Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D01023g6.15ON26826812151e-170
SAKL0E01056g6.15ON2692158551e-115
ACR011C6.15ON2532158401e-113
KAFR0A050606.15ON2692168131e-109
KLTH0C11352g6.15ON2682148071e-108
Kwal_56.223996.15ON2742208041e-107
NDAI0I022506.15ON2712177881e-105
Suva_15.1796.15ON2592157871e-105
KNAG0F028806.15ON2692187851e-105
Kpol_1045.746.15ON2572177831e-104
CAGL0E02673g6.15ON2632107751e-103
Skud_15.1656.15ON2572167631e-101
ZYRO0C07920g6.15ON2932157591e-100
Ecym_30196.15ON2662157551e-100
Smik_15.1736.15ON2512157511e-100
NCAS0D026606.15ON2612147431e-98
YOR004W (UTP23)6.15ON2542107394e-98
TDEL0G045406.15ON2452147307e-97
TPHA0J002806.15ON2712157051e-92
TBLA0A072906.15ON2591866335e-82
ZYRO0A06754g5.392ON1891481768e-15
KLTH0E02860g5.392ON1891481742e-14
Kwal_55.200895.392ON1891481733e-14
Kpol_1055.185.392ON1891481681e-13
SAKL0G07766g5.392ON1891481644e-13
AEL102W5.392ON1891481645e-13
TPHA0D023105.392ON1891481636e-13
NDAI0C045505.392ON1891481636e-13
Skud_4.6065.392ON1891481636e-13
KNAG0C052705.392ON1891481637e-13
CAGL0M01056g5.392ON1891481637e-13
Suva_2.5095.392ON1891481637e-13
TDEL0E023305.392ON1891461627e-13
Ecym_74695.392ON1891481627e-13
Smik_4.5995.392ON1891481627e-13
NCAS0F030905.392ON1891481628e-13
YDR339C (FCF1)5.392ON1891481628e-13
KAFR0D042805.392ON1891481582e-12
TBLA0H017505.392ON1891461541e-11
KLLA0A07018g5.392ON1891451503e-11
Skud_10.3137.463ON1420156810.10
KAFR0K02390na 1ON91093684.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D01023g
         (268 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar t...   472   e-170
SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar t...   333   e-115
ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON} Sy...   328   e-113
KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {...   317   e-109
KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {O...   315   e-108
Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W...   314   e-107
NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15...   308   e-105
Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W...   307   e-105
KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON...   306   e-105
Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {...   306   e-104
CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar...   303   e-103
Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W...   298   e-101
ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {O...   296   e-100
Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to A...   295   e-100
Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W...   293   e-100
NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON...   290   1e-98
YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}  UTP23Compo...   289   4e-98
TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON...   285   7e-97
TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15 ...   276   1e-92
TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6....   248   5e-82
ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly ...    72   8e-15
KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly ...    72   2e-14
Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C...    71   3e-14
Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON...    69   1e-13
SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly ...    68   4e-13
AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic hom...    68   5e-13
TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON...    67   6e-13
NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {...    67   6e-13
Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {O...    67   6e-13
KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5....    67   7e-13
CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly...    67   7e-13
Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}...    67   7e-13
TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.39...    67   7e-13
Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON} ...    67   7e-13
Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {O...    67   7e-13
NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON...    67   8e-13
YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON} ...    67   8e-13
KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.39...    65   2e-12
TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.39...    64   1e-11
KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {O...    62   3e-11
Skud_10.313 Chr10 (556128..560390) [4263 bp, 1420 aa] {ON} YJR09...    36   0.10 
KAFR0K02390 Chr11 complement(493521..496253) [2733 bp, 910 aa] {...    31   4.6  

>KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 268

 Score =  472 bits (1215), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 233/268 (86%), Positives = 233/268 (86%)

Query: 1   MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPM 60
           MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPM 60

Query: 61  ITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHRYVVA 120
           ITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHRYVVA
Sbjct: 61  ITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHRYVVA 120

Query: 121 TQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKFAGIA 180
           TQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKFAGIA
Sbjct: 121 TQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKFAGIA 180

Query: 181 RDENDEAGAENQENKPKKRKGPKEPNPLSMKKKKXXXXXXXXXXXXXXXXXXXXPTEAGD 240
           RDENDEAGAENQENKPKKRKGPKEPNPLSMKKKK                    PTEAGD
Sbjct: 181 RDENDEAGAENQENKPKKRKGPKEPNPLSMKKKKTTESTGSISSLSASSNNISTPTEAGD 240

Query: 241 VSGTXXXXXXXXXXXXXXXPNDSADSIQ 268
           VSGT               PNDSADSIQ
Sbjct: 241 VSGTSKNKRRRKHKKSNDKPNDSADSIQ 268

>SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 269

 Score =  333 bits (855), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 155/215 (72%), Positives = 186/215 (86%), Gaps = 1/215 (0%)

Query: 1   MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPM 60
           MRQKRAKSYRKQMLVYNHTFKFR+PYQVLVDDQ+V+ T+ SSFD  KGL+RTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQMLVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHRYVVA 120
           ITQCCMQ+LY T +QGAI+  K +ERRRCNH PKE K+ LEC+ SVV+ NGKNKHRYVVA
Sbjct: 61  ITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKESKTSLECIESVVNFNGKNKHRYVVA 120

Query: 121 TQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKFAGIA 180
           TQD++IRR+LR++PGVPL+YMNRSVMVMEPLS ASE++S+  EE+KL+KGLNDPK AG+A
Sbjct: 121 TQDIDIRRKLRRVPGVPLIYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKHAGLA 180

Query: 181 RDEN-DEAGAENQENKPKKRKGPKEPNPLSMKKKK 214
            DE+ D   +  Q+   KK+ GPKEPNPLS+K+K+
Sbjct: 181 HDESVDLVDSVKQKQPSKKKGGPKEPNPLSVKRKR 215

>ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR004W
          Length = 253

 Score =  328 bits (840), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 158/215 (73%), Positives = 183/215 (85%), Gaps = 3/215 (1%)

Query: 1   MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPM 60
           MRQKRAK+Y+KQMLVYNHTFKFR+PYQVLVDDQ+VLET  SSFD +KGL+RTLQAEVKPM
Sbjct: 1   MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHRYVVA 120
           ITQCCMQ LY T NQ AI  GK +ERRRCNH  KEPK  +ECL SVV VNG+N+HRY+VA
Sbjct: 61  ITQCCMQKLYDTKNQDAIAQGKLYERRRCNHV-KEPKEPIECLQSVVAVNGQNRHRYIVA 119

Query: 121 TQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKFAGIA 180
           +QD+ IRR LRK+PGVPLVY+NR+VMVMEPLS+ SE+VSRE E+QKL+KGLNDPK+ GIA
Sbjct: 120 SQDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSREAEKQKLFKGLNDPKYTGIA 179

Query: 181 RDENDEAGAENQENKPK-KRKGPKEPNPLSMKKKK 214
            + +  AGA+  E  P  KRKGPK PNPLSMKK+K
Sbjct: 180 -ENSAPAGAQPAEGAPTLKRKGPKAPNPLSMKKRK 213

>KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  317 bits (813), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 148/216 (68%), Positives = 185/216 (85%), Gaps = 5/216 (2%)

Query: 1   MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPM 60
           MRQKRAKSYRKQ+LVY+HTFKFR+PYQVLVD+++V  + NS+FD VKGL+RTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHRYVVA 120
           ITQCCMQ+LY+T +Q AID  K FERRRCNH PKEPK+ +EC+ SVV+VNGKNKHRYVVA
Sbjct: 61  ITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEPKTPIECVLSVVNVNGKNKHRYVVA 120

Query: 121 TQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKFAGIA 180
           +QD++IRR+LR++PGVPLV+++RSVM+MEPLS+ S K+S  +E++KLYKGLNDPK+AG+ 
Sbjct: 121 SQDIDIRRQLRRVPGVPLVHISRSVMIMEPLSDTSAKISSRMEQEKLYKGLNDPKYAGLK 180

Query: 181 RDENDEAGAENQ---ENKPKKRKGPKEPNPLSMKKK 213
            DE  E   E Q   E   KK++GPK PNPLS++KK
Sbjct: 181 LDE--EEATETQGSGEKTAKKKRGPKGPNPLSVRKK 214

>KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 268

 Score =  315 bits (807), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 150/214 (70%), Positives = 173/214 (80%)

Query: 1   MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPM 60
           MRQKRAKSYRKQMLVYNH FKFR+PYQVLVDDQ+V +T  +SFD VKGLQRTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPM 60

Query: 61  ITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHRYVVA 120
           ITQCC+Q++Y+T NQ AI+  K FERRRCNH PKE K  +ECL SVV VNG NKHRYVVA
Sbjct: 61  ITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIECLQSVVSVNGNNKHRYVVA 120

Query: 121 TQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKFAGIA 180
           +QD  IR++LR++PGVPL+YMNRSVMVMEPLS AS   SR  E++KL+KGLNDPK+AG+ 
Sbjct: 121 SQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKEKLFKGLNDPKYAGLP 180

Query: 181 RDENDEAGAENQENKPKKRKGPKEPNPLSMKKKK 214
            +E         E    KRKGPK PNPLS+KKKK
Sbjct: 181 AEEEGGKTDNGTEVSKNKRKGPKGPNPLSIKKKK 214

>Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W -
           Protein required for cell viability [contig 185] FULL
          Length = 274

 Score =  314 bits (804), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 154/220 (70%), Positives = 176/220 (80%), Gaps = 6/220 (2%)

Query: 1   MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPM 60
           MRQKRAKSYRKQMLVYNH FKFR+PYQVLVDDQ+V +T  ++FD VKGL+RTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHRYVVA 120
           ITQCC+Q++Y+TN+Q AI+  K FERRRCNH PKE K  LECL SVV+VNG NKHRYVVA
Sbjct: 61  ITQCCIQAIYETNDQEAIELAKSFERRRCNHPPKEAKPPLECLQSVVNVNGVNKHRYVVA 120

Query: 121 TQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKFAGIA 180
           TQ+ EIR  LRK+PGVPLV+MNRSVMVMEPLS AS+ VSR  E +KL+KGLNDPKFAG+ 
Sbjct: 121 TQNQEIRGCLRKVPGVPLVFMNRSVMVMEPLSKASQNVSRVQEREKLFKGLNDPKFAGLP 180

Query: 181 RDENDEAGAENQENK------PKKRKGPKEPNPLSMKKKK 214
             E          +K       KKRKGPK PNPLS+KKKK
Sbjct: 181 LTEQPATATAATVDKEGAGAPAKKRKGPKGPNPLSIKKKK 220

>NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15
           YOR004W
          Length = 271

 Score =  308 bits (788), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 143/217 (65%), Positives = 182/217 (83%), Gaps = 3/217 (1%)

Query: 1   MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPM 60
           MRQKRAKSYRKQ+LVYNHTFKFR PYQVLVD+Q+VL+  NS++D  KGL+ TLQ+EVK M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVM 60

Query: 61  ITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHRYVVA 120
           ITQCCMQ+LY+ NNQ AI+  ++FERRRCNH+PKEPK+ +EC+ SVV++NG+NKHRYVVA
Sbjct: 61  ITQCCMQALYEENNQDAIELARRFERRRCNHNPKEPKTAIECIESVVNINGQNKHRYVVA 120

Query: 121 TQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKFAGI- 179
           +QD+  RR+LR++PGVPL++++R+VM+MEPLS+ S +VSR  E +KLYKGLNDPKF G+ 
Sbjct: 121 SQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPKFTGVK 180

