Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D01001gna 1ON22922911871e-167
SAKL0E01034gna 1ON2472381241e-07
KAFR0A034901.268ON96797810.082
YKL034W (TUL1)2.545ON758112701.7
CAGL0E03355g4.52ON1535106692.6
Suva_62.1singletonON25240664.6
NDAI0G034308.143ON24262655.1
NDAI0D016105.275ON75972665.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D01001g
         (229 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D01001g Chr4 (88911..89600) [690 bp, 229 aa] {ON} conserved...   461   e-167
SAKL0E01034g Chr5 (78600..79343) [744 bp, 247 aa] {ON} conserved...    52   1e-07
KAFR0A03490 Chr1 (715839..718742) [2904 bp, 967 aa] {ON}               36   0.082
YKL034W Chr11 (371829..374105) [2277 bp, 758 aa] {ON}  TUL1Golgi...    32   1.7  
CAGL0E03355g Chr5 complement(307479..312086) [4608 bp, 1535 aa] ...    31   2.6  
Suva_62.1 Chr62 complement(3..758) [756 bp, 252 aa] {ON} YIR039C...    30   4.6  
NDAI0G03430 Chr7 complement(819024..819752) [729 bp, 242 aa] {ON...    30   5.1  
NDAI0D01610 Chr4 (383939..386218) [2280 bp, 759 aa] {ON} Anc_5.275     30   5.3  

>KLLA0D01001g Chr4 (88911..89600) [690 bp, 229 aa] {ON} conserved
           hypothetical protein
          Length = 229

 Score =  461 bits (1187), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 229/229 (100%), Positives = 229/229 (100%)

Query: 1   MSEYGNIPYPIKDLDSFTLSEETRPTYDKLNTQQGKVNLQHNSAGQIKSDKTLPKLSNLK 60
           MSEYGNIPYPIKDLDSFTLSEETRPTYDKLNTQQGKVNLQHNSAGQIKSDKTLPKLSNLK
Sbjct: 1   MSEYGNIPYPIKDLDSFTLSEETRPTYDKLNTQQGKVNLQHNSAGQIKSDKTLPKLSNLK 60

Query: 61  DKFKIRNNKYLRSASSPEKEERDKQQNTIVIVTDDEEPEKQTVQQDIYQEYIPSRIHTTG 120
           DKFKIRNNKYLRSASSPEKEERDKQQNTIVIVTDDEEPEKQTVQQDIYQEYIPSRIHTTG
Sbjct: 61  DKFKIRNNKYLRSASSPEKEERDKQQNTIVIVTDDEEPEKQTVQQDIYQEYIPSRIHTTG 120

Query: 121 RESSKHRKIKLTNRRSANPQRQSESIGTIVTQSTPIPVSSNIDQPSILNTFSSSLKSVFD 180
           RESSKHRKIKLTNRRSANPQRQSESIGTIVTQSTPIPVSSNIDQPSILNTFSSSLKSVFD
Sbjct: 121 RESSKHRKIKLTNRRSANPQRQSESIGTIVTQSTPIPVSSNIDQPSILNTFSSSLKSVFD 180

Query: 181 YVDTVIDVRFPLLISYRRHVKIMLIVIFILQVNWYIELLIILIARSVYQ 229
           YVDTVIDVRFPLLISYRRHVKIMLIVIFILQVNWYIELLIILIARSVYQ
Sbjct: 181 YVDTVIDVRFPLLISYRRHVKIMLIVIFILQVNWYIELLIILIARSVYQ 229

>SAKL0E01034g Chr5 (78600..79343) [744 bp, 247 aa] {ON} conserved
           hypothetical protein
          Length = 247

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 59/238 (24%), Positives = 102/238 (42%), Gaps = 29/238 (12%)

Query: 8   PYPIKDLDSFTLSEETRPTYDKLNTQQGKV--NLQHNSAGQIK-SDKTLPKLSNLKDKFK 64
           PYP+K+LD F+LS    P   K++  +  +   LQ +     K SDK  P+  N+  KF 
Sbjct: 4   PYPVKELDEFSLSNGEVPDTVKISPIEPSIATRLQESPKNAFKISDK--PQPENIFPKFS 61

Query: 65  IRNNKYLRSASSPEKEERDKQQNTIVIVTDDEEPEKQT--VQQDIYQEYIPSRIHTTGRE 122
              N   +  +  +K   D    + + VT + EPE  +  + +D     + S++ T  ++
Sbjct: 62  Y--NIKNKLNTLKKKCSSDPNDGSFIRVTTNVEPEHPSPAIGEDTSIIDVGSKVITRPKK 119

Query: 123 SSKHRKIKLTNRRSANP----QRQSESIGTIVTQSTPIPVSSNIDQPSILNTFSSSLKSV 178
             K  + +   R    P    ++   S+ T +      P  S  D   +    +      
Sbjct: 120 PKKQERARSFERLRPAPVLLVKKPRLSVPTTINAKPFSPYMSKKDNQPVTKDLTPQCSPG 179

Query: 179 FDY----------------VDTVIDVRFPLLISYRRHVKIMLIVIFILQVNWYIELLI 220
            DY                VDTVID R   L  YR+++K+ LI++ I+++N + + LI
Sbjct: 180 LDYLNSSYQIPIVGLIFQSVDTVIDTRLTYLAPYRKYLKVALILLAIIEINVFADHLI 237

>KAFR0A03490 Chr1 (715839..718742) [2904 bp, 967 aa] {ON} 
          Length = 967

