LNPEDGIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNENIKDLFKDHDTENDDGSE 515

Query: 183 KLR---IYDSLNSSNNVTNV 199
            L+    +DS + + ++TN+
Sbjct: 516 ALKHEIRHDSDSQTTHITNI 535

>Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)
           [1974 bp, 657 aa] {ON} ANNOTATED BY YGOB -
          Length = 657

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 94/203 (46%), Gaps = 34/203 (16%)

Query: 9   EGDELNITVAVRCRGR----NEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNS 64
           E  EL   + V CR R    NEKE    SS+ ++     G +    + +G   IT +  +
Sbjct: 355 ELQELRGNIRVFCRLRPHLDNEKE--DSSSISID-----GFS----DENGTQCITIKREA 403

Query: 65  K--TYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKL 122
           K   +T D+ FG       +F EI   +    + GYN  +  YG T +GKTYTM   E  
Sbjct: 404 KYHKFTFDRCFGAQESNKDIFHEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTMLNPED- 461

Query: 123 YDGELSEAAGIIPRVLFKLFDTLE-VQE--SDYMVKCSFIELYNEELKDLLDDGQDSGGN 179
                    GIIP  L  +F  +E ++E    Y +   FIE+YNE +KDL  D      +
Sbjct: 462 ---------GIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNENIKDLFKDHDTENDD 512

Query: 180 NSRKLR---IYDSLNSSNNVTNV 199
            S  L+    +DS + + ++TN+
Sbjct: 513 GSEALKHEIRHDSDSQTTHITNI 535

>TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {ON}
           Anc_2.633 YKL079W
          Length = 682

 Score = 72.0 bits (175), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 60/215 (27%), Positives = 107/215 (49%), Gaps = 16/215 (7%)

Query: 268 AIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYK-NFNGET 326
            + + +L++ H+   KE L    + +S   V ++K ++   R++TIF + + K +   E+
Sbjct: 208 GLPVDNLRQVHVASFKETLYYFNQAMS---VLNSKHDNSFPRTNTIFNINIEKLDKLDES 264

Query: 327 FRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD------KNAH- 379
              S I LVDLAGS+ I R  +    +++   IN S+ ++  +I SL+       KN   
Sbjct: 265 TTSSSIYLVDLAGSDLIDRKNSSGVNSEDVKRINSSIKSVQNIITSLSKLSYSDYKNYEF 324

Query: 380 -----IPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKP 434
                +P+  SKL +LL++ LGGN KT  + TIS      ++    L+  T  ++ K  P
Sbjct: 325 SLENSVPYDSSKLGKLLKEPLGGNCKTNFLFTISMNPEQYDDIIEALQLGTILQDSKTVP 384

Query: 435 QLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGI 469
           Q+  F + +    +I+ E  KLK +    +  E +
Sbjct: 385 QINKFGLNENKTLSIALENFKLKENNFKIQQAESV 419

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 58/106 (54%), Gaps = 14/106 (13%)

Query: 72  VFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSEAA 131
           +F   ++  L+   I   M  + ++GYN  ++ YG   +GKTY+      LY  ++ ++ 
Sbjct: 89  IFDRDSNIDLIGNTIVTGMIDEAMEGYNTALVTYGPKYSGKTYS------LYGNDVDDSF 142

Query: 132 GIIPRVLFK-LFDTLEVQESD------YMVKCSFIELYNEELKDLL 170
           G + +++FK LF  +    +D      ++VK SF+E++ +++ DLL
Sbjct: 143 G-LGQIIFKDLFSRINKSVTDSNAKYTFIVKISFLEVWLDKVVDLL 187

>Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079W
           (REAL)
          Length = 657

 Score = 70.9 bits (172), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 65/124 (52%), Gaps = 19/124 (15%)

Query: 51  NTSGDIGITARMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTST 110
           NT+GD          T+  DKVF  +A Q  V   + DP  +D + GYN T+L YG + +
Sbjct: 67  NTTGD-------THSTFQFDKVFDANATQKDVQDFLLDPTINDVLSGYNSTILTYGPSFS 119

Query: 111 GKTYTMTGDEKLYDGELSEAAGIIPRVLFKLFDTLEVQE----SDYMVKCSFIELYNEEL 166
           GK+Y++ G +   DG      GI+P +   LF TLE +E    +++ V     E+Y E+ 
Sbjct: 120 GKSYSLIGPQ---DG-----GGILPNICKALFSTLEDREKNKGNNFSVSVLAFEIYMEKT 171

Query: 167 KDLL 170
            DLL
Sbjct: 172 YDLL 175

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 69/137 (50%), Gaps = 13/137 (9%)

Query: 308 SRSHTIFTLTL-YKNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 366
           SRSH +F L +  +N   +  + S + L+DL G+E   +             +NQS+  L
Sbjct: 234 SRSHVVFQLHVEQRNRRHDILKNSSLYLIDLHGAEKFDKRIENTLSQDSLKKLNQSIEAL 293

Query: 367 GRVINSL---------ADKNAHIP-FRESKLTRLLQDSLGGNTKTALIATISPAKINSEE 416
              + SL         + K +H   +RES+LT +L+DSLGGN KT +I T   + + +  
Sbjct: 294 KNTVQSLEIKSMDSVYSAKASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLSNVPT-- 351

Query: 417 TSSTLEYATKAKNIKNK 433
           T STL++    + I N+
Sbjct: 352 TLSTLKFGDSIRQINNR 368

>Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 59/109 (54%), Gaps = 12/109 (11%)

Query: 66  TYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDG 125
           T+  DKVF  +A Q  V   + +P   D + GYN T+L YG + +GK+Y++ G +  Y+ 
Sbjct: 74  TFQFDKVFDANATQKDVQDFLVNPTIKDILSGYNSTILTYGPSFSGKSYSLLGSQ--YN- 130