Query: 180 -ARDENDEAGAENQENKPKKRK-GPKEPNPLSMKKKK 214
            A D+      E+ + + KKRK GPK PNPLSMKKKK
Sbjct: 181 SAVDKETVKEKESTDQQKKKRKIGPKGPNPLSMKKKK 217

>Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W
           (REAL)
          Length = 259

 Score =  307 bits (787), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 149/215 (69%), Positives = 177/215 (82%), Gaps = 5/215 (2%)

Query: 1   MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPM 60
           MRQKRAKSYRKQ+LVY+HTFKFR+PYQVLVD+QLV E   S+FD   GL+RTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 60

Query: 61  ITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHRYVVA 120
           ITQCC+Q+LY+T N+GAID  KQFERRRCNH  K+PKS  EC+ SVV+VNG NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 120

Query: 121 TQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKFAGIA 180
           +QD+++RR+LR +PGVPL+++ RSVM+MEPLS AS K SR  EEQKLYKGLNDP    I 
Sbjct: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDP---NIE 177

Query: 181 RDENDEAGAENQENKPKKRK-GPKEPNPLSMKKKK 214
           + E    G+E +E+ PKKRK GPK PNPLSMKKKK
Sbjct: 178 KAEAISKGSE-KESTPKKRKAGPKAPNPLSMKKKK 211

>KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  306 bits (785), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 141/218 (64%), Positives = 182/218 (83%), Gaps = 4/218 (1%)

Query: 1   MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPM 60
           MRQKRAKSYRKQ+LVYNHTF+FR+PYQV++DD++VL+   S FD  K LQRT+QAEVK M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQVILDDEIVLQATESKFDLYKALQRTVQAEVKLM 60

Query: 61  ITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHRYVVA 120
           ITQCCMQ+LY TNN+ AID  K++ERRRCNH PK+PKS  EC+ SVVD+ G+NKHRY+VA
Sbjct: 61  ITQCCMQALYATNNRQAIDMAKRYERRRCNHPPKDPKSPFECIESVVDIKGENKHRYIVA 120

Query: 121 TQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKFAGIA 180
            Q++++RR+LR++PGVPL++++R+VM+MEPLS+AS ++S+ +E+QKL+ GLND K AGI 
Sbjct: 121 CQNIDLRRKLRRVPGVPLIHVSRAVMIMEPLSDASARISKRMEQQKLFSGLNDAKAAGIK 180

Query: 181 RDEN---DEAGAENQENKPKKRK-GPKEPNPLSMKKKK 214
             E    ++ G E  E KPKKRK GPK+PNPLSMKKKK
Sbjct: 181 AAETEKVEDKGKEAPEAKPKKRKLGPKQPNPLSMKKKK 218

>Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {ON}
           complement(173726..174499) [774 nt, 258 aa]
          Length = 257

 Score =  306 bits (783), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 146/217 (67%), Positives = 181/217 (83%), Gaps = 8/217 (3%)

Query: 1   MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPM 60
           MRQ+RAKSYRKQMLVYNHTFKFR+PYQ +VDDQLVL+   S FD +KGL+RTLQAEVK M
Sbjct: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 60

Query: 61  ITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHRYVVA 120
           ITQCCMQ+LY+T+NQ AI   K+FERRRCNH PK+PKS LEC+ S+VD+ G NKHRYVVA
Sbjct: 61  ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 120

Query: 121 TQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKF-AGI 179
           +QD++IRR+LRKIPGVP+V+++R+VM++EPLS+AS K+S  +E+ KLYKGLND K  AG+
Sbjct: 121 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL 180

Query: 180 ARDENDEAGAENQE--NKPKKRKGPKEPNPLSMKKKK 214
                DE  +E  E  ++ KK KGPK+PNPLSMKK+K
Sbjct: 181 -----DEPKSEKSEKTSESKKNKGPKQPNPLSMKKRK 212

>CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004w
          Length = 263

 Score =  303 bits (775), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 142/210 (67%), Positives = 175/210 (83%)

Query: 1   MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPM 60
           MRQKRAKSYRKQ+LVYNHTFKFR+PYQVL+DDQ+V+++  S +D VK L+RTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPM 60

Query: 61  ITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHRYVVA 120
           ITQCCMQ+LY+T N+ AID GK+FERRRC H P E  S  EC+ +VVDV GKNKHRYVVA
Sbjct: 61  ITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHRYVVA 120

Query: 121 TQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKFAGIA 180
            QDVEIRR LRK+PGVPL++++RSVM+MEPLS+AS KVSR  EE KL++GLNDPK+AG+ 
Sbjct: 121 CQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEEESKLFRGLNDPKYAGLK 180

Query: 181 RDENDEAGAENQENKPKKRKGPKEPNPLSM 210
            +  +E  ++ Q    K++ GPK+PNPLSM
Sbjct: 181 GEHEEEEQSKEQTVAKKRKIGPKQPNPLSM 210

>Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W
           (REAL)
          Length = 257

 Score =  298 bits (763), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 178/216 (82%), Gaps = 7/216 (3%)

Query: 1   MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPM 60
           MRQKRAKSYRKQ+LVY+HTFKFR+PYQVLVD+QLV E   S+F+   GL+RTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHRYVVA 120
           ITQCC+Q+LY+T N+GAID  KQFERRRCNH  K+PKS  EC+ SVVDVNG NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 120

Query: 121 TQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKFAGIA 180
           +QD+ +RR+LR +PGVPL+++ RSVM+MEPLS AS K S++ EEQKL+KGLNDP      
Sbjct: 121 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNV---- 176

Query: 181 RDENDEAGAEN-QENKPKKRK-GPKEPNPLSMKKKK 214
            ++ ++  +E+ +E+ PKKRK GPK PNPLS+KKKK
Sbjct: 177 -EKTEKVSSESGKESAPKKRKIGPKAPNPLSVKKKK 211

>ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 293

 Score =  296 bits (759), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 144/215 (66%), Positives = 173/215 (80%), Gaps = 1/215 (0%)

