Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D00979g6.14ON56156129670.0
Kwal_56.223876.14ON54356519290.0
SAKL0E01012g6.14ON54456419230.0
KLTH0C11396g6.14ON55050218530.0
Smik_5.276.14ON60862117420.0
Skud_5.296.14ON60862117090.0
TDEL0G045506.14ON56458316990.0
YEL060C (PRB1)6.14ON63548417050.0
Suva_5.76.14ON66448417050.0
ACR012C6.14ON54157216580.0
ZYRO0C07942g6.14ON54856315890.0
NCAS0F002206.14ON69553015960.0
TBLA0A073006.14ON57359215840.0
Ecym_30186.14ON57558415710.0
Kpol_1032.56.14ON68048215570.0
NDAI0K028806.14ON70447215560.0
KNAG0E009206.14ON53157214960.0
CAGL0B03619g6.14ON46847714800.0
KAFR0L003606.14ON50246314680.0
Kpol_1045.756.14ON47745813910.0
TPHA0M002306.14ON58558513790.0
Smik_15.1726.14ON47841912841e-173
Suva_15.1786.14ON47642612791e-172
YOR003W (YSP3)6.14ON47841912581e-169
Skud_15.1646.14ON48241912521e-168
CAGL0E02651g6.14ON48542011451e-151
KAFR0B065506.14ON45642910471e-137
NCAS0D026306.14ON45143610241e-134
NDAI0I022806.14ON4825269041e-115
KNAG0F02970singletonON4203518781e-112
CAGL0L13266gsingletonON5795208251e-102
Smik_3.1496.313ON4914035225e-59
Suva_3.846.313ON5273945221e-58
CAGL0L10802g6.313ON5173825202e-58
TDEL0A072806.313ON4363025142e-58
SAKL0A02002g6.313ON4793995154e-58
ZYRO0D08822g6.313ON4904165155e-58
Kpol_1028.616.313ON5183175151e-57
YCR045C (RRT12)6.313ON4914015078e-57
Skud_3.1246.313ON5404015082e-56
Kpol_1018.56.313ON4653674996e-56
NCAS0D043906.313ON4924295009e-56
KLTH0A06094g6.313ON4962984912e-54
KNAG0I024706.313ON4754114804e-53
TBLA0F039706.313ON7343364837e-52
NDAI0I005606.313ON4834674673e-51
AAR069W6.313ON7683004795e-51
Ecym_21056.313ON6103224612e-49
Kwal_23.61836.313ON4932974491e-48
KAFR0J024506.313ON4783514472e-48
TPHA0D037606.313ON6073154429e-47
KLLA0F06028g6.313ON5083274325e-46
TBLA0A067006.313ON4973603806e-39
KLTH0F02288g1.78ON3803153438e-35
Kwal_33.133721.78ON3773093421e-34
Kpol_2000.691.78ON3863123297e-33
ZYRO0F16764g1.78ON3863132752e-25
TPHA0B045201.78ON3883142715e-25
TDEL0C062301.78ON3642902316e-20
TBLA0A054101.78ON3822652122e-17
SAKL0G00440g2.6ON8362581010.001
NCAS0A008802.6ON833260990.002
TBLA0B001302.6ON842102970.004
ZYRO0F15598g2.6ON79087970.004
Skud_14.1012.6ON819259950.008
KAFR0A080402.6ON766257940.008
NDAI0F038902.6ON833262940.009
CAGL0J07546g2.6ON789250930.013
TPHA0P017902.6ON79999910.023
KLTH0H00418g2.6ON81185900.029
Ecym_64862.6ON78190890.042
YNL238W (KEX2)2.6ON81488880.045
Suva_14.1062.6ON809258880.048
KLLA0D19811g2.6ON756250870.058
KNAG0F007702.6ON82688870.067
Smik_14.972.6ON81488850.10
Kwal_56.248002.6ON80387820.23
Kpol_1015.82.6ON84387770.94
ABL203W2.6ON76882761.4
TPHA0A014008.360ON23045722.3
TPHA0H030007.18ON24767713.4
NDAI0K02490singletonON37789714.3
Kpol_1050.725.85ON98933715.5
TPHA0G016208.669ON492107705.6
NCAS0F030505.383ON145661716.0
TDEL0G010905.85ON98349707.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D00979g
         (561 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar ...  1147   0.0  
Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060...   747   0.0  
SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar ...   745   0.0  
KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {...   718   0.0  
Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON} Y...   675   0.0  
Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON} Y...   662   0.0  
TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {O...   659   0.0  
YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}  PR...   661   0.0  
Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON} YE...   661   0.0  
ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON} S...   643   0.0  
ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {...   616   0.0  
NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14 ...   619   0.0  
TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa] ...   614   0.0  
Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to ...   609   0.0  
Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..841...   604   0.0  
NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {...   603   0.0  
KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {O...   580   0.0  
CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} simila...   574   0.0  
KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14...   570   0.0  
Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa] ...   540   0.0  
TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14...   535   0.0  
Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003...   499   e-173
Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003...   497   e-172
YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putat...   489   e-169
Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003...   486   e-168
CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} simila...   445   e-151
KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6...   407   e-137
NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14     399   e-134
NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {O...   352   e-115
KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON}              342   e-112
CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} som...   322   e-102
Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON...   205   5e-59
Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}...   205   1e-58
CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa...   204   2e-58
TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa] ...   202   2e-58
SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} simila...   202   4e-58
ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} simila...   202   5e-58
Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON} (1383...   202   1e-57
YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}  ...   199   8e-57
Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON...   200   2e-56
Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON} (14365.....   196   6e-56
NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {O...   197   9e-56
KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {...   193   2e-54
KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {O...   189   4e-53
TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {O...   190   7e-52
NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313    184   3e-51
AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic ho...   189   5e-51
Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar t...   182   2e-49
Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa] ...   177   1e-48
KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {...   176   2e-48
TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {O...   174   9e-47
KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some s...   171   5e-46
TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON} Anc_6...   150   6e-39
KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly...   136   8e-35
Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045...   136   1e-34
Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa] ...   131   7e-33
ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]...   110   2e-25
TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa] ...   108   5e-25
TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa] ...    94   6e-20
TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1...    86   2e-17
SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar ...    44   0.001
NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6...    43   0.002
TBLA0B00130 Chr2 (12377..14905) [2529 bp, 842 aa] {ON} Anc_2.6 Y...    42   0.004
ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]...    42   0.004
Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238...    41   0.008
KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa] ...    41   0.008
NDAI0F03890 Chr6 complement(921561..924062) [2502 bp, 833 aa] {O...    41   0.009
CAGL0J07546g Chr10 complement(733686..736055) [2370 bp, 789 aa] ...    40   0.013
TPHA0P01790 Chr16 complement(373247..375646) [2400 bp, 799 aa] {...    40   0.023
KLTH0H00418g Chr8 (46022..48457) [2436 bp, 811 aa] {ON} similar ...    39   0.029
Ecym_6486 Chr6 complement(941694..944039) [2346 bp, 781 aa] {ON}...    39   0.042
YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}  KEX2Subti...    39   0.045
Suva_14.106 Chr14 (196428..198857) [2430 bp, 809 aa] {ON} YNL238...    39   0.048
KLLA0D19811g Chr4 complement(1672338..1674608) [2271 bp, 756 aa]...    38   0.058
KNAG0F00770 Chr6 (137641..140121) [2481 bp, 826 aa] {ON} Anc_2.6...    38   0.067
Smik_14.97 Chr14 (181672..184116) [2445 bp, 814 aa] {ON} YNL238W...    37   0.10 
Kwal_56.24800 s56 complement(1150009..1152420) [2412 bp, 803 aa]...    36   0.23 
Kpol_1015.8 s1015 complement(19725..20576,20692..20940,20990..20...    34   0.94 
ABL203W Chr2 (26256..28562) [2307 bp, 768 aa] {ON} Syntenic homo...    34   1.4  
TPHA0A01400 Chr1 complement(274602..275294) [693 bp, 230 aa] {ON...    32   2.3  
TPHA0H03000 Chr8 (718160..718903) [744 bp, 247 aa] {ON} Anc_7.18...    32   3.4  
NDAI0K02490 Chr11 complement(554669..555802) [1134 bp, 377 aa] {...    32   4.3  
Kpol_1050.72 s1050 complement(157470..160439) [2970 bp, 989 aa] ...    32   5.5  
TPHA0G01620 Chr7 complement(334221..335699) [1479 bp, 492 aa] {O...    32   5.6  
NCAS0F03050 Chr6 (607255..611625) [4371 bp, 1456 aa] {ON} Anc_5....    32   6.0  
TDEL0G01090 Chr7 (223036..225987) [2952 bp, 983 aa] {ON} Anc_5.8...    32   7.4  

>KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 561

 Score = 1147 bits (2967), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 561/561 (100%), Positives = 561/561 (100%)

Query: 1   MKFENTLLTITALSTVATALVIPEVNRENKHGDKSVAIKDHASSDLDKPQHHANGKARSK 60
           MKFENTLLTITALSTVATALVIPEVNRENKHGDKSVAIKDHASSDLDKPQHHANGKARSK
Sbjct: 1   MKFENTLLTITALSTVATALVIPEVNRENKHGDKSVAIKDHASSDLDKPQHHANGKARSK 60

Query: 61  SRGRCADSKKFDKLRPVDDASAILAPLSTVNDIANKIPNRYIIVFKKDASADEVKFHQEL 120
           SRGRCADSKKFDKLRPVDDASAILAPLSTVNDIANKIPNRYIIVFKKDASADEVKFHQEL
Sbjct: 61  SRGRCADSKKFDKLRPVDDASAILAPLSTVNDIANKIPNRYIIVFKKDASADEVKFHQEL 120

Query: 121 VSVEHAKALGSLADNDPFFTATSGEHSEFGVKAHSLEGGIQDSFDIAGSLSGYVGYFTKE 180
           VSVEHAKALGSLADNDPFFTATSGEHSEFGVKAHSLEGGIQDSFDIAGSLSGYVGYFTKE
Sbjct: 121 VSVEHAKALGSLADNDPFFTATSGEHSEFGVKAHSLEGGIQDSFDIAGSLSGYVGYFTKE 180

Query: 181 VIDFIRRSPLVEFVEEDSMVFSNSFNTQNSAPWGLARISHREKLNLGSFNKYLYDDDAGK 240
           VIDFIRRSPLVEFVEEDSMVFSNSFNTQNSAPWGLARISHREKLNLGSFNKYLYDDDAGK
Sbjct: 181 VIDFIRRSPLVEFVEEDSMVFSNSFNTQNSAPWGLARISHREKLNLGSFNKYLYDDDAGK 240

Query: 241 GVTAYVVDTGVNVNHKDFDGRAVWGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAKNAD 300
           GVTAYVVDTGVNVNHKDFDGRAVWGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAKNAD
Sbjct: 241 GVTAYVVDTGVNVNHKDFDGRAVWGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAKNAD 300

Query: 301 IVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQKKGFKGSTANMSLGGGKSPALDLA 360
           IVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQKKGFKGSTANMSLGGGKSPALDLA
Sbjct: 301 IVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQKKGFKGSTANMSLGGGKSPALDLA 360

Query: 361 VNAAVKAGVHFAVAAGNENQDACNTSPAAAENAITVGASTLSDERAYFSNWGKCVDIFGP 420
           VNAAVKAGVHFAVAAGNENQDACNTSPAAAENAITVGASTLSDERAYFSNWGKCVDIFGP
Sbjct: 361 VNAAVKAGVHFAVAAGNENQDACNTSPAAAENAITVGASTLSDERAYFSNWGKCVDIFGP 420

Query: 421 GLNILSTYIGSDTATATLSGTSMATPHVVGLLTYFLSLQPDADSEYFHAAGGITPSQLKK 480
           GLNILSTYIGSDTATATLSGTSMATPHVVGLLTYFLSLQPDADSEYFHAAGGITPSQLKK
Sbjct: 421 GLNILSTYIGSDTATATLSGTSMATPHVVGLLTYFLSLQPDADSEYFHAAGGITPSQLKK 480

Query: 481 KLIDFSTKNVLSDLPEDTVNYLIYNGGGQDLDDLWGKDYSIGKEPSANPEFSLESLINSL 540
           KLIDFSTKNVLSDLPEDTVNYLIYNGGGQDLDDLWGKDYSIGKEPSANPEFSLESLINSL
Sbjct: 481 KLIDFSTKNVLSDLPEDTVNYLIYNGGGQDLDDLWGKDYSIGKEPSANPEFSLESLINSL 540

Query: 541 DSKTDAIFDDVRQLLDQFNII 561
           DSKTDAIFDDVRQLLDQFNII
Sbjct: 541 DSKTDAIFDDVRQLLDQFNII 561

>Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060C
           (PRB1) - vacuolar protease B [contig 185] FULL
          Length = 543

 Score =  747 bits (1929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/565 (65%), Positives = 448/565 (79%), Gaps = 26/565 (4%)

Query: 1   MKFENTLLTITALSTVATALVIPEVNRENKHGDKSVAIKDHASSDLDKPQHHANGKARSK 60
           MK + TL  +  ++ +A+ALV+PEV   +K  D  VA+++ A+S          G++   
Sbjct: 1   MKLQTTL-PVAMVAALASALVLPEVEEASK--DALVAVEETAAS---------LGESILS 48

Query: 61  SRGRCADSKKFDKLRPVDDASAILAPLSTVNDIANKIPNRYIIVFKKDASADEVKFHQEL 120
           S      SK+  K      A   L+PL T  ++ + IP+RYI+VFK     +EV FH E+
Sbjct: 49  SF-----SKEVTKKAAESGAGVTLSPLVTARNMYDAIPHRYIVVFKDRVLPEEVDFHMEV 103

Query: 121 VSVEHAKALGSLADNDPFFTATSGEHSEFGVKAHSLEGGIQDSFDIAGSLSGYVGYFTKE 180
           VS  HA+++G L  ND FF AT  E  E G+ A S EGGI DSFD+ G L GY+GYFT+E
Sbjct: 104 VSEAHAQSVGKLDANDAFFEATMDE--EMGIMATSREGGILDSFDVNGMLRGYIGYFTQE 161

Query: 181 VIDFIRRSPLVEFVEEDSMVFSNSFNTQNSAPWGLARISHREKLNLGSFNKYLYDDDAGK 240
           ++DFIR +PLV FVE+DSMV++N F+TQN APWGL+RISHREKLNLGSFNKYLYDD AGK
Sbjct: 162 IVDFIRMNPLVAFVEQDSMVYANEFDTQNGAPWGLSRISHREKLNLGSFNKYLYDDAAGK 221

Query: 241 GVTAYVVDTGVNVNHKDFDGRAVWGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAKNAD 300
           GVT+YV+DTG+N++HKDF+GRA WGKT+P +D D DGNGHGTHCAGTI S HYGVAKNA+
Sbjct: 222 GVTSYVIDTGINIDHKDFEGRAAWGKTVPTNDLDQDGNGHGTHCAGTIASKHYGVAKNAN 281

Query: 301 IVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQKKGFKGSTANMSLGGGKSPALDLA 360
           +VAVKVLRSNGSG+MSDVVKGVE+ A++H+ AV++ KKGFKGSTANMSLGGGKSPALD+A
Sbjct: 282 VVAVKVLRSNGSGSMSDVVKGVEFAAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDMA 341

Query: 361 VNAAVKAGVHFAVAAGNENQDACNTSPAAAENAITVGASTLSDERAYFSNWGKCVDIFGP 420
           VNAAVKAG+HFAVAAGNENQDACN+SPAAAENAITVGASTL+D+RAYFSNWGKCVDIF P
Sbjct: 342 VNAAVKAGIHFAVAAGNENQDACNSSPAAAENAITVGASTLADDRAYFSNWGKCVDIFAP 401