Query: 126 ELSEAAGIIPRVLFKLFDTLEVQE----SDYMVKCSFIELYNEELKDLL 170
                 G++P +   LF+TLE  E    +++ V     E+Y E+  DLL
Sbjct: 131 -----EGVLPNICQVLFETLEENEETKGTNFCVSVLAFEIYMEKSYDLL 174

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 67/137 (48%), Gaps = 13/137 (9%)

Query: 308 SRSHTIFTLTL-YKNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 366
           S+SH +F L +  +N   +  + S + L+DL G+E   +             +NQS+  L
Sbjct: 233 SKSHLVFQLHVEQRNRREDILKNSSLYLIDLHGAEKFEKRTENTLSQDALKKLNQSIEAL 292

Query: 367 GRVINSLADKNAHIPF----------RESKLTRLLQDSLGGNTKTALIATISPAKINSEE 416
             ++  LA KN    +          RES+LT +L+DSLGGN K  +I T   + + +  
Sbjct: 293 KNIVQLLAVKNPDSAYSTKASHSSTYRESQLTEVLRDSLGGNRKMKVILTCFLSNVPT-- 350

Query: 417 TSSTLEYATKAKNIKNK 433
           T STLE+    + I NK
Sbjct: 351 TISTLEFGDNIRQIINK 367

>Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 57/109 (52%), Gaps = 12/109 (11%)

Query: 66  TYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDG 125
           T+  DKVF  +A Q  V   +  P   D + GYN T++ YG + +GK+Y++ G +     
Sbjct: 74  TFKFDKVFDTNATQEDVQDFLVRPSIDDVLSGYNGTIITYGPSFSGKSYSLLGSQ----- 128

Query: 126 ELSEAAGIIPRVLFKLFDTL----EVQESDYMVKCSFIELYNEELKDLL 170
              E  GI+P +   LF+TL    E + +++ V     E++ E+  DLL
Sbjct: 129 ---EGEGILPNICKVLFETLEKNKETKGNNFSVSVLAFEIFMEKTYDLL 174

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 72/137 (52%), Gaps = 13/137 (9%)

Query: 308 SRSHTIFTLTL-YKNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 366
           S+SH +F L +  +N N +  R S + L+DL G+E   +             +NQS+  L
Sbjct: 233 SKSHLVFQLHVEQRNRNADILRKSSLYLIDLHGAERFDKRTEVTLSQDALKKLNQSIEAL 292

Query: 367 GRVIN--SLADKNAHIP--------FRESKLTRLLQDSLGGNTKTALIATISPAKINSEE 416
             ++   S+ D+++           +RES+LT +L+DSLGGN KT +I T   + +++  
Sbjct: 293 KNIVRLLSVKDRDSAYSVKASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLSNVST-- 350

Query: 417 TSSTLEYATKAKNIKNK 433
           T STLE+    + I NK
Sbjct: 351 TLSTLEFGECIRQITNK 367

>KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2.633
           YKL079W
          Length = 522

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 60/116 (51%), Gaps = 8/116 (6%)

Query: 65  KTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYD 124
           +T+++DKVF PSA Q+ V   +  P+  +   G N  M   G + TGKT+TM G + +  
Sbjct: 42  RTFSLDKVFPPSASQADVTAVLLGPIVDNLAHGVNVQMASLGDSQTGKTHTMLGQQGV-- 99

Query: 125 GELSEAAGIIPRVLFKLFDTLEVQES-DYMVKCSFIELYNEELKDLLDDGQDSGGN 179
                + G++ R+L K+F  +   E        S +EL N+++ DLL+     G N
Sbjct: 100 -----SQGLLQRILTKVFQLMNENEGVTVQYSLSAVELVNDKVYDLLNKRSPLGQN 150

>CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa]
           {ON} similar to uniprot|P32364 Saccharomyces cerevisiae
           YKL079w SMY1 kinesin-related protein
          Length = 675

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 72/285 (25%), Positives = 124/285 (43%), Gaps = 42/285 (14%)

Query: 268 AIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYK--NFNGE 325
            +Y Q     +I   KE  R+++    +++ +  KM+   S SH +   ++ +    +G 
Sbjct: 205 GLYYQEANNEYINSIKEFDRVMKLIQDNKEASEKKMDSKRSTSHVVIRCSVEQLDRVHG- 263

Query: 326 TFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL---ADKN----- 377
           T   S I   DL GS    +   Q    +    +N S+  L  V+NS+     KN     
Sbjct: 264 TITSSNIMFADLCGSNRFEKDVDQKLGVENIKKLNLSISNLESVVNSVLQNQQKNHLYIE 323

Query: 378 ------------AHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYAT 425
                         +P+++S+LT L+Q++LGGN++T ++      K + EET +TL +  
Sbjct: 324 NKLVPSVNSSDLQRVPYKDSQLTGLIQEALGGNSRTRVVLNCFDDKSHHEETIATLRFGV 383

Query: 426 KAKNIKNKPQLGSFMMKDILVKNISHELAKLKSDF--LSTKSKEGIYMSHLHYNEVMNDI 483
           + +NI N      F+  D+   N    L  L  +   +     + I +     N++ + +
Sbjct: 384 QLQNILN------FVRADVTGLNSKKTLDLLIDNMKVIENNYDQKITLLESELNKLADTV 437

Query: 484 ------ENYKTEIQESRREIEKLSSQ----NQLLHK-DKKSSQDT 517
                 E  +TEI E   EI+KL  Q     QL +  D K S+DT
Sbjct: 438 KKAKVTEELETEIVEKNDEIKKLREQLETMTQLFNNIDPKESEDT 482