 Score = 35.8 bits (81), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 48/97 (49%), Gaps = 7/97 (7%)

Query: 30  LNTQQGKVNLQHNSAGQIKSDKTLPKLSNLKDKFKIRNNKYLRSASSPEKEERDKQQNTI 89
           LN   G+  +      +IKS K     +++ ++F   N+  L++A++ E EE DK+    
Sbjct: 512 LNEMNGEATINERDLERIKSLKDKDDTADISEQF---NSLSLKAANADENEENDKKD--- 565

Query: 90  VIVTDDEEPEKQTVQQDIYQEYIPSRIHTTGRESSKH 126
            +V + +E  +  VQ D+  E     + + GRE  +H
Sbjct: 566 -LVQEHDESNRNKVQNDLKIEDEEELVVSIGREGEEH 601

>YKL034W Chr11 (371829..374105) [2277 bp, 758 aa] {ON}
           TUL1Golgi-localized RING-finger ubiquitin ligase (E3),
           involved in ubiquitinating and sorting membrane proteins
           that contain polar transmembrane domains to
           multivesicular bodies for delivery to the vacuole for
           quality control purposes
          Length = 758

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 49/112 (43%), Gaps = 14/112 (12%)

Query: 25  PTYDKLNTQQGKVNLQHNSAGQIKSDKTLPKLSNLKDKFKIRNNKYLRSASSPEKEERDK 84
           P+Y +L+     V+ QH   G+I     +  +SNL+D     NN YLR     +K +R K
Sbjct: 178 PSYGELH----NVSFQH---GEIAIQ--ISHMSNLQD-----NNNYLRRNFINKKNDRWK 223

Query: 85  QQNTIVIVTDDEEPEKQTVQQDIYQEYIPSRIHTTGRESSKHRKIKLTNRRS 136
             N  +  +D  E EK ++      +    RI +  + S  H    L +  S
Sbjct: 224 LLNLQIDFSDKAEKEKHSIYSKAVYDIQRGRILSISQSSKFHSLFALPHYMS 275

>CAGL0E03355g Chr5 complement(307479..312086) [4608 bp, 1535 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015w BPT1 or uniprot|P39109 Saccharomyces cerevisiae
            YDR135c YCF1
          Length = 1535

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 54/106 (50%), Gaps = 10/106 (9%)

Query: 116  IHTTGRESSK-HRKIKLTNRRSANPQRQSESIGTIVTQSTPIPVSSNIDQ--PSILNTFS 172
            ++ + R S K H K+  T  RS     ++   G I+ +      SS++D    ++ N FS
Sbjct: 1018 LYGSLRGSRKLHNKMAKTIMRSPMSFFETTPTGRIINR-----FSSDMDSVDTTLQNVFS 1072

Query: 173  SSLKSVFDYVDTVIDVRFPLLISYRRHVKIMLIVIFILQVNWYIEL 218
               +S+ DY+ TVI V F + + +  +    L+VI++   ++YI L
Sbjct: 1073 LFFRSILDYIITVILVTFNMPLFFLLNAG--LLVIYLYYQSFYIVL 1116

>Suva_62.1 Chr62 complement(3..758) [756 bp, 252 aa] {ON} YIR039C
           (REAL)
          Length = 252

 Score = 30.0 bits (66), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 23/40 (57%)

Query: 151 TQSTPIPVSSNIDQPSILNTFSSSLKSVFDYVDTVIDVRF 190
           T STP+P   +I   S   TF+ ++ S F Y +T+ D+ +
Sbjct: 151 TLSTPLPSVHHITSCSYWGTFNPNISSTFKYNETIFDLTY 190

>NDAI0G03430 Chr7 complement(819024..819752) [729 bp, 242 aa] {ON}
           Anc_8.143 YGL183C
          Length = 242

 Score = 29.6 bits (65), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 8/62 (12%)

Query: 42  NSAGQIKSDKTLPKLSNLKDKFKIRNN--------KYLRSASSPEKEERDKQQNTIVIVT 93
           N+ G++K D  L +L  L DK K+  N        K+     S EKEE+ K  N +  +T
Sbjct: 148 NNGGKLKRDDCLRELKELDDKLKVSKNNVMELEKFKWDDERISLEKEEKLKDINRLEKLT 207

Query: 94  DD 95
           D+
Sbjct: 208 DN 209

>NDAI0D01610 Chr4 (383939..386218) [2280 bp, 759 aa] {ON} Anc_5.275
          Length = 759

 Score = 30.0 bits (66), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 38/72 (52%), Gaps = 6/72 (8%)

Query: 5   GNIPYPIKDLDSFTLSEETRPTYDKLNTQQGKVNLQHNSAGQIKSDKTLPKLSNLKDKFK 64
           G++ +PI DLD F+     RP+   L   QG  + + +   +IK    +PKL+N K+   
Sbjct: 88  GDVNHPI-DLDRFS---GQRPSL--LFDSQGSFDEECDPDAEIKKLINVPKLNNFKEVTL 141

Query: 65  IRNNKYLRSASS 76
            R+  + RS SS
Sbjct: 142 SRSPSFQRSTSS 153

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.359 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,765,563
Number of extensions: 1121364
Number of successful extensions: 6344
Number of sequences better than 10.0: 200
Number of HSP's gapped: 6527
Number of HSP's successfully gapped: 200
Length of query: 229
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 123
Effective length of database: 41,326,803
Effective search space: 5083196769
Effective search space used: 5083196769
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 64 (29.3 bits)