Query: 421 GLNILSTYIGSDTATATLSGTSMATPHVVGLLTYFLSLQPDADSEYFHAAGGITPSQLKK 480
           GLN+LSTYIGS+TATATLSGTSMA+PHV GLLTYFLSLQPD+DSEYFHAAGGITPSQLKK
Sbjct: 402 GLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKK 461

Query: 481 KLIDFSTKNVLSDLPEDTVNYLIYNGGGQDLDDLWGKDYSIGKEPSA----NPEFSLESL 536
           KLI +STKN L DLPEDTVNYLIYNGGGQDLDD W KD    +E  A    N     ES+
Sbjct: 462 KLIAYSTKNALGDLPEDTVNYLIYNGGGQDLDDFWVKDL---EEKVADAKDNTASEFESI 518

Query: 537 INSLDSKTDAIFDDVRQLLDQFNII 561
           I++L+ KTD +++++R++ +  NII
Sbjct: 519 IDALEEKTDGLYEEIREIFEGLNII 543

>SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 544

 Score =  745 bits (1923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/564 (66%), Positives = 454/564 (80%), Gaps = 23/564 (4%)

Query: 1   MKFENTLLTITALSTVATALVIPEVNRENKHGDKSVAIKDHASSDLDKPQHHANGKARSK 60
           MK ++T+L I AL+T+A ALVIPEV++ +K     V++K+  S   +     A    R  
Sbjct: 1   MKVQSTILPIAALTTLAAALVIPEVDKSSK----DVSVKEINSDSQEVLASFAKEITR-- 54

Query: 61  SRGRCADSKKFDKLRPVDDASAILAPLSTVNDIANKIPNRYIIVFKKDASADEVKFHQEL 120
                A ++K ++++        LAPL +    AN IP+RYIIVFKKDA+ +E+ FH+E+
Sbjct: 55  -----AAAEKGEEVK--------LAPLVSSPQPANIIPHRYIIVFKKDATPEEISFHKEI 101

Query: 121 VSVEHAKALGSLADNDPFFTATSGEHSEFGVKAHSLEGGIQDSFDIAGSLSGYVGYFTKE 180
           +S  HA+++  L   D FF AT G   E+G+ A S EGGIQ+SFDIA  L+GY+GYFT E
Sbjct: 102 ISEAHAESVAKLDSKDSFFAATKGSADEYGIAAKSSEGGIQESFDIANMLNGYIGYFTDE 161

Query: 181 VIDFIRRSPLVEFVEEDSMVFSNSFNTQNSAPWGLARISHREKLNLGSFNKYLYDDDAGK 240
           V+DFIR +  VEF+E+DS+VF++ F+TQN APWGL+RISHRE+LNLGSFNKYLYDDDAGK
Sbjct: 162 VVDFIRMNQWVEFIEKDSLVFASEFDTQNGAPWGLSRISHRERLNLGSFNKYLYDDDAGK 221

Query: 241 GVTAYVVDTGVNVNHKDFDGRAVWGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAKNAD 300
           GVT+YV+DTG+NVNHKDF+GRAVWGKT+P++D D DGNGHGTHCAGTI S HYGVAKNA+
Sbjct: 222 GVTSYVIDTGINVNHKDFNGRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAE 281

Query: 301 IVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQKKGFKGSTANMSLGGGKSPALDLA 360
           +VA+KVLRSNGSGTMSDVVKGVE+ A++H++A ++ KKGFKGSTANMSLGGGKSPALDLA
Sbjct: 282 VVAIKVLRSNGSGTMSDVVKGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLA 341

Query: 361 VNAAVKAGVHFAVAAGNENQDACNTSPAAAENAITVGASTLSDERAYFSNWGKCVDIFGP 420
           VNAAVKAG+HFAVAAGNENQDACNTSPAAAENAITVGASTLSD+RAYFSNWGKCVDIF P
Sbjct: 342 VNAAVKAGIHFAVAAGNENQDACNTSPAAAENAITVGASTLSDDRAYFSNWGKCVDIFAP 401

Query: 421 GLNILSTYIGSDTATATLSGTSMATPHVVGLLTYFLSLQPDADSEYFHAAGGITPSQLKK 480
           GLN+LSTYIGS+TATATLSGTSMA+PHV GLLTYFLSLQPD+DSE+F A+ GITP+QLKK
Sbjct: 402 GLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFLSLQPDSDSEFFQAS-GITPAQLKK 460

Query: 481 KLIDFSTKNVLSDLPEDTVNYLIYNGGGQDLDDLWGKDYSIGKEPSA---NPEFSLESLI 537
           KLI +STK+VL +LPEDT NYLIYNGGGQDL D WGK     KE  +     +F L  LI
Sbjct: 461 KLIAYSTKDVLYELPEDTPNYLIYNGGGQDLSDFWGKSEEQVKEEGSIQDFKDFKLSELI 520

Query: 538 NSLDSKTDAIFDDVRQLLDQFNII 561
            S D+KTD +F++VR + D+ NII
Sbjct: 521 ESFDTKTDLLFEEVRSVFDKLNII 544

>KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 550

 Score =  718 bits (1853), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/502 (68%), Positives = 416/502 (82%), Gaps = 9/502 (1%)

Query: 68  SKKFDKLRPVDDASAILAPLSTVNDIANKIPNRYIIVFKKDASADEVKFHQELVSVEHAK 127
           SK+  K       S  L+PL + +     IP+RYI+VFK++ S +EV FH+++VS  H +
Sbjct: 50  SKQMTKDAASKGESVELSPLVSSSGKYLAIPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQ 109

Query: 128 ALGSLADNDPFFTATSG--EHSEFGV------KAHSLEGGIQDSFDIAGSLSGYVGYFTK 179
           ++  L     FFT+T    E  +F +       A + EGGIQDSFD++G L+GY+GYFT 
Sbjct: 110 SVAKLESTHEFFTSTENFVEDRDFELDYQRSFSAQTREGGIQDSFDVSGLLTGYIGYFTD 169

Query: 180 EVIDFIRRSPLVEFVEEDSMVFSNSFNTQNSAPWGLARISHREKLNLGSFNKYLYDDDAG 239
           E++DFIR +PLV+FVE+DS+VF+  F TQN APWGL+RISHREKLNLGSFNKYLYDDDAG
Sbjct: 170 EIVDFIRMNPLVDFVEQDSVVFAQEFGTQNGAPWGLSRISHREKLNLGSFNKYLYDDDAG 229

Query: 240 KGVTAYVVDTGVNVNHKDFDGRAVWGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAKNA 299
           KGVT+YV+DTGVNV+HKDF+GRA WGKTIP +D D DGNGHGTHCAGTI S HYGVAKNA
Sbjct: 230 KGVTSYVIDTGVNVDHKDFEGRASWGKTIPTNDLDQDGNGHGTHCAGTIASKHYGVAKNA 289

Query: 300 DIVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQKKGFKGSTANMSLGGGKSPALDL 359
           ++VAVKVLRSNGSG+MSDVVKGVE+ A++H+ AV+E KKGFKGSTANMSLGGGKSPALD+
Sbjct: 290 NVVAVKVLRSNGSGSMSDVVKGVEFAAKSHQDAVKENKKGFKGSTANMSLGGGKSPALDM 349

Query: 360 AVNAAVKAGVHFAVAAGNENQDACNTSPAAAENAITVGASTLSDERAYFSNWGKCVDIFG 419
           AVNAAVKAG+HFAVAAGNENQDACN+SPA+AENA+TVGASTL+D+RAYFSNWGKCVDIF 
Sbjct: 350 AVNAAVKAGIHFAVAAGNENQDACNSSPASAENAVTVGASTLADDRAYFSNWGKCVDIFA 409

Query: 420 PGLNILSTYIGSDTATATLSGTSMATPHVVGLLTYFLSLQPDADSEYFHAAGGITPSQLK 479
           PGLN+LSTYIGSDTATATLSGTSMA+PHV GLLTYFLSLQPD+DSEYFHAAGGITPSQLK
Sbjct: 410 PGLNVLSTYIGSDTATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLK 469

Query: 480 KKLIDFSTKNVLSDLPEDTVNYLIYNGGGQDLDDLWGKDYSIGKEPSANPEFSLESLINS 539
           KKLI +STKNVL D+P+DTVNYLI+NGGG+ LDD WGK+ S+  E        +ES I++
Sbjct: 470 KKLIAYSTKNVLGDIPDDTVNYLIFNGGGEGLDDFWGKE-SVVDEVEDTISSEIESFIDA 528

Query: 540 LDSKTDAIFDDVRQLLDQFNII 561
           L+ KTD +++++R++ D  NII
Sbjct: 529 LEEKTDVLYEEIREVFDHMNII 550

>Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  675 bits (1742), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/621 (57%), Positives = 434/621 (69%), Gaps = 73/621 (11%)

Query: 1   MKFENTLLTITALSTVATALVIPEV-NRENKH-------------------GDKSVAIKD 40
           MK ENTL T+ AL +++ ALVIP + N  + H                   GD   +IK 
Sbjct: 1   MKLENTLFTLGALGSISAALVIPNLENAADNHELVSKDKDQETSGNLKFASGDGEKSIKK 60

Query: 41  --------------------------HASSDLDKPQHHANGKARSKSRGRCA-------- 66
                                      +S D DKP        + K +G+          
Sbjct: 61  GHSGGGHGGSHRNGHTGGKGTKSEEGESSDDEDKPHRKGGCHDKKKKKGKKGKKVKSKKH 120

Query: 67  DSKKFDKLRPVDDASAILAPLSTV-----NDIANKIPNRYIIVFKKDASADEVKFHQELV 121
           D K  +K RP +     LAPL +      + I+  IPNRYI+VFKK    +EV FH+E V
Sbjct: 121 DGKTLEKGRPNNK----LAPLVSTAQFNPDAISKIIPNRYIVVFKKGVPEEEVNFHKESV 176

Query: 122 SVEHAKALGSLADNDPFFTATSGEHSEFGVKAHSLEGGIQDSFDIAGSLSGYVGYFTKEV 181
                +++ +L+  D FFT+T   +      + S  GGIQDSF+I    SGY+GYFT+E+
Sbjct: 177 HQAQLQSVENLSAEDAFFTSTRDTY-----LSTSEAGGIQDSFNIDNIFSGYIGYFTQEI 231

Query: 182 IDFIRRSPLVEFVEEDSMVFSNSFNTQNSAPWGLARISHREKLNLGSFNKYLYDDDAGKG 241
           ID IR++PLV+FVE DS+V +  F+TQNSAPWGLARISHRE+LNLGSFNKYLYDDDAG+G
Sbjct: 232 IDLIRQNPLVDFVERDSVVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRG 291

Query: 242 VTAYVVDTGVNVNHKDFDGRAVWGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAKNADI 301
           VT+YV+DTGVN+NHKDF+ RA+WGKTIP +D D+DGNGHGTHCAGTI S HYGVAKNA++
Sbjct: 292 VTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANV 351

Query: 302 VAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQKKGFKGSTANMSLGGGKSPALDLAV 361
           VAVKVLRSNGSGTMSDVVKGVEY A+AH+K  +E+KKGFKGSTANMSLGGGKSPALDLAV
Sbjct: 352 VAVKVLRSNGSGTMSDVVKGVEYAAKAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAV 411

Query: 362 NAAVKAGVHFAVAAGNENQDACNTSPAAAENAITVGASTLSDERAYFSNWGKCVDIFGPG 421
           NAAV+AG+HFAVAAGNENQDACNTSPA+A+ AITVGASTLSD+RAYFSNWGKCVD+F PG
Sbjct: 412 NAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPG 471

Query: 422 LNILSTYIGSDTATATLSGTSMATPHVVGLLTYFLSLQPDADSEYFH-AAGGITPSQLKK 480
           LNILSTYIGSD ATATLSGTSMA+PHV GLLTYFLSLQP +DSE+F      +TP QLKK
Sbjct: 472 LNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKK 531

Query: 481 KLIDFSTKNVLSDLPEDTVNYLIYNGGGQDLDDLWGKDYSIGKEPSANPEFSLESLINSL 540
           KLI +STK++L D+PEDT N+LIYNGGGQDL   W  D        +  E +++  I   
Sbjct: 532 KLIHYSTKDILFDIPEDTPNFLIYNGGGQDLSAFW-NDTKKSHPSGSKHELNMDEFIG-- 588

Query: 541 DSKTDAIFDDVRQLLDQFNII 561
            SKTD +F+ VR +LD+ NII
Sbjct: 589 -SKTDLLFEQVRDVLDKLNII 608

>Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  662 bits (1709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/621 (57%), Positives = 422/621 (67%), Gaps = 73/621 (11%)

Query: 1   MKFENTLLTITALSTVATALVIPEVNRENKHGDKSV----------AIKDHASSDLDKPQ 50
           MK ENTLLT+ AL +++ ALVIP +     H +  V          A+    SS     +
Sbjct: 1   MKLENTLLTLGALGSISAALVIPNLEHAADHHELVVEDNHQERVGHAVHAGGSSHESAKE 60

Query: 51  HHANGKA----------RSKSRGRCADSKK------------------------------ 70
            H +GK           ++  +G C D K                               
Sbjct: 61  SHEDGKHGDEEASKSDDKAHRKGGCHDKKDKKDKKDKKVKSKKEKKVKSKKEKKVKSKKH 120

Query: 71  ----FDKLRPVDDASAILAPLSTVND-----IANKIPNRYIIVFKKDASADEVKFHQELV 121
                +K R  +     LAPL +        +   IPNRYIIVFKK    +   FH+E V
Sbjct: 121 HEKTLEKARHNEK----LAPLVSTAQFDPAAMPKIIPNRYIIVFKKGVPQEATDFHKESV 176

Query: 122 SVEHAKALGSLADNDPFFTATSGEHSEFGVKAHSLEGGIQDSFDIAGSLSGYVGYFTKEV 181
                +++ +L+  D FF +T          + S  GGIQDSF+I    SGY+GYFT+E+
Sbjct: 177 HQAQLQSVENLSAEDAFFISTRDSS-----LSTSETGGIQDSFNIDNMFSGYIGYFTQEI 231

Query: 182 IDFIRRSPLVEFVEEDSMVFSNSFNTQNSAPWGLARISHREKLNLGSFNKYLYDDDAGKG 241
           ID IR++PLV+FVE DS+V +  F+TQNSAPWGLARISHRE+LNLGSFNKYLYDDDAG+G
Sbjct: 232 IDLIRQNPLVDFVERDSVVEATDFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRG 291

Query: 242 VTAYVVDTGVNVNHKDFDGRAVWGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAKNADI 301
           VT+YV+DTGVNVNHKDF+ RA+WGKTIP +D D+DGNGHGTHCAGTI S HYGVAKNA++
Sbjct: 292 VTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANV 351

Query: 302 VAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQKKGFKGSTANMSLGGGKSPALDLAV 361
           VAVKVLRSNGSGTMSDVVKGVEY A AH+K  +E+KKGFKGSTANMSLGGGKSPALDLAV
Sbjct: 352 VAVKVLRSNGSGTMSDVVKGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAV 411

Query: 362 NAAVKAGVHFAVAAGNENQDACNTSPAAAENAITVGASTLSDERAYFSNWGKCVDIFGPG 421
           NAAV+AG+HFAVAAGNENQDACNTSPA+A+ AITVGASTLSD+RAYFSNWGKCVDIF PG
Sbjct: 412 NAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDIFAPG 471

Query: 422 LNILSTYIGSDTATATLSGTSMATPHVVGLLTYFLSLQPDADSEYFHAAG-GITPSQLKK 480
           LNILSTYIGSD ATATLSGTSMA+PHV GLLTYFLSLQP +DSE+F      +TP QLK 
Sbjct: 472 LNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKN 531

Query: 481 KLIDFSTKNVLSDLPEDTVNYLIYNGGGQDLDDLWGKDYSIGKEPSANPEFSLESLINSL 540
           KLI +STK++L D+PEDT N LIYNGGGQDL   W  D           E +++  I   
Sbjct: 532 KLIHYSTKDILFDVPEDTPNALIYNGGGQDLSAFW-NDTKKSHSSRFKQELNMDEFIG-- 588