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/63 (23%), Positives = 33/63 (52%)

Query: 58  ITARMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMT 117
           IT   +   +  +KV+        + K +++ +  D   GY+ +++ YG   +GK++T+ 
Sbjct: 78  ITNFADESIFNFEKVYDVGVPLVDIHKSLSESVLKDIYDGYDVSIISYGEAGSGKSFTLF 137

Query: 118 GDE 120
           G+E
Sbjct: 138 GNE 140

>KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.633
           YKL079W
          Length = 667

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 80/306 (26%), Positives = 136/306 (44%), Gaps = 45/306 (14%)

Query: 308 SRSHTIFTLTL-YKNFNGETFRVSKINLVDLAGSENISRSG--AQNQRAKEAGSINQSLL 364
           S+SH I  + +  +N N +  +   I+  DLA  + I +    +    + E   +N    
Sbjct: 219 SKSHLITKINVEQRNLNEDVVKRGSISFFDLAAIDFIDKDSMVSLGLTSDEVKKLNLEST 278

Query: 365 TLGRVINSLAD----KNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSST 420
           TL   I S+++     NA IP++ S LT+LL     GN KT +I T S  K N  ET  T
Sbjct: 279 TLKNSIISMSELSENPNAVIPYKNSNLTKLLNQCFMGNMKTTVILTCSMLKSNEAETLET 338

Query: 421 LEYATKAKNIK-----NKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSHLH 475
           L+   K ++I      NK  L S    D++V+++              KSKE  YM+ + 
Sbjct: 339 LKMGLKLESISSNVHMNKHALNSKKKLDLIVEDM--------------KSKEANYMNRIR 384

Query: 476 ------------YNEVMNDIENYKTEIQESRREIEKLSSQNQLLHK--DKKSSQDTIESQ 521
                       Y E +++  ++K E+ + R +  KL  + ++  K   KK    +  S+
Sbjct: 385 LLETELNDLRASYGEAISETSSFKEEMNKERAKNVKLKEELEVFKKLLQKKGEAQSTHSK 444

Query: 522 RLQIRNLQSSMDYLYEK----IDLKHKNEIELTNMIMKLKDAVRNMQGALKTHEDHEQRL 577
            + + + +  M  L EK     +LK   +IE  +   KL + ++N    L+T +     L
Sbjct: 445 EMPLTDDEEIMQQLIEKSASVAELKATLDIE-KHKSFKLNEVLKNYVEKLQTLKKMNDNL 503

Query: 578 QSDIQK 583
            + I+K
Sbjct: 504 VTRIEK 509

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 52/106 (49%), Gaps = 11/106 (10%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           Y  D V   S +   ++  I   + ++  +GY+  ++ YG   TGK+    G +  Y+G 
Sbjct: 63  YQFDSVHEKSTE---LYNGIKGDLINNIFEGYHTGVITYGSAGTGKSSIFYGTDSTYEG- 118

Query: 127 LSEAAGIIPRVLFKLFDTLEVQESD--YMVKCSFIELYNEELKDLL 170
                G++   +  L+D ++   +D  + V  S IE++ E++ DLL
Sbjct: 119 -----GVVLMFVQDLYDKIDSIGNDTHFTVSLSTIEIHLEKMYDLL 159

>TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.633
           YKL079W
          Length = 803

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 83/167 (49%), Gaps = 18/167 (10%)

Query: 267 SAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNF-NGE 325
           S++ I++L++ ++   +E    L +G S+R      M  ++SRS+ +  + L + F   +
Sbjct: 235 SSLEIENLRQVYVESFEELNSYLIEGRSNRN-----MKHLTSRSNIVIKINLEQVFLEDQ 289

Query: 326 TFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRE- 384
             + S + L+D+A S+ I ++ +    AKEA  +N  + +    IN LA+     P+ + 
Sbjct: 290 LMKCSSLILLDMAASDYIDKNDSLGISAKEAKKLNYPMESFTSYINLLAETGTS-PYDQQ 348

Query: 385 ----------SKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTL 421
                     S L  ++   +GGN KT  I+TISP   N  ET  TL
Sbjct: 349 INGKKSNDYNSNLVDIMSIPIGGNCKTLFISTISPLLANQNETFITL 395

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 67  YTVDKVFGPSADQS-LVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKL 122
           + VDKVF     QS L+  +I      +   G+N +++ +G + TGK++TM G+  L
Sbjct: 51  FQVDKVFDRFTKQSDLLSSDIVKNKISELFDGFNSSIIAFGQSGTGKSFTMFGNNSL 107

>NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633
          Length = 660

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 63/123 (51%), Gaps = 17/123 (13%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGD-EKLYDG 125
           Y  D +F   + ++  +  I D +  D  KGYN T++ YG TS+GK++ + GD +   DG
Sbjct: 86  YQFDSIFDVDSKETEFYDSITDNLIDDISKGYNTTIMTYGPTSSGKSHALFGDPDSTNDG 145

Query: 126 ELSEAAGIIPRVLF-KLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKL 184
            ++  A    R+LF +  D L+      +   S  ELY +++ DLL        NN + L
Sbjct: 146 LINHIAD---RLLFPQCEDNLKT-----LCSISMWELYIDKVYDLL-------LNNGKPL 190

Query: 185 RIY 187
           +++
Sbjct: 191 KVH 193

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 66/131 (50%), Gaps = 14/131 (10%)

Query: 328 RVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK----NAHIPFR 383
           R S I  +DL GS+ +++  A    + +    NQ +  L  +I +L ++    ++H  F+
Sbjct: 251 RCSSITFIDLCGSDLLTKQNASKLSSDDIKKFNQMIYLLQNLIKTLPEEQSTNSSH--FK 308