Query: 1   MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPM 60
           MRQKRAKSY+KQMLVYN+ F+FR+PYQVL+DDQLV +   S +D V GL+RTLQAEVKPM
Sbjct: 1   MRQKRAKSYKKQMLVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPM 60

Query: 61  ITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHRYVVA 120
           ITQCCMQ+LY T NQ AI+ GK FERRRCNH PKE K   EC+ SVV+VNG NKHRYVVA
Sbjct: 61  ITQCCMQALYFTKNQDAIELGKSFERRRCNHPPKEAKPPHECIQSVVNVNGSNKHRYVVA 120

Query: 121 TQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKFAGIA 180
           +QDV +RR+LRK+PGVPL++M+RSVMVMEPLS AS +V+   E +KL KGLNDPK AG+ 
Sbjct: 121 SQDVTLRRKLRKVPGVPLIHMSRSVMVMEPLSEASSRVNEMSEREKLLKGLNDPKLAGLK 180

Query: 181 RDENDEAGAENQENKP-KKRKGPKEPNPLSMKKKK 214
              + E   E++   P KKRKGPK PNPLS++KK+
Sbjct: 181 TTPSVENELESESQPPAKKRKGPKGPNPLSVRKKQ 215

>Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to
           Ashbya gossypii ACR011C
          Length = 266

 Score =  295 bits (755), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 150/215 (69%), Positives = 178/215 (82%), Gaps = 4/215 (1%)

Query: 1   MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPM 60
           MRQKRAK+Y+KQMLVYNHTFKFRQPYQVLVDDQLVLET  SSFD +KGL+RTLQAEVKPM
Sbjct: 1   MRQKRAKAYKKQMLVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHRYVVA 120
           ITQCC+Q LY++ NQGAI   K +ERRRCNH  KEPK   EC+ SVVD+NG+N HRYVVA
Sbjct: 61  ITQCCVQKLYESKNQGAIAQAKMYERRRCNHY-KEPKEPSECIRSVVDINGRNLHRYVVA 119

Query: 121 TQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKFAGIA 180
           TQD+EIRR LR++PGVPL+YMNRSVMVMEPLS+ S++VS++VE +KL KGLNDPK+AG  
Sbjct: 120 TQDIEIRRILRRVPGVPLIYMNRSVMVMEPLSSNSQQVSQQVENEKLVKGLNDPKYAGTP 179

Query: 181 RDENDEA---GAENQENKPKKRKGPKEPNPLSMKK 212
            +  D +    + +     +K KGPKEPNPLS+KK
Sbjct: 180 NNTEDASVDPKSPDANQLKRKIKGPKEPNPLSIKK 214

>Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W
           (REAL)
          Length = 251

 Score =  293 bits (751), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 141/215 (65%), Positives = 173/215 (80%), Gaps = 5/215 (2%)

Query: 1   MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPM 60
           MRQKRAKSYRKQ+LVY+HTFKFR+PYQVLVD+QLVLE   S+F+   GL+RTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHRYVVA 120
           ITQCC+Q+LY+T N+GAID  KQFERRRCNH  K+PKS  +C+ SVVD+NG NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYVVA 120

Query: 121 TQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKFAGIA 180
           +QD+ +RR+LR +PGVPL+++ RSVMVMEPLS AS K S+  EE+KLYKGLNDP    + 
Sbjct: 121 SQDIGLRRKLRNVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLNDPNVDKV- 179

Query: 181 RDENDEAGAENQENKPKKRK-GPKEPNPLSMKKKK 214
               + +    +E+  KKRK GPK PNPLS+KKKK
Sbjct: 180 ---QEISEGSGKESVTKKRKFGPKAPNPLSVKKKK 211

>NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON}
           Anc_6.15
          Length = 261

 Score =  290 bits (743), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 136/214 (63%), Positives = 179/214 (83%), Gaps = 1/214 (0%)

Query: 1   MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPM 60
           MRQKRAKSYRKQ+LVYNHTF+FR+PYQ+LVD+Q+V +   S++D  KGL RTLQAEVK M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVM 60

Query: 61  ITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHRYVVA 120
           ITQCCMQ+LY+ N+Q AI+  ++FERRRCNH+PK+PK+ +EC+ SVV++NG+NKHRYVVA
Sbjct: 61  ITQCCMQALYEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVNINGQNKHRYVVA 120

Query: 121 TQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKFAGIA 180
            QDV IRR+LR++PGVPLV+++R+VM+MEPLS+AS KVS+  E +KLYKGLNDPK+ G+ 
Sbjct: 121 AQDVAIRRKLRQVPGVPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDPKYTGV- 179

Query: 181 RDENDEAGAENQENKPKKRKGPKEPNPLSMKKKK 214
           +   ++   +++    K + GPK PNPLSMKKKK
Sbjct: 180 KTAAEDVKIDDKPKPKKSKYGPKSPNPLSMKKKK 213

>YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}
           UTP23Component of the small subunit processome, involved
           in 40S ribosomal subunit biogenesis; interacts with
           snR30 and is required for dissociation of snR30 from
           large pre-ribosomal particles; has homology to PINc
           domain protein Fcf1p, although the PINc domain of Utp23p
           is not required for function; essential protein
          Length = 254

 Score =  289 bits (739), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 139/210 (66%), Positives = 172/210 (81%), Gaps = 5/210 (2%)

Query: 1   MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPM 60
           MRQKRAKSYRKQ+LVY+HTFKFR+PYQVLVD+QLVLE  NS+F+   GL+RTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHRYVVA 120
           ITQCC+Q+LY+T N GAI+  KQFERRRCNH  K+PKS  EC+ SVV+++G NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVVA 120

Query: 121 TQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKFAGIA 180
           +QD+++RR+LR +PGVPL+++ RSVMVMEPLS AS K S+  EEQKLYKGLNDP    + 
Sbjct: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLNDPNIEKL- 179