Query: 541 DSKTDAIFDDVRQLLDQFNII 561
            SKTD IF+ VR +LD+ NII
Sbjct: 589 -SKTDLIFEQVRDVLDKLNII 608

>TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {ON}
           Anc_6.14 YOR003W
          Length = 564

 Score =  659 bits (1699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/583 (59%), Positives = 428/583 (73%), Gaps = 41/583 (7%)

Query: 1   MKFENTLLTITALSTVATALVIPEVNRENKHGDKSVAIKDHASSDLD----KPQHHANGK 56
           M+FE T+L + AL+++  ALVIPE+  +     K  A+       LD    +PQH    +
Sbjct: 1   MRFEQTVLPVAALASLGAALVIPELKGKVLCHGKDKALDHPKDKALDHPRERPQHRGPRR 60

Query: 57  ARSKSRGRCADSKKFDKLRPVDDASAI-------------LAPLSTVNDIANKIPNRYII 103
              +         + D         A+             +APLS      N  P+RYI+
Sbjct: 61  GPRRGPPPPLPEGRHDGPSHEGHHDALPEHRGIVHKMGEGVAPLSIP---PNAFPHRYIV 117

Query: 104 VFKKDASADEVKFHQELVSVEHAKALGSLADNDPFFTATSGEHSEFGVKAHSLEGGIQDS 163
           V K  +S +E+  H E ++    +++G LA +DPFF+A        GV+     GGIQDS
Sbjct: 118 VLKH-SSPEEIALHMEAITQSQLQSVGELAQDDPFFSAQ-------GVRT---TGGIQDS 166

Query: 164 FDIAGSLSGYVGYFTKEVIDFIRRSPLVEFVEEDSMVFSNSFNTQNSAPWGLARISHREK 223
           FD+AG L+GYVGYFT  V++ IR+SP+V+FVE DS V ++ F+TQN APWGL+RISHRE+
Sbjct: 167 FDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHASEFDTQNGAPWGLSRISHRER 226

Query: 224 LNLGSFNKYLYDDDAGKGVTAYVVDTGVNVNHKDFDGRAVWGKTIPKDDPDVDGNGHGTH 283
           LNLGSFNKYL+DD+AGKGVT+YV+DTG+NV H+DF+GRA WGKTIP +D D+DGNGHGTH
Sbjct: 227 LNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRAHWGKTIPTNDEDLDGNGHGTH 286

Query: 284 CAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQKKGFKGS 343
           CAGTI S HYGVAK AD+VAVKVLRSNGSG+MSDV+KGVE+ A++H+KAV+++KKGFKGS
Sbjct: 287 CAGTIASKHYGVAKGADVVAVKVLRSNGSGSMSDVIKGVEFAAQSHQKAVKDKKKGFKGS 346

Query: 344 TANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQDACNTSPAAAENAITVGASTLSD 403
           TANMSLGGGKSPALDLAVNAAVKAG+HFAVAAGNENQDACNTSPAAAE A+TVGASTLSD
Sbjct: 347 TANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAEQAVTVGASTLSD 406

Query: 404 ERAYFSNWGKCVDIFGPGLNILSTYIGSDTATATLSGTSMATPHVVGLLTYFLSLQPDAD 463
           +RAYFSN+GKCVDIF PGLNILSTYIGSD ATATLSGTSMA+PHV GLLTYFLSLQPD+D
Sbjct: 407 DRAYFSNYGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPDSD 466

Query: 464 SEYFHAAG-GITPSQLKKKLIDFSTKNVLSDLPEDTVNYLIYNGGGQDLDDLW-GKDYSI 521
           S++F A   G+TP QLKKKLI +STK++L DLPEDT N LIYNGGG  L   W G D   
Sbjct: 467 SDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPEDTPNALIYNGGGHGLKGFWDGHD--- 523

Query: 522 GKEPSANPEFS---LESLINSLDSKTDAIFDDVRQLLDQFNII 561
             +  AN  F    L+ L ++L +KTDA+FD VR +LD+ NII
Sbjct: 524 --KQEANTRFQDTDLQELSDNLGAKTDALFDQVRDVLDRLNII 564

>YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}
           PRB1Vacuolar proteinase B (yscB), a serine protease of
           the subtilisin family; involved in protein degradation
           in the vacuole and required for full protein degradation
           during sporulation; activity inhibited by Pbi2p
          Length = 635

 Score =  661 bits (1705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/484 (67%), Positives = 385/484 (79%), Gaps = 15/484 (3%)

Query: 84  LAPLSTV-----NDIANKIPNRYIIVFKKDASADEVKFHQELVSVEHAKALGSLADNDPF 138
           LAPL +      + I+  IPNRYIIVFK+ A  +E+ FH+E V     +++ +L+  D F
Sbjct: 161 LAPLVSTAQFNPDAISKIIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAF 220

Query: 139 FTATSGEHSEFGVKAHSLEGGIQDSFDIAGSLSGYVGYFTKEVIDFIRRSPLVEFVEEDS 198
           F +T          + S  GGIQDSF+I    SGY+GYFT+E++D IR++PLV+FVE DS
Sbjct: 221 FISTKDT-----SLSTSEAGGIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDS 275

Query: 199 MVFSNSFNTQNSAPWGLARISHREKLNLGSFNKYLYDDDAGKGVTAYVVDTGVNVNHKDF 258
           +V +  F+TQNSAPWGLARISHRE+LNLGSFNKYLYDDDAG+GVT+YV+DTGVN+NHKDF
Sbjct: 276 IVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDF 335

Query: 259 DGRAVWGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDV 318
           + RA+WGKTIP +D D+DGNGHGTHCAGTI S HYGVAKNA++VAVKVLRSNGSGTMSDV
Sbjct: 336 EKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDV 395

Query: 319 VKGVEYVAEAHKKAVEEQKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNE 378
           VKGVEY A+AH+K  +E+KKGFKGSTANMSLGGGKSPALDLAVNAAV+ G+HFAVAAGNE
Sbjct: 396 VKGVEYAAKAHQKEAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNE 455

Query: 379 NQDACNTSPAAAENAITVGASTLSDERAYFSNWGKCVDIFGPGLNILSTYIGSDTATATL 438
           NQDACNTSPA+A+ AITVGASTLSD+RAYFSNWGKCVD+F PGLNILSTYIGSD ATATL
Sbjct: 456 NQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATL 515

Query: 439 SGTSMATPHVVGLLTYFLSLQPDADSEYFH-AAGGITPSQLKKKLIDFSTKNVLSDLPED 497
           SGTSMA+PHV GLLTYFLSLQP +DSE+F      +TP QLKKKLI +STK++L D+PED
Sbjct: 516 SGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPED 575

Query: 498 TVNYLIYNGGGQDLDDLWGKDYSIGKEPSANPEFSLESLINSLDSKTDAIFDDVRQLLDQ 557
           T N LIYNGGGQDL   W  D           E +++  I    SKTD IFD VR +LD+
Sbjct: 576 TPNVLIYNGGGQDLSAFW-NDTKKSHSSGFKQELNMDEFIG---SKTDLIFDQVRDILDK 631

Query: 558 FNII 561
            NII
Sbjct: 632 LNII 635

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 46/91 (50%), Gaps = 20/91 (21%)

Query: 1  MKFENTLLTITALSTVATALVIPE----------VNRENKHGDKSVAIK-----DHASSD 45
          MK ENTL T+ AL +++ ALVIP           +N+E+ H ++   ++     D   SD
Sbjct: 1  MKLENTLFTLGALGSISAALVIPNLENAADHHELINKEDHH-ERPRKVEFTKDDDEEPSD 59

Query: 46 LDKPQHHANGKARSKSR-GRCADSKKFDKLR 75
           +  +H   GK   K R G+  +S +F+  R
Sbjct: 60 SEDKEH---GKFHKKGRKGQDKESPEFNGKR 87

>Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON}
           YEL060C (REAL)
          Length = 664

 Score =  661 bits (1705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/484 (67%), Positives = 383/484 (79%), Gaps = 14/484 (2%)

Query: 84  LAPLSTVND-----IANKIPNRYIIVFKKDASADEVKFHQELVSVEHAKALGSLADNDPF 138
           LAPL +        I   IPNRYIIVFKKD   +E  FH+E V     +++ +LA  D F
Sbjct: 189 LAPLVSTEQFNPDAITKIIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDAF 248

Query: 139 FTATSGEHSEFGVKAHSLEGGIQDSFDIAGSLSGYVGYFTKEVIDFIRRSPLVEFVEEDS 198
           F +T          + S  GGIQDSF+I    SGY+GYFT+E++D IR++PLV+FVE+DS
Sbjct: 249 FISTRD-----AALSSSEAGGIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDS 303

Query: 199 MVFSNSFNTQNSAPWGLARISHREKLNLGSFNKYLYDDDAGKGVTAYVVDTGVNVNHKDF 258
           +V +  F+TQNSAPWGLAR+SHRE+LNLGSFNKYLYDDDAG+GVT+YV+DTGVNVNHKDF
Sbjct: 304 VVEATDFDTQNSAPWGLARVSHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDF 363

Query: 259 DGRAVWGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDV 318
           + RA+WGKTIP +D D+DGNGHGTHCAGTI S HYGVAKNA++VAVKVLRSNGSGTMSDV
Sbjct: 364 EKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDV 423

Query: 319 VKGVEYVAEAHKKAVEEQKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNE 378
           +KGVEY A+AH+K  EE+KKGFKGSTANMSLGGGKSPALDLAVNAAV+AG+HFAVAAGNE
Sbjct: 424 LKGVEYAAKAHQKQAEEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNE 483

Query: 379 NQDACNTSPAAAENAITVGASTLSDERAYFSNWGKCVDIFGPGLNILSTYIGSDTATATL 438
           NQDACNTSPA+A+ AITVGASTLSD+RAYFSN+GKCVD+F PGLNILSTYIGSD ATATL
Sbjct: 484 NQDACNTSPASADKAITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATATL 543

Query: 439 SGTSMATPHVVGLLTYFLSLQPDADSEYFH-AAGGITPSQLKKKLIDFSTKNVLSDLPED 497
           SGTSMA+PHV GLLTYFLSLQP +DSE+F      +TP QLKKKLI +STK++L D+P+D
Sbjct: 544 SGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPDD 603

Query: 498 TVNYLIYNGGGQDLDDLWGKDYSIGKEPSANPEFSLESLINSLDSKTDAIFDDVRQLLDQ 557
           T N LIYNGGGQDL   W              E +L+  I    SKTD IF+ VR +LD+
Sbjct: 604 TPNALIYNGGGQDLSAFWNDTKKSHSSSGFKQELNLDEFIG---SKTDLIFEQVRDVLDK 660

Query: 558 FNII 561
            NII
Sbjct: 661 LNII 664

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 18/25 (72%)

Query: 1  MKFENTLLTITALSTVATALVIPEV 25
          MK +NTL T+ AL  ++ ALVIP +
Sbjct: 1  MKLQNTLFTLGALGGISAALVIPNL 25

>ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL060C
           (PRB1) and YOR003W (YSP3)
          Length = 541

 Score =  643 bits (1658), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/572 (56%), Positives = 403/572 (70%), Gaps = 42/572 (7%)

Query: 1   MKFENTLLTITALSTVATALVIPEVNRENKHGDKSVAIKDHASSDLDKPQHHANGKARSK 60
           MK +  +    AL+T    L++P+        D+ V  + H    +   Q  A      K
Sbjct: 1   MKLQRAVWPAVALTTAQALLILPQAE------DELVVAEAHRGQLV---QWMARENQERK 51

Query: 61  SRGRCADSKKFDKLRPVDDASAILAPLSTVNDIANKIPNRYIIVFKKDASADEVKFHQEL 120
           ++G    S                 PL  V+D+   IP++YI+VF++  S +E  FH EL
Sbjct: 52  AQGAEQQS-----------------PLFRVDDVTRAIPHKYIVVFREGVSDEEAAFHMEL 94

Query: 121 VSVEHAKALGSLADNDPFFTATSGEHSEFGVKAHSLEGGIQDSFDIAGSLSGYVGYFTKE 180
           V   HA+++  L +   FF +T GE++EFG+ A   EGGI+  F +   L GYVGYFT++
Sbjct: 95  VEAAHAESVARLDEQHAFFRSTRGENNEFGIAATRAEGGIEGEFALGEQLRGYVGYFTED 154

Query: 181 VIDFIRRSPLVEFVEEDSMVFSNSFNTQNSAPWGLARISHREKLNLGSFNKYLYDDDAGK 240
           ++  +R +P V FVEEDSMVF++ F TQN APWGLAR+SHREKLN GSFNKYLYDD++G+
Sbjct: 155 MVGLLRSNPHVHFVEEDSMVFASDFTTQNGAPWGLARVSHREKLNSGSFNKYLYDDNSGE 214

Query: 241 GVTAYVVDTGVNVNHKDFDGRAVWGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAKNAD 300
           GVT+YV+DTG+N++H DF+ RA+WGKTIP +D D DGNGHGTHCAGTI S  YGVAK A+
Sbjct: 215 GVTSYVIDTGINIDHVDFEDRALWGKTIPNNDADYDGNGHGTHCAGTIASKTYGVAKKAN 274

Query: 301 IVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQKKGFKGSTANMSLGGGKSPALDLA 360
           +VAVKVLRSNG+G+MSDV++GVEY  +AH+KA E+  KGFKGSTANMSLGGG+S ALDLA
Sbjct: 275 VVAVKVLRSNGTGSMSDVLRGVEYAVKAHRKAAEKADKGFKGSTANMSLGGGRSQALDLA 334

Query: 361 VNAAVKAGVHFAVAAGNENQDACNTSPAAAENAITVGASTLSDERAYFSNWGKCVDIFGP 420
           V+AAV AG+HFAVAAGNENQDACNTSPAA++ AITVGASTL+D+RAYFSNWG+CVD+F P
Sbjct: 335 VDAAVDAGIHFAVAAGNENQDACNTSPAASQKAITVGASTLADDRAYFSNWGRCVDLFAP 394

Query: 421 GLNILSTYIGSDTATATLSGTSMATPHVVGLLTYFLSLQPDADSEYFHAAGGITPSQLKK 480
           G+NILSTYIGSDTA ATLSGTSMA+PHV GLLTYFLSLQPD DSE F     I+P  LKK
Sbjct: 395 GMNILSTYIGSDTAVATLSGTSMASPHVAGLLTYFLSLQPDGDSE-FRNKQTISPEVLKK 453

Query: 481 KLIDFSTKNVLSDLPEDTVNYLIYNGGGQDLDDLWGKDYSIGKEPSANPEFS-------- 532
           K+IDF TK+ LS LP  T N LIYNGGG DL D WG       +  + P+F+        
Sbjct: 454 KVIDFGTKDALSSLPARTANVLIYNGGGADLSDFWGNK----PKKVSGPKFTYADDEEAM 509

Query: 533 ---LESLINSLDSKTDAIFDDVRQLLDQFNII 561
              L+ LI+ L+S TDA+F   R +LD+ NII
Sbjct: 510 GSDLDRLIHELESSTDAMFSGFRTILDRMNII 541

>ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 548

 Score =  616 bits (1589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/563 (56%), Positives = 396/563 (70%), Gaps = 17/563 (3%)

Query: 1   MKFENTLLTITALSTVATALVIPEVNRENKHGDKSVAIKDHASSDLDKPQHHANGKARSK 60
           MKF+ +++ +  L+ + +AL+IPE+   N++        +      D   +  +  A S 
Sbjct: 1   MKFQKSVIPVATLAGLGSALIIPELTGSNEY--------EKRPERTDDVNNGESVVATSF 52