Query: 384 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMK- 442
           +S L ++L D LGG+TK  L+  I     N+      ++   KAK IKN P +    +  
Sbjct: 309 DSSLNKILMDYLGGDTKMTLVVAIDG---NTGGYEDAVKLGAKAKLIKNYPTMNKIGLNA 365

Query: 443 ----DILVKNI 449
               D+LV+++
Sbjct: 366 KRKMDLLVQDM 376

>TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {ON}
           Anc_2.633 YKL079W
          Length = 693

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 70/134 (52%), Gaps = 7/134 (5%)

Query: 309 RSHTIFTLTLYKNFNGETFRV-SKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLG 367
           RS TI  + L +    E     S I  VDLAGS+  S+   +    + A   N+ + +L 
Sbjct: 265 RSSTILRIKLLQLDEDEDLETQSTICFVDLAGSDRASKDIEKGITREAASKYNRVMDSLN 324

Query: 368 RVINSLADK-----NAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLE 422
            ++ +LA+      N  I +R S LTR+L D L GN KT LI + S  K +  ET STL 
Sbjct: 325 SMVYTLANSESISINKSI-YRNSHLTRILYDLLAGNHKTNLIFSCSLNKDDEYETFSTLG 383

Query: 423 YATKAKNIKNKPQL 436
           +++ A ++ N+ ++
Sbjct: 384 FSSYASSMSNQIKI 397

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 38/74 (51%), Gaps = 8/74 (10%)

Query: 48  VSINTS---GDIGITARMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLV 104
           +++N+S   G +G      S  Y  DK+F P      +   ++    +D  KGYN T + 
Sbjct: 41  ITLNSSVNQGSLG-----GSNQYRFDKIFEPEKPDDEINSTLSFACINDLFKGYNSTYIS 95

Query: 105 YGMTSTGKTYTMTG 118
           YG T TGKTYT+ G
Sbjct: 96  YGQTGTGKTYTLYG 109

>ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar to
           uniprot|Q759X8 Ashbya gossypii ADR145C ADR145Cp and
           weakly similar to YKL079W uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a kinesin
           colocalizes with Myo2p kinesin heavy chain homolog
          Length = 668

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 46/160 (28%), Positives = 79/160 (49%), Gaps = 20/160 (12%)

Query: 308 SRSHTIFTLTL-YKNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 366
           SRS     +T+  +N   ET + S + L+DLA S+ + ++   +    E  S N S+  L
Sbjct: 224 SRSSAFLNITVEQRNKKEETLKHSVLQLIDLASSDKLDKNLKYDISTDEMKSTNSSMQNL 283

Query: 367 GRVINSLAD-----------KNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSE 415
            +V+  L++           K+ H   R S+L + LQ ++GG++KT  +   S  K + E
Sbjct: 284 HQVVYGLSELESPSSKNHSSKHTH---RTSRLAKFLQQAIGGDSKTTAVMLSSTDKADRE 340

Query: 416 ETSSTLEYATKAKNIKNKP-----QLGSFMMKDILVKNIS 450
            T  TL   ++ ++I N P      L S  + D+ +KN+S
Sbjct: 341 NTVITLSLGSRLRSIHNFPVQNKMGLNSKALLDLRLKNMS 380

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 52/108 (48%), Gaps = 12/108 (11%)

Query: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126
           +  +KV+     Q  V ++I      + + G+N +++ +G   +GKTYTM G++      
Sbjct: 68  FRFNKVYDVGVRQQEVCEDIIGDNVMELLAGFNVSIMAFGSEGSGKTYTMFGND------ 121

Query: 127 LSEAAGIIPRVLFKLFDTLEVQESD----YMVKCSFIELYNEELKDLL 170
                GI+ R+   +FD L+    D      +  +F EL+ E + DLL
Sbjct: 122 --HEEGIVQRMCQSIFDQLDKLHEDSGNESTISINFFELFAENVYDLL 167

>NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}
           Anc_2.633
          Length = 598

 Score = 52.0 bits (123), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 63/119 (52%), Gaps = 8/119 (6%)

Query: 327 FRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPF---- 382
           +++S ++ +DL G +  ++   Q     E   +N  + +   +I +L+D  + +P+    
Sbjct: 265 YKLSTLSFIDLYGIDKFTKKDIQ-LTNDEMKKLNTLMSSFQNLITTLSDPKS-LPYTSSL 322

Query: 383 -RESKLTRLLQDSLGGNTKTALIATI-SPAKINSEETSSTLEYATKAKNIKNKPQLGSF 439
            ++S L ++LQD +GGN+KT  I    SP+ I  EE    L++A   K+IKN   +  F
Sbjct: 323 YKDSALNKILQDYIGGNSKTTFIIPFPSPSIIQHEELIEMLKFAMGLKSIKNPLIMNVF 381

 Score = 33.5 bits (75), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 49/94 (52%), Gaps = 15/94 (15%)

Query: 59  TARMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTG 118
           T +++S+ +  D +F  +++Q+   + +      D   GYN + + YG +++GK+ T+  
Sbjct: 61  TLKLDSQDFKFDNIFPTNSEQN---EMLTVSTIKDLFDGYNQSFITYGKSNSGKSDTL-- 115

Query: 119 DEKLYDGELSEAAGIIPRVLF-KLFDTLEVQESD 151
                    +E  G+I R+LF +LF  ++   +D
Sbjct: 116 --------FNEKDGLI-RLLFEQLFKKVQSLTAD 140

>KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633
           YKL079W
          Length = 681

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 54/116 (46%), Gaps = 4/116 (3%)

Query: 59  TARMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTG 118
             ++  ++++  KV    A ++  F E+A  +  D + G NC +  YG      +  M G
Sbjct: 82  VVKLGEQSFSFSKVLNDQATKTEQFTELASKVTDDVLSGINCCVTTYGSGLAADSLVMFG 141