Query: 181 RDENDEAGAENQENKPKKRK-GPKEPNPLS 209
           ++  D +G   +E+  KKRK GPK PNPLS
Sbjct: 180 QESGDGSG---KESITKKRKLGPKAPNPLS 206

>TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON}
           Anc_6.15 YOR004W
          Length = 245

 Score =  285 bits (730), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 147/214 (68%), Positives = 171/214 (79%), Gaps = 10/214 (4%)

Query: 1   MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPM 60
           MRQKRAK+YRKQMLVYNHTFKFR+PYQVLVD+Q+VL+   S+FD VKGLQRTLQAEVK M
Sbjct: 1   MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVM 60

Query: 61  ITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHRYVVA 120
           ITQCCMQ+LY+TN QGAI+  K FERRRCNH PKEPK  +ECL S+V VNG NKHRYVVA
Sbjct: 61  ITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIECLESIVCVNGHNKHRYVVA 120

Query: 121 TQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKFAGIA 180
           +QD++ RR LR+ PGVPLV+  RSVMVMEPLS+AS KVS   E +KL+KGLNDP+ AGI 
Sbjct: 121 SQDIDTRRILRRTPGVPLVHTVRSVMVMEPLSDASAKVSSAAEAEKLHKGLNDPRNAGIK 180

Query: 181 RDENDEAGAENQENKPKKRKGPKEPNPLSMKKKK 214
                    EN +   KKR   K+PNPLS+KK+K
Sbjct: 181 --------TENPQTSIKKR--TKQPNPLSVKKRK 204

>TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15
           YOR004W
          Length = 271

 Score =  276 bits (705), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 128/215 (59%), Positives = 175/215 (81%), Gaps = 2/215 (0%)

Query: 1   MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAE-VKP 59
           MRQKRAKSY+KQM+VYNHTFKFR+PYQ+LVD+Q+V ++F S+++  + L++TLQAE +K 
Sbjct: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 60

Query: 60  MITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHRYVV 119
           MITQCCMQ LY T+NQ  ID  K+FERRRCNH  K+PK  LEC+ S+V+++G+NKHRYVV
Sbjct: 61  MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 120

Query: 120 ATQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKFAGI 179
           ATQ++E+RR+LR++PGVP+++++RSVM+MEP+S++S +++R+ E+ KLYKGLNDPK++  
Sbjct: 121 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 180

Query: 180 ARDENDEAGAE-NQENKPKKRKGPKEPNPLSMKKK 213
              +      E  Q    KKRKG KEPNPLS KKK
Sbjct: 181 PTPKEGTPDTEGTQPAATKKRKGVKEPNPLSKKKK 215

>TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6.15
           YOR004W
          Length = 259

 Score =  248 bits (633), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 145/186 (77%), Gaps = 2/186 (1%)

Query: 1   MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAE--VK 58
           MRQKRAKSY+KQ++VYNHTFKFR+PYQV++DD LV ET  + ++ +KGL   L +   +K
Sbjct: 1   MRQKRAKSYKKQLIVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIK 60

Query: 59  PMITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHRYV 118
           PMITQCC+ +LY++ +Q +I  GK FERRRCNH  KEP S  EC+ S+VDVNGKNKHRY+
Sbjct: 61  PMITQCCISALYKSEDQESISIGKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHRYI 120

Query: 119 VATQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKFAG 178
           VATQD+E+RR+LRKIPGVPL++  RSVMVMEPLS+AS + + EVE +KL  GLN  K + 
Sbjct: 121 VATQDLELRRKLRKIPGVPLIHFKRSVMVMEPLSDASCEYNEEVESKKLTSGLNSTKASV 180

Query: 179 IARDEN 184
               EN
Sbjct: 181 EGGQEN 186

>ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 72.4 bits (176), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 74/148 (50%), Gaps = 17/148 (11%)

Query: 14  LVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPMITQCCMQSL---- 69
           L + +    R PYQVL+D   +  +     D VKG+   L A+  P+IT C M  L    
Sbjct: 51  LFFQYNQAIRPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 70  --YQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHR-YVVATQDVEI 126
             Y+   + A D   + +R  C H   +     +CL     VN   +H+ Y+VAT D  +
Sbjct: 111 PKYRIALKLARDP--RIKRLSCTH---KGTYADDCL-----VNRVMQHKCYIVATNDAPL 160

Query: 127 RRRLRKIPGVPLVYMNRSVMVMEPLSNA 154
           ++R+RKIPG+PL+ +     V+E L +A
Sbjct: 161 KQRVRKIPGIPLMSVGGHSYVIEKLPDA 188

>KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 71.6 bits (174), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 74/148 (50%), Gaps = 17/148 (11%)

Query: 14  LVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPMITQCCMQSL---- 69
           L + +    + PYQVL+D   +  +     D V+G+  TL A+  PMIT C M  L    
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDTLLAKCIPMITDCVMAELEKLG 110

Query: 70  --YQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHR-YVVATQDVEI 126
             Y+   + A D   + +R  C+H         +CL     VN   +H+ Y+VAT D  +
Sbjct: 111 PKYRIALKLARDP--RIQRLTCSHKGTYAD---DCL-----VNRVLQHKCYIVATNDAGL 160

Query: 127 RRRLRKIPGVPLVYMNRSVMVMEPLSNA 154
           ++R+RK+PG+PL+ +     V+E L + 
Sbjct: 161 KQRIRKVPGIPLMSVGGHAYVIEKLPDV 188

>Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C -
           Protein required for cell viability [contig 154] FULL
          Length = 189

 Score = 71.2 bits (173), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 74/148 (50%), Gaps = 17/148 (11%)

Query: 14  LVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPMITQCCMQSL---- 69
           L + +    + PYQVL+D   +  +     D V+G+  TL A+  P+IT C M  L    
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDTLLAKCIPLITDCVMAELEKLG 110