Query: 61  SRGRCADSKKFDKLRPVDDASAILAPLSTVNDIANKIPNRYIIVFKKDASADEVKFHQEL 120
            +G   D       +   +     APL    D    + NRYII+FKK  +  E+ FH+EL
Sbjct: 53  EKGPSKDELAVFASKLTQEVQDRFAPLVVPEDTLGVLENRYIILFKKGVNPQEIGFHREL 112

Query: 121 VSVEHAKALGSLADNDPFFTATSGEHSEFGVKAHSLEGGIQDSFDIAGSLSGYVGYFTKE 180
           +   H + +  L +   FF     +    GV    L GGI  +FDI G L GY GYF  +
Sbjct: 113 IEQVHLQEVSQLPEEHSFFEGIRLD----GVYDSPL-GGIDHTFDINGMLMGYSGYFPSK 167

Query: 181 VIDFIRRSPLVEFVEEDSMVFSNSFNTQNSAPWGLARISHREKLNLGSFNKYLYDDDAGK 240
           V+D IR SPL+E VE+DS+V++   +T+N APWGLARISHRE+LNLGS+NKYLYD+  G 
Sbjct: 168 VLDVIRMSPLIEMVEQDSVVYTQKADTENGAPWGLARISHRERLNLGSYNKYLYDEQGGS 227

Query: 241 GVTAYVVDTGVNVNHKDFDGRAVWGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAKNAD 300
           GVT+YV+DTGVNV+H  F GRA WGKTIP  D D DGNGHGTHCAGTIGS  YGVAK AD
Sbjct: 228 GVTSYVIDTGVNVHHNQFGGRAKWGKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGAD 287

Query: 301 IVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQKKGFKGSTANMSLGGGKSPALDLA 360
           IVAVKVLRSNGSG+MSDV+KGVE+ A+ H+ AV+++K GFKGSTANMSLGGGKSP+LD A
Sbjct: 288 IVAVKVLRSNGSGSMSDVLKGVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQA 347

Query: 361 VNAAVKAGVHFAVAAGNENQDACNTSPAAAENAITVGASTLSDERAYFSNWGKCVDIFGP 420
           VNAAV AG++FAVAAGNE+QDACNTSPA+A   ITVGASTLSD+RAYFSN+GKCVD+F P
Sbjct: 348 VNAAVAAGLNFAVAAGNEDQDACNTSPASASGPITVGASTLSDDRAYFSNYGKCVDVFAP 407

Query: 421 GLNILSTYIGSDTATATLSGTSMATPHVVGLLTYFLSLQPDADSEYFHAAGGITPSQLKK 480
           GLNILSTYIGSD++TATLSGTSMA+PHV GLL YFLSLQP +DSE F A   I+P QLKK
Sbjct: 408 GLNILSTYIGSDSSTATLSGTSMASPHVAGLLAYFLSLQPGSDSE-FDAGSSISPDQLKK 466

Query: 481 KLIDFSTKNVLSDLPEDTVNYLIYNGGGQDLDDLWGKDYSIGKEPSANPEFSLE--SLIN 538
           KL+ FSTK+VLSD+P  T N LIYNGGG DL   WG    + +E   N +  LE   L++
Sbjct: 467 KLLAFSTKDVLSDIPSGTPNLLIYNGGGGDLSGFWGSK-EVAQELEFNEKVDLELHDLVD 525

Query: 539 SLDSKTDAIFDDVRQLLDQFNII 561
            L SKTDA+F  +R L+D+ +II
Sbjct: 526 ELGSKTDAVFGQIRGLMDRLDII 548

>NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14
           YEL060C
          Length = 695

 Score =  619 bits (1596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/530 (61%), Positives = 396/530 (74%), Gaps = 31/530 (5%)

Query: 1   MKFENTLLTITALSTVATALVIPEVNRENKHGDKSVAIKDHASSDLDKPQHHANGKARSK 60
           MK E T+L I AL+ + +ALVIP + +E+K  DK +AI +   +D+            +K
Sbjct: 1   MKIEKTVLPIAALAALGSALVIPNLAKEDK--DK-LAINNKKFNDI--------TDVVAK 49

Query: 61  SRGRCADSKKFDKLRPVDDASAILAPLSTVNDIA-------------NKIPNRYIIVFKK 107
              +  +S +       D  +  +APL T                  N IPNRYI+VFKK
Sbjct: 50  YSEQIIESARKIGKSVQDSVNLKMAPLVTPTPYPVVSGASANSNANSNIIPNRYIVVFKK 109

Query: 108 DASADEVKFHQELVSVEHAKALGSLADNDPFFTATSGEHSEFGVKAHSLEGGIQDSFDIA 167
               +EV FH+EL++    ++   L  +D FF+A++ E           +GGI  +F+I+
Sbjct: 110 SILPEEVDFHKELINQIQLESAAKLPKDDKFFSASAIEDESIN------QGGILTTFNIS 163

Query: 168 GSLSGYVGYFTKEVIDFIRRSPLVEFVEEDSMVFSNSFNTQNSAPWGLARISHREKLNLG 227
             L+GYVGYFT EV++ IR +PLVE+VE+DS+V +  F+ QN+APWGLARISHRE+LNLG
Sbjct: 164 NLLNGYVGYFTDEVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARISHRERLNLG 223

Query: 228 SFNKYLYDDDAGKGVTAYVVDTGVNVNHKDFDGRAVWGKTIPKDDPDVDGNGHGTHCAGT 287
           SFNKYLYDDDAGKGVT YV+DTG+N  H DF+ RAVWGKTIP +D D+DGNGHGTHCAGT
Sbjct: 224 SFNKYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGNGHGTHCAGT 283

Query: 288 IGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQKKGFKGSTANM 347
           I S HYGVAKNA++VAVKVLRSNGSG+MSDV+KGVE+ AE+H KA +E+KKGFKGSTANM
Sbjct: 284 IASTHYGVAKNAEVVAVKVLRSNGSGSMSDVIKGVEFAAESHIKAAKEKKKGFKGSTANM 343

Query: 348 SLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQDACNTSPAAAENAITVGASTLSDERAY 407
           SLGGGKSP LDLAVNAAV AG+HFAVAAGNENQDACNTSPA+AE AITVGASTLSD+RAY
Sbjct: 344 SLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGASTLSDDRAY 403

Query: 408 FSNWGKCVDIFGPGLNILSTYIGSDTATATLSGTSMATPHVVGLLTYFLSLQPDADSEYF 467
           FSNWGKCVDIF PGLNILSTYIG D ATATLSGTSMA+PHV GLLTYFLSLQP +DSE+F
Sbjct: 404 FSNWGKCVDIFAPGLNILSTYIGDDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFF 463

Query: 468 HAAGGITPSQLKKKLIDFSTKNVLSDLPEDTVNYLIYNGGGQDLDDLWGK 517
                +TP+Q+KKKLI++S+K+VL DLPE T N LI+NG G +LDDLW K
Sbjct: 464 DPT-ELTPAQMKKKLINYSSKDVLFDLPEGTPNKLIFNGAGGNLDDLWNK 512

>TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa]
           {ON} Anc_6.14 YOR003W
          Length = 573

 Score =  614 bits (1584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/592 (55%), Positives = 403/592 (68%), Gaps = 50/592 (8%)

Query: 1   MKFENTLLTITALSTVATALVIPEVNRENKHGDKSVAIKDHASSDLDKPQH--------- 51
           MK E T L   A  +VA++ +IP   R  +  DK V     A +D +  +H         
Sbjct: 1   MKLEKTSLVSLATISVASSFLIPADERMLR--DKLVPQHGKAGADAEHAKHKGGQHSVVK 58

Query: 52  HANGKARSKSRGRCADSKKFDKLRPVDDA--------------------SAILAPL-STV 90
           H + K   +SR +    K  D     D                      S  +APL S  
Sbjct: 59  HNSAKHHKQSRKQMRVHKHDDSDSGSDSDSGSDSDGDGDGDGDGDGNYESPAIAPLYSQS 118

Query: 91  NDIANKIPNRYIIVFKKDASADEVKFHQELVSVEHAKALGSLADNDPFFTATSGEHSEFG 150
               N IP+RYII FKKD + +E+ FHQ+ ++    +++  L  + P+F +  G      
Sbjct: 119 LHPQNIIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPYFNSVEGL----- 173

Query: 151 VKAHSLEGGIQDSFDIAGSLSGYVGYFTKEVIDFIRRSPLVEFVEEDSMVFSNSFNTQNS 210
                L+  I DSF+I   L GY+GYFT +VIDFIR +PLV+FVE+DS V  N F+TQN 
Sbjct: 174 ----DLQQPIIDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEFDTQNG 229

Query: 211 APWGLARISHREKLNLGSFNKYLYDDDAGKGVTAYVVDTGVNVNHKDFDGRAVWGKTIPK 270
           APWGLARISHRE+LNLGSFNKYL+DD AG+GVTAYV+DTGVNV H DF+GRA WGKTIP 
Sbjct: 230 APWGLARISHRERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRASWGKTIPN 289

Query: 271 DDPDVDGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHK 330
           +D D+DGNGHGTHCAGTI S HYGVAKNA++VAVKVLRSNGSG+MSDV+KGVEY   +H 
Sbjct: 290 NDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVLKGVEYATASHL 349

Query: 331 KAVEEQKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQDACNTSPAAA 390
             V+ +K GFKGSTANMSLGGGKSP+LDLAVNAAVKAG+HFAVAAGNENQDACNTSPA+A
Sbjct: 350 ADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDACNTSPASA 409

Query: 391 ENAITVGASTLSDERAYFSNWGKCVDIFGPGLNILSTYIGSDTATATLSGTSMATPHVVG 450
           + AITVGASTLSD+RAYFSNWGKCVD+F PGLNILSTYIGSD ATATLSGTSMA+PHV G
Sbjct: 410 KYAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAG 469

Query: 451 LLTYFLSLQPDADSEYFHA-AGGITPSQLKKKLIDFSTKNVLSDLPEDTVNYLIYNGGGQ 509
           LL+YFLSLQP+ DSE+  +  GGITP+QLKK+LI + TK++L D+PE T N L++NG GQ
Sbjct: 470 LLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVLVFNGAGQ 529

Query: 510 DLDDLWGKDYSIGKEPSANPEFSLESLINSLDSKTDAIFDDVRQLLDQFNII 561
           DL D W    +I K      +     +  +LD   D ++D    +  + N++
Sbjct: 530 DLSDFW----NISKP----ADLESNEVYKNLDLVGDVLYDQFTGIFKKMNLL 573

>Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to
           Ashbya gossypii ACR012C
          Length = 575

 Score =  609 bits (1571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/584 (52%), Positives = 401/584 (68%), Gaps = 32/584 (5%)

Query: 1   MKFENTLLTITALSTVATALVIPEVNRENKHGDKSVAIKDHASSDLDKPQHHANGKARSK 60
           MK ++ +L +   ST+  AL++P ++ E +     V +          P HH   K    
Sbjct: 1   MKVQSVVLPVAVFSTLGAALILPWMDPEIR---LDVGLHGRGPHGRVPPPHHH--KMGEH 55

Query: 61  SRGRCADSKKFDKLRPVDDASAILAP-----------------LSTVNDIANKIPNRYII 103
            RGR     +   +  VDD    ++P                 L++++D +  IP+RYI+
Sbjct: 56  GRGRGKGHHRGSSVLLVDDEEDKVSPMFEYFEFDSSQDFVDMKLASLSDNSRAIPHRYIV 115

Query: 104 VFKKDASADEVKFHQELVSVEHAKALGSLADNDPFFTATSGEHSEFGVKAHSLEGGIQDS 163
           +FK   +  +V  HQ+LV+  H + +  L     FF AT G H E G+ A S+EGGI++ 
Sbjct: 116 IFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHE-GISARSVEGGIEEM 174

Query: 164 FDIAGSLSGYVGYFTKEVIDFIRRSPLVEFVEEDSMVFSNSFNTQNSAPWGLARISHREK 223
           F+IAGSL GY GYFT  ++D IR S LV+ +E+DS+V ++ F TQ  APWGLAR+SHRE+
Sbjct: 175 FEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSHRER 234

Query: 224 LNLGSFNKYLYDDDAGKGVTAYVVDTGVNVNHKDFDGRAVWGKTIPKDDPDVDGNGHGTH 283
           LNLGSFNKYLYDD+AGKGVTAYV+DTG+N++H +F+GRA WGKTIP +D D DGNGHGTH
Sbjct: 235 LNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTH 294

Query: 284 CAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQKKGFKGS 343
           CAGTI S  YGVAKNA +VAVKVLR+NG+GTMSDV++GVEYV   H+KA  +    FKGS
Sbjct: 295 CAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEHRKASGDPN--FKGS 352

Query: 344 TANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQDACNTSPAAAENAITVGASTLSD 403
           TANMSLGGGKS AL+LAV+AAV AG+HFAVAAGNENQDACNTSPA+++  ITV ASTLSD
Sbjct: 353 TANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCITVAASTLSD 412

Query: 404 ERAYFSNWGKCVDIFGPGLNILSTYIGSDTATATLSGTSMATPHVVGLLTYFLSLQPDAD 463
           +RAYFSNWG CVDIF PGLNILSTYIGSDTA ATLSGTSMA+PHV GLL YFLSLQPD+ 
Sbjct: 413 DRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSG 472

Query: 464 SEYFHAAGGITPSQLKKKLIDFSTKNVLSDLPEDTVNYLIYNGGGQDLDDLWG------K 517
           SEY+     I+P  LKKK++ + +KN+L+++P  T N LI+NGGG  LD  W       +
Sbjct: 473 SEYY-TGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFWNSKCDGCE 531

Query: 518 DYSIGKEPSANPEFSLESLINSLDSKTDAIFDDVRQLLDQFNII 561
              +        +F  ESL++ L S + ++F ++R  LD+ ++I
Sbjct: 532 QEKVSSSHGKADDFESESLMDCLHSTSHSLFGEIRNFLDRLDLI 575

>Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..8410)
           [2043 nt, 681 aa]
          Length = 680

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/482 (60%), Positives = 378/482 (78%), Gaps = 23/482 (4%)

Query: 85  APLSTVNDIANK---IPNRYIIVFKKDASADEVKFHQELVSVEHAKALGSLADNDPFFTA 141
           APL ++ +   +   IPN+YIIVFKKD S  +++ H++L++    +           + +
Sbjct: 217 APLHSMENTKYENLVIPNKYIIVFKKDVSVKDMQIHKDLIARAQFQ-----------YAS 265

Query: 142 TSGEHSEFGVKAHSLEGGIQDSFDIAGSLSGYVGYFTKEVIDFIRRSPLVEFVEEDSMVF 201
            S E S       S+ GGI+++F++A    GY+G+F ++++ FIR SP+V+FVE+DS+V 
Sbjct: 266 VSDETSS------SILGGIEEAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVEQDSIVH 319

Query: 202 SNSFNTQNSAPWGLARISHREKLNLGSFNKYLYDDDAGKGVTAYVVDTGVNVNHKDFDGR 261
           +N  +TQN+APWGLARISHR+ LNLGS+NKYLYDD AG+GVTAYV+DTG+N+ HK+F GR
Sbjct: 320 ANEVDTQNNAPWGLARISHRDGLNLGSYNKYLYDDVAGEGVTAYVIDTGINIKHKEFGGR 379

Query: 262 AVWGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKG 321
           AVWGKTIP++D DVDGNGHGTHCAGTI S +YGVAKNA++VAVKVLRS+GSGTMSDV+KG
Sbjct: 380 AVWGKTIPENDQDVDGNGHGTHCAGTIASKNYGVAKNAEVVAVKVLRSDGSGTMSDVLKG 439

Query: 322 VEYVAEAHKKAVEEQKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQD 381
           VEY A +H+KA+ E+KKGFKGSTANMSLGGGKS +LDLAV+AAVK+G+HFAVAAGNENQD
Sbjct: 440 VEYAAFSHQKALREKKKGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQD 499