Query: 119 DEKLYDGE---LSEAAGIIPRVLFKLFDTLEVQE-SDYMVKCSFIELYNEELKDLL 170
            +     E    S  +G++ +    +F+ ++    S+Y V  S  E+Y +++ DLL
Sbjct: 142 PQSGNSKEEQDSSRCSGLLQQTCKHIFNAIDSDSTSEYQVSLSLCEVYVDKVFDLL 197

 Score = 32.7 bits (73), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 77/377 (20%), Positives = 148/377 (39%), Gaps = 98/377 (25%)

Query: 307 SSRSHTIFTLTLYK-NFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLT 365
           S +SH    + + + N   +T +   +  V+LA     S   +Q +  K +  +      
Sbjct: 260 SKKSHIFVRMKITQVNELKDTLKEGIVQFVNLASDFKDSPGISQEESKKSSAGV----AL 315

Query: 366 LGRVINSLA-DKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYA 424
           L  V+  L+ D++    ++E+ LT+L+ + L  N KT+ +   S    N  +T   L++ 
Sbjct: 316 LREVVADLSSDESKASRYKEAHLTKLMYEPLMVNFKTSFVLCCSNNSKNRNDTLQLLQFG 375

Query: 425 TKAKNIKNKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIE 484
            + + I+ +     F                     L++K K  +Y+S +   E     E
Sbjct: 376 AQLQQIRTQVSGNVFG--------------------LNSKRKMELYLSDMKLKE-----E 410

Query: 485 NYKTEIQESRREIE---------------------------------KLSSQNQLLH--K 509
           NYK  I+  +R++E                                 KL  Q +LLH  K
Sbjct: 411 NYKERIRFLQRQLESSKNLNNGTAGTTSNKPANPVMDRLMKIQIENFKLKEQVKLLHSLK 470

Query: 510 DKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRNMQGALKT 569
             K+S +T   +++        M  L EK +     +IE+ +      +A+  + G LK 
Sbjct: 471 KAKASGETFNEEKI--------MQTLLEKCEQLATLQIEVDDE----GEAITKLNGKLKL 518

Query: 570 HEDHEQRL---------QSDIQKMLYDNILEYRRKIETKLDNLKQQALEQSFTIDDDINN 620
            E+ +  L         Q + Q+   + ++E+   + ++L++ K           + I  
Sbjct: 519 IEEKDHSLEKMNAKLVEQMNFQEQSLEKVIEHNSVLVSELNHWK-----------NLITT 567

Query: 621 VKDSLETLLETVKKDAI 637
            KD++E L E +K+  I
Sbjct: 568 QKDNIEALEEKLKRLGI 584

>NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON}
           Anc_2.633 YKL079W
          Length = 572

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 57/126 (45%), Gaps = 19/126 (15%)

Query: 308 SRSHTIFTLTL-YKNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 366
           S  HT   ++L   N + ++FR   I  VDL   E++                 Q + +L
Sbjct: 192 STFHTFVKISLQLVNCHEDSFRKCCIEFVDLCAQEDVL----------------QLVCSL 235

Query: 367 GRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATK 426
             V+++  D +  I   +S+  +LL +S+GGN KT  I   S  + N + +  TLE+  K
Sbjct: 236 VAVLSN--DNDKKIGKEKSQFCKLLSNSIGGNRKTTFILACSTLEQNEKISLETLEFGLK 293

Query: 427 AKNIKN 432
              + N
Sbjct: 294 VSQVVN 299

 Score = 40.4 bits (93), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 33/58 (56%), Gaps = 10/58 (17%)

Query: 91  FHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSEAAGIIPRVLFKLFDTLEVQ 148
            ++  +G +C+M+ YG ++TGKT+       L+D    +  GIIP  + +L+  LE Q
Sbjct: 73  INELTRGVDCSMVTYGQSATGKTHV------LFD----QVRGIIPLFIEQLYIYLEAQ 120

>NCAS0C02830 Chr3 (534302..536926) [2625 bp, 874 aa] {ON} Anc_8.401
          Length = 874

 Score = 39.3 bits (90), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 60/132 (45%), Gaps = 12/132 (9%)

Query: 276 EFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGETFRV------ 329
           E  I DA E L    K LS R  A  ++   S     ++ L L +    E          
Sbjct: 367 EIDIDDAIELLGSTFKNLSVRSYAVNRLKKASDTELELYLLQLVQAVCFENISTFSDKTN 426

Query: 330 SKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHI---PFRESK 386
           S+  +VD+ G++++ +S  QN   K    +N SLLTLG+ IN+L      I   P  E  
Sbjct: 427 SEFTIVDMNGTQHLGKS--QNVMPKTT-ELNSSLLTLGKSINNLNLDEMPIVISPLAEFL 483

Query: 387 LTRLLQDSLGGN 398
           + R L++S  GN
Sbjct: 484 IRRALKNSRLGN 495

>Skud_4.52 Chr4 complement(90001..90984) [984 bp, 327 aa] {ON}
           YDL205C (REAL)
          Length = 327

 Score = 36.2 bits (82), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 42/69 (60%), Gaps = 4/69 (5%)

Query: 596 IETKLDNLKQQALEQSFTID-DDINNVKDSLETLLETVKKDAIIMCENLAQKVVGDQPKF 654
           +E+K +   ++ L ++  +D D    V+D +E L+E VK+D++   +NLA++++ D  K 
Sbjct: 257 VESKYNEETKKLLLKAIVVDVDGTEAVEDEIEMLIENVKEDSMACGKNLAERMIADGAK- 315