Query: 70  --YQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHR-YVVATQDVEI 126
             Y+   + A D   + +R  C+H         +CL     VN   +H+ Y+VAT D  +
Sbjct: 111 PKYRIALKLARDP--RIQRLSCSHKGTYAD---DCL-----VNRVLQHKCYIVATNDAAL 160

Query: 127 RRRLRKIPGVPLVYMNRSVMVMEPLSNA 154
           ++R+RK+PG+PL+ +     V+E L + 
Sbjct: 161 KQRIRKVPGIPLMSVGGHAYVIEKLPDV 188

>Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON}
           complement(40805..41374) [570 nt, 190 aa]
          Length = 189

 Score = 69.3 bits (168), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/148 (29%), Positives = 74/148 (50%), Gaps = 17/148 (11%)

Query: 14  LVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPMITQCCMQSL---- 69
           L + +    + PYQVL+D   +  +     D +KG+   L A+  P+IT C M  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 70  --YQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHR-YVVATQDVEI 126
             Y+   + A D   + +R  C+H         +C+     VN   +H+ Y+VAT DV +
Sbjct: 111 PKYRIALRLARDP--RIKRLSCSHKGTYAD---DCI-----VNRVLQHKCYIVATNDVGL 160

Query: 127 RRRLRKIPGVPLVYMNRSVMVMEPLSNA 154
           ++R+RK+PG+PL+ +     V+E L + 
Sbjct: 161 KQRIRKVPGIPLMSVGGHSYVIEKLPDV 188

>SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 67.8 bits (164), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 44/148 (29%), Positives = 73/148 (49%), Gaps = 17/148 (11%)

Query: 14  LVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPMITQCCMQSL---- 69
           L + +    + PYQVL+D   +  +     D V+G+   L A+  P+IT C M  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 70  --YQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHR-YVVATQDVEI 126
             Y+   + A D   + +R  C+H         +CL     VN   +H+ Y+VAT D  +
Sbjct: 111 PKYRIALRLARDP--RIKRLNCSHKGTYAD---DCL-----VNRVLQHKCYIVATNDAAL 160

Query: 127 RRRLRKIPGVPLVYMNRSVMVMEPLSNA 154
           ++R+RK+PG+PL+ +     V+E L + 
Sbjct: 161 KQRIRKVPGIPLMSVGGHSYVIEKLPDV 188

>AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR339C
          Length = 189

 Score = 67.8 bits (164), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 44/148 (29%), Positives = 73/148 (49%), Gaps = 17/148 (11%)

Query: 14  LVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPMITQCCMQSL---- 69
           L + +    + PYQVL+D   +  +     D V+G+   L A+  P+IT C M  L    
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 70  --YQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHR-YVVATQDVEI 126
             Y+   + A D   + +R  C+H         +CL     VN   +H+ Y+VAT D  +
Sbjct: 111 PKYRIALKLARDP--RIKRLNCSHKGTYAD---DCL-----VNRVLQHKCYIVATNDAGL 160

Query: 127 RRRLRKIPGVPLVYMNRSVMVMEPLSNA 154
           ++R+RK+PG+PL+ +     V+E L + 
Sbjct: 161 KQRIRKVPGIPLMSVGGHSYVIEKLPDV 188

>TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 67.4 bits (163), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 72/148 (48%), Gaps = 17/148 (11%)

Query: 14  LVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPMITQCCMQSL---- 69
           L +      R PYQVL+D   +  +     D +KG+   L A+  P+IT C M  L    
Sbjct: 51  LFFQFNEAIRPPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 70  --YQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHR-YVVATQDVEI 126
             Y+   + A D   + +R  C+H         +C+     VN   +H+ Y+VAT D  +
Sbjct: 111 PKYRIALRLARDP--RIKRLSCSHKGTYAD---DCI-----VNRVLQHKCYIVATNDQGL 160

Query: 127 RRRLRKIPGVPLVYMNRSVMVMEPLSNA 154
           ++R+RKIPG+PL+ +     V+E L + 
Sbjct: 161 KQRVRKIPGIPLMSVGGHAYVIEKLPDV 188

>NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {ON}
           Anc_5.392
          Length = 189

 Score = 67.4 bits (163), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 44/148 (29%), Positives = 73/148 (49%), Gaps = 17/148 (11%)

Query: 14  LVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPMITQCCMQSL---- 69
           L + +    + PYQVL+D   +  +     D V+G+   L A+  P+IT C M  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 70  --YQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHR-YVVATQDVEI 126
             Y+   + A D   + +R  C+H         +C+     VN   +H+ Y+VAT D  +
Sbjct: 111 PKYRIALKLARDP--RIKRLSCSHKGTYAD---DCI-----VNRVLQHKCYIVATNDAGL 160

Query: 127 RRRLRKIPGVPLVYMNRSVMVMEPLSNA 154
           ++R+RKIPG+PL+ +     V+E L + 
Sbjct: 161 KQRVRKIPGIPLMSVGGHSYVIEKLPDV 188

>Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 67.4 bits (163), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 44/148 (29%), Positives = 72/148 (48%), Gaps = 17/148 (11%)

Query: 14  LVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPMITQCCMQSL---- 69
           L + +    + PYQVL+D   +  +     D V+G+   L A+  P+IT C M  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 70  --YQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHR-YVVATQDVEI 126
             Y+   + A D   + +R  C+H         +CL   V      +H+ Y+VAT D  +
Sbjct: 111 PKYRIALKLARDP--RIKRLSCSHKGTYAD---DCLVHRV-----LQHKCYIVATNDAGL 160

Query: 127 RRRLRKIPGVPLVYMNRSVMVMEPLSNA 154
           ++R+RKIPG+PL+ +     V+E L + 
Sbjct: 161 KQRIRKIPGIPLMSVGGHAYVIEKLPDV 188

>KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 67.4 bits (163), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 44/148 (29%), Positives = 73/148 (49%), Gaps = 17/148 (11%)