Query: 382 ACNTSPAAAENAITVGASTLSDERAYFSNWGKCVDIFGPGLNILSTYIGSDTATATLSGT 441
           ACN+SPAA+ENAITVGASTLSD+RAYFSNWGKCVD+F PGLNILSTYIGSD ATATLSGT
Sbjct: 500 ACNSSPAASENAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGT 559

Query: 442 SMATPHVVGLLTYFLSLQPDADSEYFHA-AGGITPSQLKKKLIDFSTKNVLSDLPEDTVN 500
           SMA+PHV GLL+YFLS+QPDADSE+F + +  I+P+QLKKKLI +STKN+  DLPE T N
Sbjct: 560 SMASPHVAGLLSYFLSMQPDADSEFFSSGSNSISPAQLKKKLIAYSTKNLFQDLPEKTPN 619

Query: 501 YLIYNGGGQDLDDLWGKDYSIGKEPSAN-PEFSLESLINSLDSKTDAIFDDVRQLLDQFN 559
            L+YN  G ++ D W        EP+    EF LE L++S     D   + ++Q+ ++ +
Sbjct: 620 LLVYN-AGHNISDFWKPKSESSAEPNERAKEFELEDLVDSAQWIADTWLNGIQQVFERMD 678

Query: 560 II 561
           + 
Sbjct: 679 LF 680

>NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {ON}
           Anc_6.14
          Length = 704

 Score =  603 bits (1556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/472 (64%), Positives = 370/472 (78%), Gaps = 13/472 (2%)

Query: 97  IPNRYIIVFKKDASADEVKFHQELVSVEHAKALGSLADNDPFFTATSGEHSEFGVKAHSL 156
           +PN+YIIVFK   + DE+ +H+EL+S    ++   L  +  FF +TS E      +    
Sbjct: 239 LPNKYIIVFKDSINIDEISYHKELISEIQQQSASRLPPHHHFFHSTSEE-----EEESFR 293

Query: 157 EGGIQDSFDIAGSLSGYVGYFTKEVIDFIRRSPLVEFVEEDSMVFSNSFNTQNSAPWGLA 216
            GGI  SF+I   LSGY GYFT+EVID IR +PLV++VE DS+V +  FNTQN+APWGL+
Sbjct: 294 NGGIISSFNINNILSGYSGYFTQEVIDLIRLNPLVKYVERDSIVQTTEFNTQNNAPWGLS 353

Query: 217 RISHREKLNLGSFNKYLYDDDAGKGVTAYVVDTGVNVNHKDFDGRAVWGKTIPKDDPDVD 276
           RISHRE+LNLGSFNKYLYDDDAGKGVT +V+DTG+NVNH DF  RA+WGKTIP +D D+D
Sbjct: 354 RISHRERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVNHVDFGKRAIWGKTIPSNDQDID 413

Query: 277 GNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQ 336
           GNGHGTHCAGTI S HYGVAKNA++VAVKVLRSNGSG+MSDV+KGVE+ AE H    E+ 
Sbjct: 414 GNGHGTHCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMSDVIKGVEFAAETHLNN-EKN 472

Query: 337 KKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQDACNTSPAAAENAITV 396
           KK +KGSTANMSLGGGKSP LDLAVNAAV+AG+HF+VAAGNENQDACN+SPA+AENAITV
Sbjct: 473 KKDYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNENQDACNSSPASAENAITV 532

Query: 397 GASTLSDERAYFSNWGKCVDIFGPGLNILSTYIG-SDTATATLSGTSMATPHVVGLLTYF 455
           GASTLSD+RAYFSNWG+CVD+F PGLNILSTY+G  +  TATLSGTSMA+PHV GLLTYF
Sbjct: 533 GASTLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNTATLSGTSMASPHVAGLLTYF 592

Query: 456 LSLQPDADSEYFHAA--GGITPSQLKKKLIDFSTKNVLSDLPEDTVNYLIYNGGGQDLDD 513
           LSLQPD+ S +F++   G ITP QLKKKLI +ST ++L DLP+ T N LIYNG G D+ D
Sbjct: 593 LSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYDLPDGTPNKLIYNGAGGDISD 652

Query: 514 LW-GK-DYSIGKEPSANPEFSLESLI--NSLDSKTDAIFDDVRQLLDQFNII 561
           LW GK      +EP+   + + E+L+  +S+  KTD  FD +R + ++ NII
Sbjct: 653 LWNGKVQEQAHEEPAHEDKINFENLVDSDSMSGKTDLFFDQIRNVFEKMNII 704

>KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {ON}
           Anc_6.14 YOR003W
          Length = 531

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/572 (54%), Positives = 390/572 (68%), Gaps = 52/572 (9%)

Query: 1   MKFENTLLTITALSTVATALVIPEVNREN-----KHGDKSVAIKDHASSDLDKPQH---H 52
           MK    +L   AL+ VA ALV+PE+  E      +HG +   +++H      +P H   H
Sbjct: 1   MKITQPVLWAVALNRVAEALVLPEIRDERGVSQGEHGGRRHDVEEHGRRG--RPHHGPKH 58

Query: 53  ANGKARSKSRGRCADSKKFDKLRPVDDASAILAPLST---VNDIANKIPNRYIIVFKKDA 109
              + R    G+ A  ++             LAPL T       ++   N+YII+FK+  
Sbjct: 59  EKDEHRPCKHGKEAHDEE------------ELAPLYTPGSALSASSSRSNKYIILFKEGV 106

Query: 110 SADEVKFHQELVSVEHAKALGSLADNDPFFTATSGEHSEFGVKAHSLEGGIQDSFDIAGS 169
           +A+++  H++L+     + L   +D                V A  +   + DSFD+ G 
Sbjct: 107 TAEQISAHKQLLQ----QVLLETSD----------------VSAQGIVADVLDSFDLEGV 146

Query: 170 LSGYVGYFTKEVIDFIRRSPLVEFVEEDSMVFSNSFNTQNSAPWGLARISHREKLNLGSF 229
           LSGYV   +  V++ +RRSP V+ VE+DS V +N F+TQN+APWGLARISHR+ L+LGSF
Sbjct: 147 LSGYVAELSPMVLELVRRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARISHRDPLSLGSF 206

Query: 230 NKYLYDDDAGKGVTAYVVDTGVNVNHKDFDGRAVWGKTIPKDDPDVDGNGHGTHCAGTIG 289
           NKYLYDD AG+GV +Y++DTG+NV HK+F+GRA WGKTIP +D D DGNGHGTHCAGTI 
Sbjct: 207 NKYLYDDAAGEGVDSYIIDTGINVKHKEFEGRAQWGKTIPDNDFDEDGNGHGTHCAGTIA 266

Query: 290 SVHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQKKGFKGSTANMSL 349
           S HYGVAK A+++AVKVLRSNGSG+MSDV+ GVE+ A+ H    +   K FKGSTANMSL
Sbjct: 267 SKHYGVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDKKFKGSTANMSL 326

Query: 350 GGGKSPALDLAVNAAVKAGVHFAVAAGNENQDACNTSPAAAENAITVGASTLSDERAYFS 409
           GGGKSP+LD  V+AAVK G+HF+VAAGNENQDACNTSPAA+E AITVGASTLSD+RAYFS
Sbjct: 327 GGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSPAASERAITVGASTLSDDRAYFS 386

Query: 410 NWGKCVDIFGPGLNILSTYIGSDTATATLSGTSMATPHVVGLLTYFLSLQPDADSEYFHA 469
           NWG CVDIF PGLNILSTY GSD ATATLSGTSMA+PHV GLLTYFLSLQP+  S+ F  
Sbjct: 387 NWGSCVDIFAPGLNILSTYTGSDDATATLSGTSMASPHVAGLLTYFLSLQPEKSSQ-FGT 445

Query: 470 AGGITPSQLKKKLIDFSTKNVLSDLPEDTVNYLIYNGGGQDLDDLWGKDYSIGKEPSANP 529
           +  ITP QLKKKL+D+STK VL DLPEDT N LIYNGGG DL D WG     GK+ S  P
Sbjct: 446 SAQITPEQLKKKLLDYSTKGVLFDLPEDTPNALIYNGGGADLSDFWGDK---GKK-SHKP 501

Query: 530 EFSLESLINSLDSKTDAIFDDVRQLLDQFNII 561
            F+ E   +++ + +DA+F+ VR +  + NI 
Sbjct: 502 LFAHE--YDNVWASSDAMFEQVRAMFGKLNIF 531

>CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} similar
           to uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
           protease B or uniprot|P25036 Saccharomyces cerevisiae
           YOR003w YSP3
          Length = 468

 Score =  574 bits (1480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/477 (61%), Positives = 362/477 (75%), Gaps = 22/477 (4%)

Query: 97  IPNRYIIVFKKDASADEVKFHQELVSVEHAKALGSLADNDPFFTATSGEHSEFGVKAHSL 156
           +P++YI+V KK  S + V      VS  HA A+  L     FF   + E    G+     
Sbjct: 2   VPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNFVNAE----GLP---- 53

Query: 157 EGGIQDSFDIAGSLSGYVGYFTKEVIDFIRRSPLVEFVEEDSMVFSNSFNTQNSAPWGLA 216
            GGI+D F+I     G +GYF + V+  + +S +VEFVE DS+V +++F+TQN+APWGLA
Sbjct: 54  RGGIKDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLA 113

Query: 217 RISHREKLNLGSFNKYLYDDDAGKGVTAYVVDTGVNVNHKDFDGRAVWGKTIPKDDPDVD 276
           RISHR++LNLG+FNKYLYD+  G+GVTAYV+DTG+NV H +FDGRA WGKTIP +D D+D
Sbjct: 114 RISHRDRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDID 173

Query: 277 GNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQ 336
           GNGHGTHCAGTI S HYG+AK A++VAVKVL+S+GSGTMSDV+KGVEY A+AH K  +  
Sbjct: 174 GNGHGTHCAGTIASKHYGIAKKANVVAVKVLKSDGSGTMSDVIKGVEYAAQAHLKESKNN 233

Query: 337 KKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQDACNTSPAAAENAITV 396
           KK FKGSTANMSLGGGKSPALD+AVNAAV AG+HFAVAAGNENQDACNTSPA+AE AITV
Sbjct: 234 KK-FKGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITV 292

Query: 397 GASTLSDERAYFSNWGKCVDIFGPGLNILSTYIG-SDTATATLSGTSMATPHVVGLLTYF 455
           GASTLSD+RAYFSNWGKCVDIF PGLNILSTYIG ++  TA+LSGTSMA+PHV GLLTYF
Sbjct: 293 GASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYF 352

Query: 456 LSLQPDADSEYFHAAG-GITPSQLKKKLIDFSTKNVLSDLPE-DTVNYLIYNGGGQDLDD 513
           LSLQPD+DSE++ A+  G+TP+QLKKKLI +STKNVL+DLP+ D+ N LIYNG G DL  
Sbjct: 353 LSLQPDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGV 412

Query: 514 LWGKDYSIGKEPSANPEF---------SLESLINSLDSKTDAIFDDVRQLLDQFNII 561
            W    S  ++ + +PE          SL  ++    + TD++F  VR LLD+ NII
Sbjct: 413 FWNST-SADEQSAEHPEQRIAAELGLDSLAKMVGDRHAATDSLFGQVRNLLDKMNII 468

>KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14
           YOR003W
          Length = 502

 Score =  570 bits (1468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/463 (62%), Positives = 349/463 (75%), Gaps = 20/463 (4%)

Query: 67  DSKKFDKLRPVDDASAILAPLSTVNDIANKIPNRYIIVFKKDASADEVKFHQELVSVEHA 126
           DS KF  L PV +A           D  N IP+RYIIVFK   S ++++FH+EL++  H 
Sbjct: 39  DSAKFSSLAPVHNA-----------DAENIIPHRYIIVFKDGVSKEQIQFHKELITTLHL 87

Query: 127 KALGSLADNDPFFTATSGEHSEFGVKAHSLEGGIQDSFDIAGSLSGYVGYFTKEVIDFIR 186
           +   + +++   +  T     E      SL GGI   FDI+  LSGY+ Y + E++ FIR
Sbjct: 88  QQSSAFSNDFTEYLQTDINVPE--SMRQSL-GGIVSDFDISSLLSGYIAYLSDELLHFIR 144

Query: 187 RSPLVEFVEEDSMVFSNSFNTQNSAPWGLARISHREKLNLGSFNKYLYDDDAGKGVTAYV 246
            +PL+ F+E D+MV +  FNTQN+APWGLARISHRE LNL +FNKYLYDDDAGK V AYV
Sbjct: 145 LNPLIAFIEHDTMVHTTDFNTQNNAPWGLARISHRESLNLANFNKYLYDDDAGKNVDAYV 204

Query: 247 VDTGVNVNHKDFDGRAVWGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAKNADIVAVKV 306
           +DTGV+VNH +F  RA WGKTIP +D D+DGNGHGTH AGTIGS HYGVAK+ +I+AVKV
Sbjct: 205 IDTGVDVNHVEFHSRAHWGKTIPLNDQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKV 264

Query: 307 LRSNGSGTMSDVVKGVEYVAEAHKKAVEEQKKGFKGSTANMSLGGGKSPALDLAVNAAVK 366
           LRSNGSG+MSDVVKGVE+   +H + ++ +K   KGS ANMSLGGGKSPALDLAVNAAVK
Sbjct: 265 LRSNGSGSMSDVVKGVEFAVSSHLERMKNEKN-LKGSVANMSLGGGKSPALDLAVNAAVK 323

Query: 367 AGVHFAVAAGNENQDACNTSPAAAENAITVGASTLSDERAYFSNWGKCVDIFGPGLNILS 426
           AG+HFAVAAGNENQ+ACN+SPA+AE A+TVGAST+SDERAYFSNWG+CVDIF PGLNILS
Sbjct: 324 AGIHFAVAAGNENQNACNSSPASAEQAVTVGASTISDERAYFSNWGECVDIFAPGLNILS 383

Query: 427 TYIGS-DTATATLSGTSMATPHVVGLLTYFLSLQPDADSEYFHAAGGITPSQLKKKLIDF 485
           TYIG+ D  TATLSGTSMA+PHV GLL Y+LSLQP+  SE+  +   I+ SQLKKKLI++
Sbjct: 384 TYIGANDDVTATLSGTSMASPHVAGLLAYYLSLQPEKSSEF--STRAISTSQLKKKLIEY 441

Query: 486 STKNVLSDLPEDTVNYLIYNGGGQDLDDLWGKDYSIGKEPSAN 528
           +TK+VL DLPE T N LIYNGGGQDL D W    S  K P +N
Sbjct: 442 ATKDVLEDLPEGTPNVLIYNGGGQDLSDFWNLQNS--KIPGSN 482

>Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa]
           {ON} complement(174972..176405) [1434 nt, 478 aa]
          Length = 477

 Score =  540 bits (1391), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/458 (58%), Positives = 329/458 (71%), Gaps = 8/458 (1%)

Query: 86  PLSTVNDIANKIPNRYIIVFKKDASADEVKFHQELVSVEHAKALGSLADNDPFFTATSGE 145
           P S +   +  IP  YI+VF +  + +E+  H E +S    +++  L  +  FFT ++  
Sbjct: 24  PASLITPNSEVIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTISTSS 83

Query: 146 HSEFGVKAHSLEGGIQDSFDIAGSLSGYVGYFTKEVIDFIRRSPLVEFVEEDSMVFSNSF 205
                V ++ L GG++D F I   L GY G FT EV++F+R SPLV+F+E DSMV +   
Sbjct: 84  D----VNSNGLLGGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTEA 139

Query: 206 NTQNSAPWGLARISHREKLNLGSFNKYLYDDDAGKGVTAYVVDTGVNVNHKDFDGRAVWG 265
            TQ +APWGLARISHR +LNL +FNKYLYDD  GKGV AYV+DTG+N+ + DF GRA WG
Sbjct: 140 TTQYNAPWGLARISHRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAYWG 199