Query: 655 FNSMLSELN 663
              +L E+N
Sbjct: 316 --KILDEIN 322

>Ecym_5291 Chr5 (586479..593942) [7464 bp, 2487 aa] {ON} similar to
           Ashbya gossypii AEL006W
          Length = 2487

 Score = 35.4 bits (80), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 34/61 (55%), Gaps = 7/61 (11%)

Query: 551 NMIMKLKDAVRNMQGALKTHEDHEQRL------QSDIQKMLYDNILEYRRKIETKL-DNL 603
           N++MKL    RN++   K+ E H++ L       +D QK+ ++ +L Y+  +  K  DNL
Sbjct: 830 NLLMKLVGKFRNIKAVYKSEELHQRLLILLGSRTTDAQKLSFEALLAYKEPVVVKYKDNL 889

Query: 604 K 604
           K
Sbjct: 890 K 890

>KLTH0D04928g Chr4 complement(447820..448797) [978 bp, 325 aa] {ON}
           highly similar to uniprot|P32332 Saccharomyces
           cerevisiae YKL120W OAC1 Mitochondrial inner membrane
           transporter transports oxaloacetate sulfate and
           thiosulfate member of the mitochondrial carrier family
          Length = 325

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%)

Query: 255 QQQTQGQVNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMND 305
           + Q QG+++ +S  IY    Q   I    EG+R LQKGLS   +    +N 
Sbjct: 51  RMQLQGEMSAESQRIYKNPWQSLKIIFKNEGIRGLQKGLSCAYIYQIGLNG 101

>ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] {ON}
            similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1413

 Score = 34.3 bits (77), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 61/125 (48%), Gaps = 1/125 (0%)

Query: 464  KSKEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSSQNQLLHKDKKSSQDTIESQRL 523
            K++  I  SH    E   D+EN+  EIQ  +  IE L      +H+   S Q T E    
Sbjct: 993  KTENEINKSHKMKLETSRDLENFNQEIQTLKTTIEGLQDSLNKVHESVTSVQHTKEGLIE 1052

Query: 524  QIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRNMQGALKTHEDHEQRLQ-SDIQ 582
            + R L+  ++ + E I +    E+E+ N + KL     +++  +K +E+    L+  D+ 
Sbjct: 1053 ESRTLEDKLNDINEDIAIFKSFEMEMKNELEKLNSLSFHLKKEIKHYEEKLGDLKIRDVT 1112

Query: 583  KMLYD 587
            ++L+D
Sbjct: 1113 QILHD 1117

>Suva_4.43 Chr4 complement(81094..82077) [984 bp, 327 aa] {ON}
           YDL205C (REAL)
          Length = 327

 Score = 33.5 bits (75), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 41/69 (59%), Gaps = 4/69 (5%)

Query: 596 IETKLDNLKQQALEQSFTID-DDINNVKDSLETLLETVKKDAIIMCENLAQKVVGDQPKF 654
           +ET+ +   ++ L ++  +D D    V+D +E L+E VK+D++   + LA++++ D  K 
Sbjct: 257 VETRYNEKTKKLLLKAIVVDVDGTEAVEDEIEMLIENVKEDSMACGKILAERMIADGAK- 315

Query: 655 FNSMLSELN 663
              +L E+N
Sbjct: 316 --KILDEIN 322

>KNAG0A03050 Chr1 complement(374568..375266) [699 bp, 232 aa] {ON}
           Anc_8.653 YOR232W
          Length = 232

 Score = 33.1 bits (74), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 55/117 (47%), Gaps = 3/117 (2%)

Query: 529 QSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRNMQGALKTHEDHEQRLQSDIQKMLYDN 588
           Q  +  L E+++ K K  ++L + +++     RN+QG   T +D E+     +QK   D 
Sbjct: 68  QQKIKTLEEQLETKEKENVDLKDRLLRSVADFRNLQGV--TKKDVEKAKAFALQKFAKD- 124

Query: 589 ILEYRRKIETKLDNLKQQALEQSFTIDDDINNVKDSLETLLETVKKDAIIMCENLAQ 645
           +LE        L   K++ L++S  I D    VK + E    T++K  I   + L +
Sbjct: 125 LLESVDNFGHALGAFKEEDLKKSKEISDLYTGVKMTKEVFENTLRKHGIEKVDPLGE 181

>TPHA0K02220 Chr11 (473969..476431) [2463 bp, 820 aa] {ON} Anc_4.23
           YLL034C
          Length = 820

 Score = 33.5 bits (75), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 26/41 (63%), Gaps = 1/41 (2%)

Query: 820 LCHFQDRNDIANMTTNINGT-VDDIKNKHSVLRDELEKNVS 859
           L +FQ++ DI N  T +NGT +DD  N   ++RD+  KN S
Sbjct: 690 LPNFQEKLDIINTITKVNGTPLDDSVNLSEIIRDDRCKNFS 730

>KLTH0H14806g Chr8 (1285442..1285493,1285556..1286544) [1041 bp, 346
           aa] {ON} similar to uniprot|Q06675 Saccharomyces
           cerevisiae YDR318W MCM21 Protein involved in
           minichromosome maintenance component of the COMA complex
           that bridges kinetochore subunits that are in contact
           with centromeric DNA and the subunits bound to
           microtubules
          Length = 346

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 37/85 (43%), Gaps = 15/85 (17%)

Query: 835 NINGTVDDIKNKHSVLRDELE---KNVSFIHASSEGFKAIDSSLKRIMNFRMPEGKTETL 891
           ++N  +  +KNK  VL DEL+   K VS +    EG    +  LK             TL
Sbjct: 13  SLNAEILQLKNKCRVLEDELQAQKKGVSEVPVEFEGLFQKNPELKH------------TL 60