Query: 14  LVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPMITQCCMQSL---- 69
           L + +    + PYQVL+D   +  +     D V+G+   L A+  P+IT C +  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 70  --YQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHR-YVVATQDVEI 126
             Y+   + A D   + +R  C+H         +CL     VN   +H+ Y+VAT D  +
Sbjct: 111 PKYRIALKLARDP--RIKRLSCSHKGTYAD---DCL-----VNRVLQHKCYIVATNDAGL 160

Query: 127 RRRLRKIPGVPLVYMNRSVMVMEPLSNA 154
           ++R+RKIPG+PL+ +     V+E L + 
Sbjct: 161 KQRVRKIPGIPLMSVGGHAYVIEKLPDV 188

>CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339c
          Length = 189

 Score = 67.4 bits (163), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 44/148 (29%), Positives = 72/148 (48%), Gaps = 17/148 (11%)

Query: 14  LVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPMITQCCMQSL---- 69
           L + +    + PYQVL+D   +  +     D VKG+   L A+  P+IT C +  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 70  --YQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHR-YVVATQDVEI 126
             Y+   + A D   + +R  C H         +C+     VN   +H+ Y+VAT D  +
Sbjct: 111 PKYRIALKLARDP--RIKRLTCTHKGTYAD---DCI-----VNRVLQHKCYIVATNDAGL 160

Query: 127 RRRLRKIPGVPLVYMNRSVMVMEPLSNA 154
           ++R+RKIPG+PL+ +     V+E L + 
Sbjct: 161 KQRVRKIPGIPLMSVGGHAYVIEKLPDV 188

>Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 67.4 bits (163), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 44/148 (29%), Positives = 72/148 (48%), Gaps = 17/148 (11%)

Query: 14  LVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPMITQCCMQSL---- 69
           L + +    + PYQVL+D   +  +     D V+G+   L A+  P+IT C M  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 70  --YQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHR-YVVATQDVEI 126
             Y+   + A D   + +R  C+H         +CL   V      +H+ Y+VAT D  +
Sbjct: 111 PKYRIALKLARDP--RIKRLSCSHKGTYAD---DCLVHRV-----LQHKCYIVATNDAGL 160

Query: 127 RRRLRKIPGVPLVYMNRSVMVMEPLSNA 154
           ++R+RKIPG+PL+ +     V+E L + 
Sbjct: 161 KQRIRKIPGIPLMSVGGHAYVIEKLPDV 188

>TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 67.0 bits (162), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 70/146 (47%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPMITQCCMQSLYQTN 73
           L + +    + PYQVL+D   +  +     D V+G+   L A+  P+IT C M  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  NQGAIDA----GKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHR-YVVATQDVEIRR 128
            +  I        + +R  C H         +C+     VN   +H+ Y+VAT D  +++
Sbjct: 111 PKFRIALKLARDPRIKRLSCTHKGTYAD---DCI-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 RLRKIPGVPLVYMNRSVMVMEPLSNA 154
           R+RKIPG+PL+ +      +E L +A
Sbjct: 163 RVRKIPGIPLMSVGGHAYAIEKLPDA 188

>Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON}
           similar to Ashbya gossypii AEL102W
          Length = 189

 Score = 67.0 bits (162), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 44/148 (29%), Positives = 73/148 (49%), Gaps = 17/148 (11%)

Query: 14  LVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPMITQCCMQSL---- 69
           L + +    + PYQVL+D   +  +     D V+G+   L A+  P+IT C M  L    
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 70  --YQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHR-YVVATQDVEI 126
             Y+   + A D   + +R  C+H         +CL     VN   +H+ Y+VAT D  +
Sbjct: 111 PKYRIALKLARDP--RIKRLTCSHRGTYAD---DCL-----VNRVLQHKCYIVATNDAGL 160

Query: 127 RRRLRKIPGVPLVYMNRSVMVMEPLSNA 154
           ++R+RK+PG+PL+ +     V+E L + 
Sbjct: 161 KQRIRKVPGIPLLSVGGHSYVIEKLPDV 188

>Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 67.0 bits (162), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 44/148 (29%), Positives = 72/148 (48%), Gaps = 17/148 (11%)

Query: 14  LVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPMITQCCMQSL---- 69
           L + +    + PYQVL+D   +  +     D V+G+   L A+  P+IT C M  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 70  --YQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHR-YVVATQDVEI 126
             Y+   + A D   + +R  C+H         +CL   V      +H+ Y+VAT D  +
Sbjct: 111 PKYRIALKLARDP--RIKRLSCSHKGTYAD---DCLVHRV-----LQHKCYIVATNDAGL 160

Query: 127 RRRLRKIPGVPLVYMNRSVMVMEPLSNA 154
           ++R+RKIPG+PL+ +     V+E L + 
Sbjct: 161 KQRIRKIPGIPLMSVGGHAYVIEKLPDV 188

>NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 67.0 bits (162), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 44/148 (29%), Positives = 73/148 (49%), Gaps = 17/148 (11%)

Query: 14  LVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPMITQCCMQSL---- 69
           L + +    + PYQVL+D   +  +     D VKG+   L A+  P+IT C M  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 70  --YQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHR-YVVATQDVEI 126
             Y+   + A D   + +R  C+H         +C+     VN   +H+ ++VAT D  +
Sbjct: 111 PKYRIALRLARDP--RIKRLSCSHKGTYAD---DCI-----VNRVLQHKCFIVATNDAGL 160

Query: 127 RRRLRKIPGVPLVYMNRSVMVMEPLSNA 154
           ++R+RKIPG+PL+ +     V+E L + 
Sbjct: 161 KQRVRKIPGIPLMSVGGHSYVIEKLPDV 188

>YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON}
           FCF1Putative PINc domain nuclease required for early
           cleavages of 35S pre-rRNA and maturation of 18S rRNA;
           component of the SSU (small subunit) processome involved
           in 40S ribosomal subunit biogenesis; copurifies with
           Faf1p
          Length = 189