Query: 266 KTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYV 325
           KTIP  + +VDGNGHGTH AGTI S+HYGVAK   + AVKVLRSNG+G+MSDV+KGVEYV
Sbjct: 200 KTIPAGEANVDGNGHGTHVAGTIASIHYGVAKQVKVYAVKVLRSNGAGSMSDVLKGVEYV 259

Query: 326 AEAHKKAVEEQKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQDACNT 385
             AH++ V     GFKGS ANMSLGGGKS +LDLAVNAAV AGVHFAVAAGNENQDACNT
Sbjct: 260 VGAHQRDV--GTAGFKGSVANMSLGGGKSRSLDLAVNAAVGAGVHFAVAAGNENQDACNT 317

Query: 386 SPAAAENAITVGASTLSDERAYFSNWGKCVDIFGPGLNILSTYIGSDTATATLSGTSMAT 445
           SPAAAE AITVGASTLSD RAYFSNWG+CV IF PGLNILSTYIGS  ATATLSGTSMA+
Sbjct: 318 SPAAAERAITVGASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSGTSMAS 377

Query: 446 PHVVGLLTYFLSLQPDADSEYFH--AAGGITPSQLKKKLIDFSTKNVLSDLPEDTVNYLI 503
           PH+ GL+ YFLSLQP   S+++    A  ITP QLKKK++ F TKN L DLP +T N + 
Sbjct: 378 PHIAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTPNVIA 437

Query: 504 YNGGGQDLDDLWGKDYSIGKEPSANPEFSLESLINSLD 541
           YNG G+ L+D W  +  +    S      L+ ++N ++
Sbjct: 438 YNGAGKSLEDFWNANDYVKNYQSLVITEQLQFILNKMN 475

>TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14
           YOR003W
          Length = 585

 Score =  535 bits (1379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/585 (52%), Positives = 388/585 (66%), Gaps = 58/585 (9%)

Query: 1   MKFENTLLTITALSTVATALVIPEVNRENKHGDKSVAIKDHASSDLDKPQHHANGKARSK 60
           MK +NTL++    ++VA ALVIP +++    G        HA   LD   ++ N      
Sbjct: 35  MKLQNTLVSAVIAASVAEALVIPALDQGRGRG--------HA---LDHGPNNNNNVPAFM 83

Query: 61  SRGRCADSKKFDKLRPVDDASAILA------------PLSTVND--IANKIPNRYIIVFK 106
            R   A +   + ++ V D   ILA             L+ ++D  +     +RYIIVFK
Sbjct: 84  MRAAAAPASAMEMVKDVTDQ--ILAYYQHASPASRGLELAALHDNGVGTADHDRYIIVFK 141

Query: 107 KDASADEVKFHQELVSVEHAKALGSLADNDPFFTATSGEHSEFGVK-AHSLEGG---IQD 162
           K    ++V  H +++S                F   S E        A +L  G   + D
Sbjct: 142 KGVFKEQVDQHLKMMSA--------------LFRRLSEEQRPAAAPGASALRDGFDRVMD 187

Query: 163 SFDIAGSLSGYVGYF-TKEVIDFIRRSPLVEFVEEDSMVFSNSFNTQNSAPWGLARISHR 221
           +F++AG+ SGY+    + +++DFIR +PLV++VE+DS+V S    TQN+APWGLARISHR
Sbjct: 188 TFEVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLD-ETQNNAPWGLARISHR 246

Query: 222 EKLNLGSFNKYLY-DDDAGKGVTAYVVDTGVNVNHKDFDGRAVWGKTIPKDDPDVDGNGH 280
           E LNLG+FNKYLY  + AGKGVTAYVVDTG++V+H +F  RA WGKTIP +D D+DGNGH
Sbjct: 247 EGLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYDIDGNGH 306

Query: 281 GTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQKK-- 338
           GTHCAGTIGS HYGVAK A++VAVKVLRS+GSGTMSDV+KGVE+VA  H K +EE +K  
Sbjct: 307 GTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEESRKDK 366

Query: 339 --GFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQDACNTSPAAAENAITV 396
              +KG+TANMSLGGGKSPALD AVNAAVKAGVHFAVAAGNENQDACN+SPAAAENAITV
Sbjct: 367 NSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAENAITV 426

Query: 397 GASTLSDERAYFSNWGKCVDIFGPGLNILSTYIGSDTATATLSGTSMATPHVVGLLTYFL 456
           GASTLSD+RAYFSN+GKCVDIF PGLNILSTYIG++ ATATLSGTSMA+PHV GLLTY L
Sbjct: 427 GASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTNDATATLSGTSMASPHVAGLLTYLL 486

Query: 457 SLQPDADSEYFHAAGGITPSQLKKKLIDFSTKNVLSDLPEDTVNYLIYNGGGQDLDDLWG 516
           SLQPD  SE++     +TP Q+KKK+ID++TKN L+DLP DT N LIYNGG     D W 
Sbjct: 487 SLQPDKGSEFYVPNSELTPLQMKKKIIDYATKNALADLPADTPNKLIYNGGFNST-DFWA 545

Query: 517 KDYSIGKEPSANPEFSLESLINSLDSKTDAIFDDVRQLLDQFNII 561
              +          +SL S ++S+    +  F+      D  NI 
Sbjct: 546 SAAAPQSHKVKTNRYSLGSFLDSIQDSNNHWFN-----FDNMNIF 585

>Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003W
           (REAL)
          Length = 478

 Score =  499 bits (1284), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 238/419 (56%), Positives = 311/419 (74%), Gaps = 7/419 (1%)

Query: 97  IPNRYIIVFKKDASADEVKFHQELVSVEHAKALGSLADNDPFFTATSGEHSEFGVKAHSL 156
           IP RYI+VF +D S   ++ H+++V   H+ ++  LA++D F    S       +     
Sbjct: 67  IPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSS-----IAPDLQ 121

Query: 157 EGGIQDSFDIAGSLSGYVGYFTKEVIDFIRRSPLVEFVEEDSMVFSNSFNTQNSAPWGLA 216
            GGI  SFDI G   GY GYFT E+++ + + PL++F+E++S V  ++ + Q  APWGL 
Sbjct: 122 LGGIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGLH 181

Query: 217 RISHREKLNLGSFNKYLYDDDAGKGVTAYVVDTGVNVNHKDFDGRAVWGKTIPKDDPDVD 276
           RISHREK   G   +YLY+D AG+GVT+YV+DTG++  H+DF+GRAVWG  IP +D   D
Sbjct: 182 RISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEASD 241

Query: 277 GNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQ 336
            NGHGTHCAG IGS HYGVAKN  +VAVKVLRSNG GT+SDV+KG+EYVA  H ++  ++
Sbjct: 242 LNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRKK 301

Query: 337 KKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQDACNTSPAAAENAITV 396
            K FKGSTAN+SLG  KS A+++AV+AAV +GVHFA+AAGNEN+DAC +SPA A+ +ITV
Sbjct: 302 SKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSITV 361

Query: 397 GASTLSDERAYFSNWGKCVDIFGPGLNILSTYIGSDTATATLSGTSMATPHVVGLLTYFL 456
           GAST SD+RA+FSNWG CVD+F PG+NI+STYIGS  AT +LSGTSMA PHV G+L+YFL
Sbjct: 362 GASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSYFL 421

Query: 457 SLQPDADSEYFHAAGGITPSQLKKKLIDFSTKNVLSDLPEDTVNYLIYNGGGQDLDDLW 515
           SLQP  DSEYF  A  ++P +LK+K++ FST  VL D+ ++T N LIYNGGG+ LDDLW
Sbjct: 422 SLQPAPDSEYFDNA--LSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGKILDDLW 478

>Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003W
           (REAL)
          Length = 476

 Score =  497 bits (1279), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 240/426 (56%), Positives = 316/426 (74%), Gaps = 17/426 (3%)

Query: 94  ANKIPNRYIIVFKKDASADEVKFHQELVSVEHAKALGSLADNDPFFTATSGEHS-EFGVK 152
           A  +P RYII F +D+S   ++ H+ ++     +++  LA +D FF +TS     +FG  
Sbjct: 64  AESLPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVSTSAPSDLQFG-- 121

Query: 153 AHSLEGGIQDSFDIAGSLSGYVGYFTKEVIDFIRRSPLVEFVEEDSMVFSNSFNTQNSAP 212
                 GI   FDI G   GY GYFT+EVI  + + P+++F+E++S V   +   Q  AP
Sbjct: 122 ------GIDSFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAP 175

Query: 213 WGLARISHREKLNLGSFNKYLYDDDAGKGVTAYVVDTGVNVNHKDFDGRAVWGKTIPKDD 272
           WGL RISHREK   G   +YLY+D AG+GVT+YV+DTG+++NH+DF+GRAVWG  IP +D
Sbjct: 176 WGLHRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDND 235

Query: 273 PDVDGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKA 332
              D NGHGTHCAG IGS H+GV KN ++VAVKVLRSNG GT+SDV+KG+EYV + H   
Sbjct: 236 EASDLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDH--- 292

Query: 333 VEEQKKG---FKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQDACNTSPAA 389
           ++  KKG   FKGSTAN+SLG  KSPA+++AVNAAV++GVHFA+AAGNE++DAC +SPA 
Sbjct: 293 IDSSKKGGPKFKGSTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAG 352

Query: 390 AENAITVGASTLSDERAYFSNWGKCVDIFGPGLNILSTYIGSDTATATLSGTSMATPHVV 449
           AE +ITVGAST SD+RA+FS+WG CVD+F PG+NILSTYIGS  A+ +LSGTSMA PHV 
Sbjct: 353 AEKSITVGASTFSDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVA 412

Query: 450 GLLTYFLSLQPDADSEYFHAAGGITPSQLKKKLIDFSTKNVLSDLPEDTVNYLIYNGGGQ 509
           G+L+YFLSLQP +DSE+F +   ++P QLK+K+I+FST+ VL D+ EDT N LIYNGGG+
Sbjct: 413 GILSYFLSLQPSSDSEFFDST--VSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGR 470

Query: 510 DLDDLW 515
            LD+ W
Sbjct: 471 KLDNFW 476

>YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putative
           precursor to the subtilisin-like protease III
          Length = 478

 Score =  489 bits (1258), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 237/419 (56%), Positives = 314/419 (74%), Gaps = 7/419 (1%)

Query: 97  IPNRYIIVFKKDASADEVKFHQELVSVEHAKALGSLADNDPFFTATSGEHSEFGVKAHSL 156
           +P RY+IVF +D S  +++ H ++V  +H+ ++G L +ND F+   S       V + S 
Sbjct: 67  LPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVISSS-----VSSKSQ 121

Query: 157 EGGIQDSFDIAGSLSGYVGYFTKEVIDFIRRSPLVEFVEEDSMVFSNSFNTQNSAPWGLA 216
            GGI + FDI G   GY GYFT E+I  I + P+++FVE+++ V  ++ + Q  APWGL 
Sbjct: 122 FGGIDNFFDINGLFRGYTGYFTDEIIKIISQDPIIKFVEQETTVKISNSSLQEEAPWGLH 181

Query: 217 RISHREKLNLGSFNKYLYDDDAGKGVTAYVVDTGVNVNHKDFDGRAVWGKTIPKDDPDVD 276
           R+SHREK   G   +YLY+D AGKGVT+YV+DTG++  H+DF+GRA WG  IP +D   D
Sbjct: 182 RVSHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDEASD 241

Query: 277 GNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQ 336
            NGHGTHCAG IGS H+GVAKN  IVAVKVLRSNG GT+SDV+KG+EYV + H ++ +++
Sbjct: 242 LNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSKKK 301

Query: 337 KKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQDACNTSPAAAENAITV 396
            K FKGSTAN+SLG  KS A+++AVNAAV +GVHFA+AAGNE++DAC +SPA AE +ITV
Sbjct: 302 NKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEKSITV 361

Query: 397 GASTLSDERAYFSNWGKCVDIFGPGLNILSTYIGSDTATATLSGTSMATPHVVGLLTYFL 456
           GAST SD+RA+FSNWG CVD+F PG+NI+STYIGS  AT +LSGTSMA+PHV G+L+YFL
Sbjct: 362 GASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHVAGILSYFL 421

Query: 457 SLQPDADSEYFHAAGGITPSQLKKKLIDFSTKNVLSDLPEDTVNYLIYNGGGQDLDDLW 515
           SLQP  DSE+F+ A   +P +LK+K++ FST+ VL D+ +DT N LIYNGGG+ LD  W
Sbjct: 422 SLQPAPDSEFFNDAP--SPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKLDGFW 478

>Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003W
           (REAL)
          Length = 482

 Score =  486 bits (1252), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 231/419 (55%), Positives = 306/419 (73%), Gaps = 7/419 (1%)

Query: 97  IPNRYIIVFKKDASADEVKFHQELVSVEHAKALGSLADNDPFFTATSGEHSEFGVKAHSL 156
           +P RYIIVF +D +   ++ H +++      ++  + ++D F    S   S      +  
Sbjct: 69  LPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASAS-----PNPQ 123

Query: 157 EGGIQDSFDIAGSLSGYVGYFTKEVIDFIRRSPLVEFVEEDSMVFSNSFNTQNSAPWGLA 216
            GGI  SFDI G   GY GYFT EVI+ + + PLV+F+E +S V  ++ + Q  APWGL 
Sbjct: 124 FGGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLH 183

Query: 217 RISHREKLNLGSFNKYLYDDDAGKGVTAYVVDTGVNVNHKDFDGRAVWGKTIPKDDPDVD 276
           RISHRE+   G   +YLY+D AG GVT+YV+DTG++  H+DF+GRA WG  IP++D   D
Sbjct: 184 RISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASD 243

Query: 277 GNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQ 336
            NGHGTHCAG IGS H+GVAKN +I+AVKVLRSNG GT+SDV+KG+EYVA+ H  + +++
Sbjct: 244 LNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIASSKKR 303

Query: 337 KKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQDACNTSPAAAENAITV 396
              FKGSTAN+SLG  KSPA+++AVNAAV  GVHFA+AAGNE++DAC +SPA AE +ITV
Sbjct: 304 GSKFKGSTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITV 363

Query: 397 GASTLSDERAYFSNWGKCVDIFGPGLNILSTYIGSDTATATLSGTSMATPHVVGLLTYFL 456
           GAST SD+RA+FSNWG CVD+F PG+NI+STYIGS  AT +LSGTSMA PHV G+L+Y L
Sbjct: 364 GASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLL 423

Query: 457 SLQPDADSEYFHAAGGITPSQLKKKLIDFSTKNVLSDLPEDTVNYLIYNGGGQDLDDLW 515
           SLQP  DSE+F+    ++P QLK+K++ FST+ VL D+ E+T N L+YNGGG+ LD+ W
Sbjct: 424 SLQPAQDSEFFYDT--VSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 480

>CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} similar
           to uniprot|P25036 Saccharomyces cerevisiae YOR003w YSP3
           or uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
          Length = 485

 Score =  445 bits (1145), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 221/420 (52%), Positives = 297/420 (70%), Gaps = 9/420 (2%)

Query: 97  IPNRYIIVFKKDASADEVKFHQELVSVEHAKALGSLADNDPFFTATSGEHSEFGVKAHSL 156
           IPNRYI++FK   +  E++ H  L ++E   +      +  F  AT  ++++   +    
Sbjct: 74  IPNRYIVLFKDFVTDKEIQSH--LSAIEEINSSSIFLQDSDFGKAT--QYNDISTRGI-- 127

Query: 157 EGGIQDSFDIAGSLSGYVGYFTKEVIDFIRRSPLVEFVEEDSMVFSNSFNTQNSAPWGLA 216
             G+Q  F I  S++GY+GYFT+    FI  SPLVE VE DS+V  N++  Q   PWGL 
Sbjct: 128 --GLQHEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPWGLG 185