Query: 892 ADDLIKHIDSSSVAPVASSGKTPLR 916
           +  + K  DS    P +S  K PL+
Sbjct: 61  SQKIFKETDSFPQTPYSSPKKRPLK 85

>KAFR0D03070 Chr4 (606943..607908) [966 bp, 321 aa] {ON} Anc_2.451
           YKL120W
          Length = 321

 Score = 33.1 bits (74), Expect = 3.1,   Method: Composition-based stats.
 Identities = 17/41 (41%), Positives = 23/41 (56%)

Query: 253 QQQQQTQGQVNEQSSAIYIQHLQEFHITDAKEGLRLLQKGL 293
           Q Q +    V+ Q++ IY   LQ F +    EG+R LQKGL
Sbjct: 45  QLQGELSSAVSAQANHIYRNPLQAFRVIFKNEGIRGLQKGL 85

>SAKL0G18458g Chr7 (1591284..1593578) [2295 bp, 764 aa] {ON} similar
           to uniprot|P38883 Saccharomyces cerevisiae YHR197W RIX1
           RIbosome eXport essential protein
          Length = 764

 Score = 33.5 bits (75), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 32/61 (52%), Gaps = 1/61 (1%)

Query: 780 CDSLSNKFKDDTTESLNSLKSHMESTVRESSLIADKIKDNLCHFQDRNDIANMTTNINGT 839
           CDS+  +F D   + +N+L +HM   + E ++    +  +L   QD+  + +M  N+N  
Sbjct: 423 CDSIKQEFFD-LLKLVNALSAHMGHCINEVTIFTKLVDVSLYLLQDKTSLDSMFANLNVN 481

Query: 840 V 840
           V
Sbjct: 482 V 482

>Skud_4.196 Chr4 (341072..346450) [5379 bp, 1792 aa] {ON} YDL058W
            (REAL)
          Length = 1792

 Score = 33.5 bits (75), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 60/314 (19%), Positives = 139/314 (44%), Gaps = 30/314 (9%)

Query: 439  FMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIE--NYKTEIQESRRE 496
            F   DILV  ++ +L  L +++   ++     ++ +   +  N ++  N +++     +E
Sbjct: 950  FQSHDILVAKLTEKLKSLANNYRDLQATHESLIASMEEIKKENTMQMSNLESKFDSLSQE 1009

Query: 497  IEKLSSQNQLLHKDKKSSQDTIESQRL-----------QIRNLQSSMDYLYEKIDLKHKN 545
             E   S+ +LL ++ +  ++TI +  L              + +S +  L E+++     
Sbjct: 1010 KESFQSERELLEENIRKLKETISTLELTKEEAITKFNSSKEDYESQIGLLKEQLETVATE 1069

Query: 546  EIELTNMIMKLKDAVRNMQGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQ 605
              E  N I +L   + +++G L+T ++ +  L++          LE  +K+  +    +Q
Sbjct: 1070 NGESVNKISELSHNIDDLKGELETQKNFKDDLEAK---------LEASKKVLKETQANEQ 1120

Query: 606  QALEQSFTIDDDINNVKDSLETL------LETVKKDAIIMCENLAQKVVGDQPKFFNSML 659
               E+   ++ +I  +K+ L+ L      LE   K+++   E   +K + D+ K +N  L
Sbjct: 1121 HLKEEKLQLEGEITKIKEQLDNLRDNLKSLEKENKESVAQVEEY-KKQISDKEKEYNGKL 1179

Query: 660  SELNDMFSKVDEHTDRLKEGLSQITAENNNL-KAYLDTHFFRNNHQEILNVHADKTYHQL 718
            SELN+  + V +  + + +   ++  E   + KA  D    + +  E LN   ++     
Sbjct: 1180 SELNNEINSVQQKNETICQNNEKLKGEIEEIEKASEDQSNLKGSKIEALNAQIEELEESK 1239

Query: 719  NLSSKHLMSKITNI 732
             ++   L+  + N+
Sbjct: 1240 QITETKLLDSVKNM 1253

>ZYRO0D10032g Chr4 complement(847175..847804) [630 bp, 209 aa] {ON}
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 209

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 37/79 (46%), Gaps = 8/79 (10%)

Query: 208 NSPTVNLEAKRRIRAGALYKPKPKLPTQSQSNG--------QQQQQQQQQQQQQQQQQTQ 259
           N+ +  L A R+ R   L  P+P LPTQ   +G        QQ ++   +Q+ Q  ++  
Sbjct: 39  NAESKELAAGRKPRVYQLEAPEPSLPTQDDKHGNQLMNYTIQQYEEWNSRQRDQTNKRDS 98

Query: 260 GQVNEQSSAIYIQHLQEFH 278
           G + + +   Y + L + H
Sbjct: 99  GNLQDMAKYTYDKELNKLH 117

>KAFR0F03020 Chr6 (595158..597632) [2475 bp, 824 aa] {ON} Anc_4.46
           YLR309C
          Length = 824

 Score = 32.7 bits (73), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 64/236 (27%), Positives = 112/236 (47%), Gaps = 48/236 (20%)

Query: 488 TEIQESRREIEKLSSQ-----NQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLK 542
           TE++ S+ E +KLSSQ     N+L+ K+K     T+     QI+    + + + + +DL 
Sbjct: 415 TEVKTSKNETDKLSSQLNQVKNKLIQKEK-----TVIYLEKQIKEYAENQEPVKQAMDLL 469

Query: 543 HKNEIELTNMIMKLKDAVRNMQGALK----THEDH-------EQRLQSDIQKMLYDNILE 591
            +   +L+N I  LK+   ++   LK    T+ED+        +R+  DI +  YD +  
Sbjct: 470 KRENKQLSNRIDLLKNENESLNNDLKKNSSTYEDYLKENGKLTERI--DILQEKYDTLQN 527