 Score = 67.0 bits (162), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 44/148 (29%), Positives = 72/148 (48%), Gaps = 17/148 (11%)

Query: 14  LVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPMITQCCMQSL---- 69
           L + +    + PYQVL+D   +  +     D V+G+   L A+  P+IT C M  L    
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 70  --YQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHR-YVVATQDVEI 126
             Y+   + A D   + +R  C+H         +CL   V      +H+ Y+VAT D  +
Sbjct: 111 PKYRIALKLARDP--RIKRLSCSHKGTYAD---DCLVHRV-----LQHKCYIVATNDAGL 160

Query: 127 RRRLRKIPGVPLVYMNRSVMVMEPLSNA 154
           ++R+RKIPG+PL+ +     V+E L + 
Sbjct: 161 KQRIRKIPGIPLMSVGGHAYVIEKLPDV 188

>KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 65.5 bits (158), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 73/148 (49%), Gaps = 17/148 (11%)

Query: 14  LVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPMITQCCMQSL---- 69
           L + +    + PYQVL+D   +  +     D V+G+   L A+  P+IT C +  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 70  --YQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHR-YVVATQDVEI 126
             Y+   + A D   + +R  C+H         +C+     VN   +H+ Y+VAT D  +
Sbjct: 111 PKYRIALKLARDP--RIKRLSCSHKGTYAD---DCI-----VNRVLQHKCYIVATNDAGL 160

Query: 127 RRRLRKIPGVPLVYMNRSVMVMEPLSNA 154
           ++R+RKIPG+PL+ +     V+E L + 
Sbjct: 161 KQRVRKIPGIPLMSVGGHSYVIEKLPDV 188

>TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 63.9 bits (154), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 71/146 (48%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPMITQCCMQSLYQTN 73
           L + +    + PYQVL+D   +  +     D V+G+   L A+  P+IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVVAELEKLG 110

Query: 74  NQGAIDA----GKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHR-YVVATQDVEIRR 128
            +  I        + +R  C+H         +C+     VN   +H+ Y+VAT D  +++
Sbjct: 111 PKFRIALKLARDPRIKRLSCSHRGTYAD---DCI-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 RLRKIPGVPLVYMNRSVMVMEPLSNA 154
           R+RKIPG+PL+ +     V+E L + 
Sbjct: 163 RVRKIPGIPLMSVGGHSYVVEKLPDV 188

>KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {ON}
           highly similar to uniprot|Q05498 Saccharomyces
           cerevisiae YDR339C Protein required for cell viability
          Length = 189

 Score = 62.4 bits (150), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 70/145 (48%), Gaps = 17/145 (11%)

Query: 14  LVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPMITQCCMQSL---- 69
           L + +    + PYQVL+D   +  +     D VKG+   L A+   +IT C M  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNILITDCVMAELEKLG 110

Query: 70  --YQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHR-YVVATQDVEI 126
             Y+   + A D   + +R  C+H         +C+   V      +H+ Y+VAT D  +
Sbjct: 111 PKYRIALKLARDP--RIKRLSCSHKGTYAD---DCIVHRV-----LQHKCYIVATNDAGL 160

Query: 127 RRRLRKIPGVPLVYMNRSVMVMEPL 151
           ++R+RK+PG+PL+ +     V+E L
Sbjct: 161 KQRVRKVPGIPLMSVGGHSYVIEKL 185

>Skud_10.313 Chr10 (556128..560390) [4263 bp, 1420 aa] {ON} YJR092W
           (REAL)
          Length = 1420

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 62/156 (39%), Gaps = 14/156 (8%)

Query: 64  CCMQS---LYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKH--RYV 118
           CCM S   +   + +  +       +R+ + D + P + +E L   V + G + H    V
Sbjct: 256 CCMSSTPEMTPVDEKCHVSGNLPHTKRKSHSDTRSPTASVEDLNISVGLPGTDDHPSNAV 315

Query: 119 VATQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKFAG 178
               DV I+R L K       ++N + +  + L    EK S +      + G ND K   
Sbjct: 316 TTDTDVLIKRDLVKDLQRNRNHVNEAFVEKKILGECCEKKSVD------FLGNNDTKSI- 368

Query: 179 IARDENDEAGAENQENKPKKRKGPKEPNPLSMKKKK 214
              D N+E    NQ N P    G  E  PL   + K
Sbjct: 369 --EDHNNEVNDNNQGNLPVNVVGSTESAPLDHTESK 402

>KAFR0K02390 Chr11 complement(493521..496253) [2733 bp, 910 aa] {ON}
           
          Length = 910

 Score = 30.8 bits (68), Expect = 4.6,   Method: Composition-based stats.
 Identities = 28/93 (30%), Positives = 42/93 (45%), Gaps = 10/93 (10%)

Query: 121 TQDVEIRRRLRKIPGVP----LVYMNRSVMVMEPLSNASEKVSR--EVEEQKLYKGLNDP 174
           T D ++     KI   P     V  N + +  E    A EK +R  E EEQ + K  +D 
Sbjct: 766 TSDADVDSEFDKIMREPGEHVFVDQNGNPLTPEQAKAAYEKNARNEEAEEQNV-KNDDD- 823

Query: 175 KFAGIARDENDEAGAENQENKPKKRKGPKEPNP 207
               + ++EN EA  + QE  PK+ +  +E  P
Sbjct: 824 --VNLHKEENQEAHKQEQEQAPKEDRKVEEQVP 854

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.130    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 25,234,090
Number of extensions: 1024398
Number of successful extensions: 3586
Number of sequences better than 10.0: 63
Number of HSP's gapped: 3633
Number of HSP's successfully gapped: 63
Length of query: 268
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 160
Effective length of database: 41,097,471
Effective search space: 6575595360
Effective search space used: 6575595360
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 65 (29.6 bits)