Query: 217 RISHREKLNLGSFNKYLYDDDAGKGVTAYVVDTGVNVNHKDFDGRAVWGKTIPKDDPDVD 276
           RIS REKL +     Y YDD  GK    +V+DTG+ V+H+DF+GRA WGKTI ++D D D
Sbjct: 186 RISQREKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVENDNDYD 245

Query: 277 GNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQ 336
            NGHGTHCAGTI S HYG+AK A+++AVKVLRS+GSG+MSDV++GVEY  EA+   +++ 
Sbjct: 246 LNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAYND-LKKT 304

Query: 337 KKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQDACNTSPAAAENAITV 396
           K   KG+  NMSLG  KS AL+ A++AA  AG+ FAVAAGNE+ DACN+SPA+A + ITV
Sbjct: 305 KSNLKGAAGNMSLGAWKSYALNRAMDAAAAAGISFAVAAGNESDDACNSSPASAWSPITV 364

Query: 397 GASTLSDERAYFSNWGKCVDIFGPGLNILSTYIGSDTATATLSGTSMATPHVVGLLTYFL 456
           G STLSD+ A+FSN+G+CVDIF PG+NI+STYIGS  AT +LSGTSM++PHV G+L Y+L
Sbjct: 365 GGSTLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGVLAYYL 424

Query: 457 SLQPDADSEYFHAAGGITPSQLKKKLIDFSTKNVLSDLPEDTVNYLIYNGGGQDLDDLWG 516
           SLQPD  S+++H    I+P  LKKK+++++T   LS LP +TVN L+YNGGG++L   WG
Sbjct: 425 SLQPDHKSQFYHEHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGKNLSKFWG 484

>KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6.14
           YOR003W
          Length = 456

 Score =  407 bits (1047), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 217/429 (50%), Positives = 280/429 (65%), Gaps = 29/429 (6%)

Query: 91  NDIANKIPNRYIIVFKKDASADEVKFHQELVSVEHAKALGSLADNDPFFTATSGEHSEFG 150
           NDI   I ++YI++FK  A   E    +EL    H K L +      F    S E  E  
Sbjct: 57  NDI---IKDQYIVIFKNSAMMAE----KEL----HFKQLKN------FIKTYSYEWDEKD 99

Query: 151 VKAHSLEGGIQDSFDIAGSLSGYVGYFTKEVIDFIRRSPLVEFVEEDSMVFSNSFNTQNS 210
               +L     + F I  +LSGY+     E +  +R+ P+V+ +E DS V +     Q  
Sbjct: 100 DHKSNL-----NIFKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQED 154

Query: 211 APWGLARISHREKLNLGSFNKYLYDDDAGKGVTAYVVDTGVNVNHKDFDGRAVWGKTIPK 270
            PWGL+RIS R ++ +G    Y YDD     VTAYV+DTG+ ++H+ F+GRA WGKTI  
Sbjct: 155 TPWGLSRISQRPRVRIGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVP 214

Query: 271 DDPDVDGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHK 330
           +D D D +GHGTH AG I S  +GVAK  ++VAVKVLRSNG G MSDV+KG+E+V + H 
Sbjct: 215 NDVDEDNSGHGTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHS 274

Query: 331 KAVEEQKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQDACNTSPAAA 390
           K     K   KGS  N+SLG  KSPAL LA++AA+   +HFAVAAGNEN DAC TSPA A
Sbjct: 275 K----NKNYSKGSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADA 330

Query: 391 ENAITVGASTLSDERAYFSNWGKCVDIFGPGLNILSTYIGSDTATATLSGTSMATPHVVG 450
             AITVGAS  SDERA+FSNWG+CVD+F PG+N++STYIGSD AT +LSGTS A P+  G
Sbjct: 331 RRAITVGASIFSDERAFFSNWGECVDVFAPGMNVMSTYIGSDNATLSLSGTSAAAPYTAG 390

Query: 451 LLTYFLSLQPDADSEYFHAAGGITPSQLKKKLIDFSTKNVLSDLPEDTVNYLIYNGGGQD 510
           L+ Y+LSLQPD DS YF   G +TPS+LK+K++ F +K+VL +LPE+T N +IYNG G++
Sbjct: 391 LIAYYLSLQPDKDSGYF--TGEMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRN 448

Query: 511 LDDLWGKDY 519
           L   W KDY
Sbjct: 449 LSHFW-KDY 456

>NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14
          Length = 451

 Score =  399 bits (1024), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 205/436 (47%), Positives = 276/436 (63%), Gaps = 32/436 (7%)

Query: 85  APLSTVNDIANKIPNRYIIVFKKDASADEVKFHQELVSVEHAKALGS-LADNDPFFTATS 143
           +P + ++  A+ IPN+YI++FK D +        ++    H   L S L + DP +T   
Sbjct: 41  SPSNIIHHAASPIPNQYIVLFKSDTT--------DIQRETHLATLNSWLLNTDPQYT--- 89

Query: 144 GEHSEFGVKAHSLEGGIQDSFDIAGSLSGYVGYFTKEVIDFIRRSPLVEFVEEDSMVFSN 203
                           I  SF +A  L GY     +++I  +   P+++ +E+DS V + 
Sbjct: 90  ----------------ILHSFQLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHAL 133

Query: 204 SFNTQNSAPWGLARISHREKLNLGSFNKYLYDDD-AGKGVTAYVVDTGVNVNHKDFDGRA 262
               Q  +PWGLARIS RE+L L     Y YDD  A      Y++DTG+N NH +F GRA
Sbjct: 134 GRQKQIDSPWGLARISQRERLKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRA 193

Query: 263 VWGKTIPKDDPDV-DGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKG 321
            WG      +P+  D NGHGTHCAG IGS  YGVAKN  ++AVKVL + G G MS V++G
Sbjct: 194 KWGAVFTPMEPNQEDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRG 253

Query: 322 VEYVAEAHKKAVEEQ-KKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQ 380
           +EYV + H++ +++Q + GFKGS  N+SLG GKSPAL   + AAVK GVHFAVAAGNE+ 
Sbjct: 254 IEYVTQQHEQDMKKQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDD 313

Query: 381 DACNTSPAAAENAITVGASTLSDERAYFSNWGKCVDIFGPGLNILSTYIGS-DTATATLS 439
           DAC+TSPA + +A+TVGAS+ SD+R +FSNWG CVD+F PG+NI+STYIG  +  T +LS
Sbjct: 314 DACSTSPADSPHALTVGASSFSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLS 373

Query: 440 GTSMATPHVVGLLTYFLSLQPDADSEYFHAAGGITPSQLKKKLIDFSTKNVLSDLPEDTV 499
           GTSM+ P V GL+ YFLSLQPD  S+++      TP QLK K+I FST+ VL ++PE T 
Sbjct: 374 GTSMSAPFVTGLIAYFLSLQPDTKSQFYTGITSPTPYQLKYKIISFSTEGVLHEIPEGTP 433

Query: 500 NYLIYNGGGQDLDDLW 515
           N ++YNGGG  L D W
Sbjct: 434 NRIVYNGGGHSLKDFW 449

>NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {ON} 
          Length = 482

 Score =  352 bits (904), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 214/526 (40%), Positives = 303/526 (57%), Gaps = 62/526 (11%)

Query: 1   MKFENTLLTITALSTVATALVIPEVNRENKHGDKSVAIKDHASSDLDKPQHHANGKARSK 60
           M    TLL ++  +   T+L+IPE+                         H  N  A   
Sbjct: 1   MTLGGTLLILSWFARSITSLIIPEI------------------------IHSGNNDA--- 33

Query: 61  SRGRCADSKKFDKLRPVDDASAILAPLSTVNDIANKIPNRYIIVFKKDASADEV-KFHQE 119
           S  +  +    DK       + I   + T     N IP++YI++F+ D +  ++ +F Q 
Sbjct: 34  SHAKLNERDTLDK-------NQIPFIIPTHGPQKNFIPDQYIVLFENDTTDLQISRFEQF 86

Query: 120 LVS-VEHAKALGSLADNDPFFTATSGEHSEFGVKAHSLEGGIQDSFDIAGSLSGYVGYFT 178
           L S +E      ++ DN       S   S F + ++  +G I     I   +  ++    
Sbjct: 87  LSSLIEEDNQKYNVNDN------YSKVLSRFQI-SNDTKGMI-----IRAPIDDFLEDVK 134

Query: 179 KEVIDFIRRSPLVEFVEEDSMVFSNSFNTQNSAPWGLARISHREKLNLGSFNKYLYDDD- 237
             + ++ +   +++ +E DS V  N F TQ  + WGL+RIS R  L L     Y YDD+ 
Sbjct: 135 NNIFNYQK---IIKIIERDSYVHMNKFTTQIDSSWGLSRISQRNHLKLLQDQFYFYDDNG 191

Query: 238 AGKGVTAYVVDTGVNVNHKDFDGRAVWGKTIPKDDPDV-DGNGHGTHCAGTIGSVHYGVA 296
           +GKGV  Y++DTG+N NH +F+GRA WG ++P  +P + D NGHGTHCAG IGS  YGVA
Sbjct: 192 SGKGVDCYILDTGINSNHIEFEGRASWGVSLPVTEPSLEDSNGHGTHCAGIIGSKTYGVA 251

Query: 297 KNADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQKKG------FKGSTANMSLG 350
           K  +++AVKVL   G G+MSDV+ G+E+VA +H                FKGS  N+SLG
Sbjct: 252 KETNLIAVKVLDFKGDGSMSDVILGLEFVANSHTNKTNNISSSSSVHSEFKGSVVNLSLG 311

Query: 351 GGKSPALDLAVNAAVKAGVHFAVAAGNENQDACNTSPAAAENAITVGASTLSDERAYFSN 410
             KSP+LD+A+ +A K G+H  VAAGNE++DAC TSPA +   ITVGAS+ SD+RA+FSN
Sbjct: 312 APKSPSLDIALESAKKIGIHITVAAGNEDEDACMTSPADSPAVITVGASSFSDDRAFFSN 371

Query: 411 WGKCVDIFGPGLNILSTYIG-SDTATATLSGTSMATPHVVGLLTYFLSLQPDADSEYFHA 469
           WG CVD+F PG+NI STYIG ++  T +LSG+SM++P V GL  Y+LSLQPD  S++  +
Sbjct: 372 WGPCVDVFAPGINIKSTYIGPNNNETLSLSGSSMSSPFVSGLTAYYLSLQPDVSSQFHDS 431

Query: 470 AGGITPSQLKKKLIDFSTKNVLSDLPEDTVNYLIYNGGGQDLDDLW 515
              +TP QLK+K+IDFST  +L +LP DT N L+YNGGG+DL   W
Sbjct: 432 L--MTPDQLKRKIIDFSTNGMLKELPLDTANKLVYNGGGKDLSGFW 475

>KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON} 
          Length = 420

 Score =  342 bits (878), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 168/351 (47%), Positives = 235/351 (66%), Gaps = 8/351 (2%)

Query: 162 DSFDIAGSLSGY-VGYFTKEVIDFIRRSPLVEFVEEDSMVFSNSFNTQNSAPWGLARISH 220
           + F IA  L G+ V  F    + F+ + P VE VE +S V++ +   Q   PWGL R+S 
Sbjct: 75  EQFHIADELIGFTVKNFPFHNVYFLLQIPFVEMVETNSKVYALNVTVQEDVPWGLMRLSQ 134

Query: 221 REKLNLGSFNKYLYDDD-AGKGVTAYVVDTGVNVNHKDFDGRAVWGKTIPKDDPDVDGNG 279
           R+++ +G    Y YD   + K V  Y++DTG+ V+H++F+GRA WGKTI  +DPD D NG
Sbjct: 135 RDRVRIGDEQVYRYDTRGSAKDVNVYILDTGIQVDHEEFEGRARWGKTIAWNDPDRDDNG 194

Query: 280 HGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQKKG 339
           HGTHCAG +G   YGVAK A+++AVKVL + G G MSDV++G+E+    H   +   +  
Sbjct: 195 HGTHCAGIVGGATYGVAKEANLIAVKVLHATGDGEMSDVIRGIEFAVNEH---LTRNQDE 251

Query: 340 FKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQDACNTSPAAAENAITVGAS 399
            +GS  N+SLG G+SPAL   V AA+  GVHFAVAAGNE+ +AC +SPA  +  +TVG S
Sbjct: 252 VRGSIINLSLGAGESPALQRVVTAALNKGVHFAVAAGNEDDNACYSSPANIDGVVTVGGS 311

Query: 400 TLSDERAYFSNWGKCVDIFGPGLNILSTYIG-SDTATATLSGTSMATPHVVGLLTYFLSL 458
           T SD+RA+FSNWG C+D+F PG+N+ S+Y+G +   T +LSGTS + PHV GL+ Y LSL
Sbjct: 312 TFSDDRAFFSNWGPCIDVFAPGVNVKSSYVGAAKNKTLSLSGTSTSAPHVAGLMAYLLSL 371

Query: 459 QPDADSEYFHAAGGITPSQLKKKLIDFSTKNVLSDLPEDTVNYLIYNGGGQ 509
           +PD  S+ FH A    P+QLK+KL+  +T+  L ++P+DT N +I+NG  Q
Sbjct: 372 EPDTKSQ-FHTAWS-NPAQLKQKLVSLATEGKLFEVPDDTANLMIFNGVKQ 420

>CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} some
           similarities with uniprot|P09232 Saccharomyces
           cerevisiae YEL060c or uniprot|P25036 Saccharomyces
           cerevisiae YOR003w YSP3
          Length = 579

 Score =  322 bits (825), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 185/520 (35%), Positives = 289/520 (55%), Gaps = 44/520 (8%)

Query: 1   MKFENTLLTITALSTVATALVIPEVNRENKHGDKSVAIKDHASSDLDKPQHHANGKARSK 60
           M+  N +  +  + +++ A+V+P++N   +  +                Q + N   +SK
Sbjct: 1   MRLSNIITLVIGIISLSNAIVLPDINTLEQTSES---------------QEYDNFFKQSK 45

Query: 61  SRGRCADSKKFDKLRPVDDASAILAPLSTVNDIANKI-PNRYIIVFKKDASADEVKFHQE 119
                         RP +  + ++APL   ++I N I P RYI++FK  A  +E+K H +
Sbjct: 46  --------------RPGNVKAPLVAPLGENDEIQNNIVPYRYIVMFKNFAYTNEIKLHIQ 91

Query: 120 LVSVEHAKALGSLADNDPFFTATSGEHSEFGVKAHSLEGGIQDSFDIAGSLSGYVGYFTK 179
            V+    +   SLA NDPFF  T     EF  +     GG+  +FDI    +GYVGYFT 
Sbjct: 92  TVAKLQLRGSISLAPNDPFFHHT--RDKEFSTEEL---GGVLYTFDIGSGFNGYVGYFTD 146

Query: 180 EVIDFIRRSPLVEFVEEDSMVFSNSFNTQNSAPWGLARISHREKLNLGSFNKYLYDDDAG 239
           EV++FIR+  +V++VE DS++  +   T +++ W LARISHR KL L +FN+Y +D + G
Sbjct: 147 EVVEFIRKQSIVDYVEMDSILTIDDKETDSNSHWHLARISHRPKLGLSNFNEYKFDPNGG 206

Query: 240 KGVTAYVVDTGVNVNHKDFDGRAVWGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAKNA 299
           + + AY++DTGV   H  +  R + G  I  ++ + D NGHGT  AG +G    GVA+ A
Sbjct: 207 QNIDAYILDTGVYQTHAYYIERTIRGIVITPNEDERDMNGHGTEMAGLVGGREVGVARKA 266

Query: 300 DIVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQKKGFKGSTANMSLGGGKSPALDL 359
            ++ VKVL   G GT+S+++KG+ +V   H + +E  K G  G+    S+ G KS +L+ 
Sbjct: 267 TLIDVKVLNWQGRGTVSNIIKGLSFVNHHHPQRIE--KNGVLGAVVLFSISGAKSRSLNT 324