Query: 592 YRRKIETKLDNLKQQALEQSFTIDDDINNVKDSLETLLETVKKDAIIMCENLAQ--KVVG 649
            +      +D++K+Q  E          NVK      L    K  I + + L+    ++ 
Sbjct: 528 LKNNSSDHMDSIKKQCEEL---------NVK------LREANKKIISLEDELSDYTSIIQ 572

Query: 650 DQPKFFNSM---LSEL-NDMFSKVDEHTDRLKEGLSQITAENNNLKAYLDTHFFRN 701
           D+ +  ++M   LSE  ND  +K+DE    ++  L+ +  ENNNLK+ L+    RN
Sbjct: 573 DKAREADTMRRLLSESNNDEKNKLDE----METKLNSMIDENNNLKSELNLQSSRN 624

>TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {ON}
           Anc_4.237 YLR383W
          Length = 1119

 Score = 32.7 bits (73), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 55/104 (52%), Gaps = 8/104 (7%)

Query: 584 MLYDNILEYRRKIETKLDNLKQQALEQSFTIDDDINNVKDSLETLLETVKKDAIIMCENL 643
           + Y+N ++   +I   LD + ++A       D+ +N++  S ++L E   K+ +I  E+L
Sbjct: 787 IAYENSIQ---QIRNNLDQITEEAQPLKVNFDETLNDLTASQKSLKEA--KEEVINRESL 841

Query: 644 AQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKEGLSQ--ITA 685
            +K   D  K ++  +    D+  K+DE+   L+EG+ +  ITA
Sbjct: 842 MEKYQYD-LKIYSEKIKSYTDIIKKIDENVQSLEEGIEKQVITA 884

>NDAI0J02540 Chr10 complement(627186..629306) [2121 bp, 706 aa] {ON}
           Anc_4.301 YLR424W
          Length = 706

 Score = 32.7 bits (73), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 69/142 (48%), Gaps = 23/142 (16%)

Query: 474 LHYNEVMNDIENYKTEIQESRREIEKLSSQ------NQLLHKDKKSSQDT----IESQRL 523
           L  NE++N++  +++E +    +IE L SQ       + L +D KS   T    IE+   
Sbjct: 184 LALNEIVNELMLFQSESKSLDYQIEALQSQLEDLEVKETLFQDIKSLWSTTDNKIETVAQ 243

Query: 524 QIRNLQSS------MDYLYEKIDLK------HKNEIELTNMI-MKLKDAVRNMQGALKTH 570
           +IR +         M  L+ ++ LK      + N +E+ N+I M+L   V ++   + T 
Sbjct: 244 KIRIIDDDLLVDKLMAQLFSEVFLKDIGKLDNWNPLEIDNIILMQLDPIVTDLTYRMDTD 303

Query: 571 EDHEQRLQSDIQKMLYDNILEY 592
             H  R Q+ + K++++ +L Y
Sbjct: 304 SKHLNRTQTIVFKIIFNKLLAY 325

>Kwal_26.7653 s26 complement(459583..460560) [978 bp, 325 aa] {ON}
           YKL120W (OAC1) - 1:1 [contig 55] FULL
          Length = 325

 Score = 32.0 bits (71), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 26/51 (50%)

Query: 255 QQQTQGQVNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMND 305
           + Q QG+++  +  IY   +Q   +    EG+R LQKGLS   +    +N 
Sbjct: 51  RMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKGLSCAYIYQIGLNG 101

>Kpol_1037.47 s1037 (114295..118818) [4524 bp, 1507 aa] {ON}
           (114295..118818) [4524 nt, 1508 aa]
          Length = 1507

 Score = 32.3 bits (72), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 5/68 (7%)

Query: 467 EGIYMSHLHYNEVMNDIENYKTEI-QESRREIEKLSSQNQLLHKDKKSSQDTI----ESQ 521
           E  + S   + ++++DIE YKTE+  E  REI  +S + +     +KSS  T+    + +
Sbjct: 442 ESYWKSSPEFKQLLSDIETYKTEVDPEKTREIYTMSLKQEKTKWTRKSSYYTVSFPEQVK 501

Query: 522 RLQIRNLQ 529
              IR  Q
Sbjct: 502 LCTIRGFQ 509

>Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON}
            YIL149C (REAL)
          Length = 1680

 Score = 32.0 bits (71), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 77/156 (49%), Gaps = 23/156 (14%)

Query: 428  KNIKNKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYK 487
            K++KN  +    + K+++  N+  E+++L+   + TK +  I     + N+V+     Y+
Sbjct: 1186 KSLKNVTEKNEAIYKELI--NMQEEISRLQGHLIQTKEQVSI-----NANKVLA----YE 1234

Query: 488  TEIQESRREIEKLSSQNQLLHKDKKSSQDTI----ESQRLQIRNLQSSMD--------YL 535
            +EI++ ++  + LS Q +L HK++      +    E + L ++N  + ++          
Sbjct: 1235 SEIEQCKQRYQDLSQQQKLTHKNETEKLHNVIGDLEVKLLNVQNANADLENKFNRLKKQA 1294

Query: 536  YEKIDLKHKNEIELTNMIMKLKDAVRNMQGALKTHE 571
            +EK+D   K +  LTN + +LK+    ++  L   E
Sbjct: 1295 HEKLDASKKQQTALTNELNELKETKDKLEENLHNEE 1330

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.126    0.340 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 100,881,529
Number of extensions: 4712431
Number of successful extensions: 102924
Number of sequences better than 10.0: 2928
Number of HSP's gapped: 70520
Number of HSP's successfully gapped: 7253
Length of query: 965
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 846
Effective length of database: 39,836,145
Effective search space: 33701378670
Effective search space used: 33701378670
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 71 (32.0 bits)