Query: 360 AVNAAVKAGVHFAVAAGNENQDACNTSPAAAENAITVGASTLSDERAYFSNWGKCVDIFG 419
           A +  V +G+H  V AG +  +ACN+SPA++   ITV   +++DE     NWG CVDI+G
Sbjct: 325 AFDKMVSSGIHVVVGAGTKGINACNSSPASSSKPITVAGMSITDEPIDRGNWGSCVDIYG 384

Query: 420 PGLNILSTYIGSD----TATATLSGTSMATPHVVGLLTYFLSLQPDADSEYFHAAGGITP 475
           PG  + +TY   +    T   +++G+S A   V GLL YF SLQP   +        +TP
Sbjct: 385 PGDRVRTTYPNLERNQFTNEISVTGSSAAAAQVAGLLAYFASLQPGLGTP---DVIPLTP 441

Query: 476 SQLKKKLIDFSTKNVLSDLPEDTVNYLIYNGGGQDLDDLW 515
            +LK++LIDF TK  L++L   + N + +NG G +LD  +
Sbjct: 442 EELKERLIDFGTKGKLTNLERMSPNIIAFNGAGGNLDSFF 481

>Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON}
           YCR045C (REAL)
          Length = 491

 Score =  205 bits (522), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 147/403 (36%), Positives = 205/403 (50%), Gaps = 62/403 (15%)

Query: 156 LEGGIQDSFDIAGSLSGYVGYFTKEVIDFIRRSPLV---------EFVEEDS---MVFSN 203
           ++  I+  F I GS  G     +K +++ +++SPLV         E  E DS   + ++ 
Sbjct: 45  IDNKIEKKFSI-GSFRGVTMNLSKNLVNKLKKSPLVADIVPNFRFEAFENDSARDVEYNY 103

Query: 204 SFNT-----------------QNSAPWGLARISHREKLNL---------GSFNKYLYDDD 237
           +FN                  Q+ AP  LARIS   +L             FN Y  DD 
Sbjct: 104 TFNATAKYSYENLDEEQNITYQSDAPRHLARISRHYQLPFDIEDKERYKSWFNYYYEDDY 163

Query: 238 AGKGVTAYVVDTGVNVNHKDFDGRAVWGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAK 297
            G+ V AY++DTG+  +H +F+ R + G  + K+    D NGHGTH AG +GS  YG AK
Sbjct: 164 QGQDVNAYIMDTGIFADHPEFEDRVIQGIDLTKEGFG-DQNGHGTHVAGLVGSKTYGAAK 222

Query: 298 NADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQKKGFKGSTANMSLGGGKSPAL 357
             ++V VKVL  +GSG  S+V+ G+E++ E   +    Q    K   AN+SLG  +SP +
Sbjct: 223 KVNLVEVKVLGKDGSGEASNVLSGLEFIVEHCTRVSRPQG---KKCVANLSLGSFRSPII 279

Query: 358 DLAVNAAVKAGVHFAVAAGNENQDACNTSPAAAENAITVGA-STLSDERAYFSNWGKCVD 416
           ++AV  A++ G+ F  AAGN N DA   SPA+AEN ITVGA     D  A FSNWG CV+
Sbjct: 280 NMAVEGAIEEGIVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVN 339

Query: 417 IFGPGLNILSTYIGSDTATATLSGTSMATPHVVGLLTYFLSLQPDADSEYFHAAGGITPS 476
           IF PG+ I S    +   T  LSGTSM+TP V G+    LS              GI P 
Sbjct: 340 IFAPGVEIESLSHLNFNDTLVLSGTSMSTPIVTGVAAVLLS-------------KGIEPE 386

Query: 477 QLKKKLIDFSTKNVLSD----LPEDTVNYLIYNGGGQDLDDLW 515
            + ++L   ST+NV           T N ++YNG  + LDD +
Sbjct: 387 MIAQELEYLSTRNVFHRRTLFFKPSTPNQILYNGVDK-LDDRY 428

>Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}
           YCR045C (REAL)
          Length = 527

 Score =  205 bits (522), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 145/394 (36%), Positives = 201/394 (51%), Gaps = 60/394 (15%)

Query: 160 IQDSFDIAGSLSGYVGYFTKEVIDFIRRSPLV---------EFVEEDSMVFSNSFNT--- 207
           I+  F I GS  G     +K +++ +++SPL+         E  + D+ + S  FNT   
Sbjct: 89  IEKKFSI-GSFRGVTMNLSKNLVNKLKKSPLIADIVPNFKFEAFDTDAEL-SYMFNTTAK 146

Query: 208 --------------QNSAPWGLARISHREKLNL---------GSFNKYLYDDDAGKGVTA 244
                         Q  AP  LARIS   +L             FN Y  D+  G+GV A
Sbjct: 147 YAYQDIDEAQNVTYQPDAPRHLARISRHHQLPFDLEDKDRYKSWFNYYYEDEYQGQGVNA 206

Query: 245 YVVDTGVNVNHKDFDGRAVWGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAKNADIVAV 304
           Y++DTG++  H +F+ R + G  + K+    D NGHGTH AG +GS  +G AK   +V V
Sbjct: 207 YIMDTGIHAEHPEFEDRVIQGVDLTKEGFG-DENGHGTHVAGLVGSRTFGAAKKVSLVEV 265

Query: 305 KVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQKKGFKGSTANMSLGGGKSPALDLAVNAA 364
           KVL  +GSG  S+V+ G+E++ E   K    Q    K   AN+SLG  +SP +++AV  A
Sbjct: 266 KVLGKDGSGEASNVLSGLEFIVEHCTKVSRPQG---KKCVANLSLGSFRSPIINMAVEGA 322

Query: 365 VKAGVHFAVAAGNENQDACNTSPAAAENAITVGA-STLSDERAYFSNWGKCVDIFGPGLN 423
           ++ G+ F  AAGN N DA   SPA+AEN ITVGA     D  A FSNWG CV+IF PG+ 
Sbjct: 323 IEEGIVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVE 382

Query: 424 ILSTYIGSDTATATLSGTSMATPHVVGLLTYFLSLQPDADSEYFHAAGGITPSQLKKKLI 483
           I S    +D  +  LSGTSM+TP V G+    LS              GI P  + +++ 
Sbjct: 383 IESLSHLNDNESLVLSGTSMSTPIVTGVAAVLLS-------------KGIEPELIAQEIE 429

Query: 484 DFSTKNVLSD----LPEDTVNYLIYNGGGQDLDD 513
             ST+NV           T N ++YNG  + LDD
Sbjct: 430 YLSTRNVFHRRTLFFKPSTPNQILYNGVDK-LDD 462

>CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa]
           {ON} similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045c
          Length = 517

 Score =  204 bits (520), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 137/382 (35%), Positives = 188/382 (49%), Gaps = 64/382 (16%)

Query: 200 VFSNSFNTQNSAPWGLARISHREKLNL---------GSFNKYLYDDDAGKGVTAYVVDTG 250
           + S    TQ+ AP  LAR+S R +L             FN Y Y    G+ V AYV+D+G
Sbjct: 152 LLSRYIKTQSEAPRHLARLSRRSQLPYDFNDPTRYESDFNYYYYGWHQGRSVNAYVLDSG 211

Query: 251 VNVNHKDFDGRAVWGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSN 310
           V ++H DF+GRA +G    +     D NGHGTH AG IGS  YGV+K  +I+ VKVL S 
Sbjct: 212 VMIDHCDFEGRAYYGADFIRSGNSGDQNGHGTHVAGLIGSKTYGVSKKVNIIDVKVLDSV 271

Query: 311 GSGTMSDVVKGVEYVA-----------------------EAHKKAVEEQKKGFKGSTANM 347
           GSGT+  V+ G+E+V+                       ++H   VE ++        N+
Sbjct: 272 GSGTLDTVMSGLEFVSNHCNYKGKQGKQGKQGKPVWGSEDSHDDDVESKR-----CVINL 326

Query: 348 SLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQDACNTSPAAAENAITVGA-STLSDERA 406
           SLG  +S  ++ A+   +K G+   VAAGN N +AC TSPA+  + ITVGA     D  A
Sbjct: 327 SLGTFRSTIINEAIEELIKQGIVVVVAAGNSNMNACWTSPASVADVITVGAFDDRIDSIA 386

Query: 407 YFSNWGKCVDIFGPGLNILSTYIGSDTATATLSGTSMATPHVVGLLTYFLSLQPDADSEY 466
            FSNWG CVDIF PG+ + S            +GTSMATP V GL+   L          
Sbjct: 387 KFSNWGNCVDIFAPGVLVKSLSNKFPYYPIEQTGTSMATPIVTGLVALLLD--------- 437

Query: 467 FHAAGGITPSQLKKKLIDFSTKNVLSD----LPEDTVNYLIYNGGGQDLDDLWGKDYSIG 522
                GI P+Q+KK+L + +T N+           T N + +NG  +D DD     Y   
Sbjct: 438 ----SGIKPTQIKKRLNELATDNIFPRRTLLFKPGTPNRIAFNGVKRDDDDYHHYSY--- 490

Query: 523 KEPSANPEFSLESLINSLDSKT 544
                 P  ++E ++  LDS T
Sbjct: 491 ------PNITIEHILKELDSYT 506

>TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa]
           {ON} Anc_6.313 YCR045C
          Length = 436

 Score =  202 bits (514), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 125/302 (41%), Positives = 170/302 (56%), Gaps = 31/302 (10%)

Query: 179 KEVIDFIRRSPLV-------EFVEEDSMVFSN-SFNT-----QNSAPWGLARISHREKLN 225
           ++++D IRRSPLV       +FV  D   F   +FN+     Q  AP  L+R+S R +L 
Sbjct: 72  RDLVDRIRRSPLVAEVVPNIQFVAYDEHDFEGWNFNSRFIRRQRGAPRHLSRLSRRSQLP 131

Query: 226 L----------GSFNKYLYDDDAGKGVTAYVVDTGVNVNHKDFDGRAVWGKTIPKDDPDV 275
                      GSFN Y  +   G G+ AY++DTG+   H +F GRAV+G+ +  + P  
Sbjct: 132 YDFEEEDDNYEGSFNYYYDNKHRGDGINAYIIDTGIYKEHAEFGGRAVFGEDLTGEGPG- 190

Query: 276 DGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEE 335
           DGNGHGTH AG +GS  YGVAK+  +V VK L + G G ++ V+  +E+ A  H ++ E 
Sbjct: 191 DGNGHGTHVAGIVGSSKYGVAKDITLVEVKALTAKGQGNLTTVISAMEF-AVNHCRSSEG 249

Query: 336 QKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQDACNTSPAAAENAIT 395
                KG   N+SLG  ++  ++ AV AA +AG+   VAAGN N +AC  SPA+A  AIT
Sbjct: 250 -----KGCVINLSLGAIRNSVINQAVKAAHEAGIVVVVAAGNSNINACLNSPASAPEAIT 304

Query: 396 VGA-STLSDERAYFSNWGKCVDIFGPGLNILSTYIGSDTATATLSGTSMATPHVVGLLTY 454
           VGA    +D  A FSNWG CVDIF PG+ + S            SGTSMA+P + GL   
Sbjct: 305 VGAFDDRTDSIAKFSNWGSCVDIFAPGVRVKSLASAPHLKPILFSGTSMASPSITGLAAI 364

Query: 455 FL 456
            L
Sbjct: 365 LL 366

>SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 479

 Score =  202 bits (515), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 139/399 (34%), Positives = 201/399 (50%), Gaps = 54/399 (13%)

Query: 168 GSLSGYVGYFTKEVIDFIRRSPLVEFVEEDSMV------------FSNSFNTQNSAPWGL 215
           G   G+   F K+ ++ ++++PLV  V  +S+             +S  +  Q  AP  L
Sbjct: 59  GKFEGFTADFPKDFVEKLKKNPLVADVVPNSVFNVFDQKEQIAEEYSRRYKVQEDAPRHL 118

Query: 216 ARISHREKLNLGS-------FNKYLYDDDAGKGVTAYVVDTGVNVNHKDFDGRAVWGKTI 268
           AR+S R  L           FN Y      G  V AY++DTG+   HKD  GRA +G  +
Sbjct: 119 ARLSRRGPLPYSEEDGWYQEFNYYYDRKHRGDSVNAYIIDTGIYKQHKDLGGRAYFGADM 178

Query: 269 PKDDPDVDGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVAEA 328
             + P  D NGHGTH AG +GS  +GVAK  ++V VK L + G G ++ V+  +E+    
Sbjct: 179 VGEGPG-DYNGHGTHVAGIVGSRTFGVAKKVNLVEVKALNAKGQGNLTSVISSIEF---- 233

Query: 329 HKKAVEEQKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQDACNTSPA 388
              +V   KK      AN+SLG  ++  L+ AV AAV++G+   VAAGN N +AC  SPA
Sbjct: 234 ---SVNHCKKSGMLCVANLSLGSLRNTVLNQAVEAAVESGLVVVVAAGNSNVNACWNSPA 290

Query: 389 AAENAITVGA-STLSDERAYFSNWGKCVDIFGPGLNILSTYIGSDTATATLSGTSMATPH 447
           +A +AITVGA    +D  A FSNWG CVD+F  G+ ++S            SGTSMA+P 
Sbjct: 291 SAISAITVGAFDDRTDTIAKFSNWGMCVDVFASGVKVMSLSNMPPFKPVAYSGTSMASPS 350

Query: 448 VVGLLTYFLSLQPDADSEYFHAAGGITPSQLKKKLIDFSTKNVLSD----LPEDTVNYLI 503
           V GL    L      DS       GI P  +K+K+ID +T+NV           T N + 
Sbjct: 351 VAGLAAVLL------DS-------GIDPPDIKQKIIDLATENVFQKRTLVFKPGTPNRIA 397

Query: 504 YNGGGQDLDDLWGKDYSIGKEPSANPEFSLESLINSLDS 542
           +NG  ++ DD++        E +  P   +  L+  L++
Sbjct: 398 FNGVRKE-DDIF--------EEAVYPVVDINELVKELEN 427

>ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 490

 Score =  202 bits (515), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 142/416 (34%), Positives = 206/416 (49%), Gaps = 70/416 (16%)

Query: 168 GSLSGYVGYFTKEVIDFIRRSPLV-------EF--------VEE-------DSMVFSNSF 205
           GS  G     +++V++ IR +PLV       +F        V+E       D++   + F
Sbjct: 59  GSFRGITVDISQDVVEKIRNNPLVADLVPNIQFKAFDDVLGVQELQQNYHGDNLDDEDGF 118

Query: 206 N-----TQNSAPWGLARISHREKLNLG---------SFNKYLYDDDAGKGVTAYVVDTGV 251
           N      Q  AP  LAR+S R  L            SFN Y Y    G+ + AY++DTG+
Sbjct: 119 NPFKVKVQGEAPRHLARLSRRAPLPYEFDDELRYEESFNYYYYKWHKGRNINAYIIDTGI 178

Query: 252 NVNHKDFDGRAVWGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNG 311
              HKDF GRA++G+    + P  D NGHGTH AG +GS ++GVAK  +++ VK L + G
Sbjct: 179 YKEHKDFCGRAIFGRDFTGEGPG-DRNGHGTHVAGIVGSSNFGVAKKVNLIEVKALNNRG 237

Query: 312 SGTMSDVVKGVEYVAEAHKKAVEEQKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHF 371
            G ++ V+  VE+     K +      G KG  AN+SLG  ++  ++ A+ AA +AG+  
Sbjct: 238 QGNLTTVISAVEFAVNHCKSS------GKKGCVANLSLGAVRNSVINQAIKAAHEAGLII 291

Query: 372 AVAAGNENQDACNTSPAAAENAITVGA-STLSDERAYFSNWGKCVDIFGPGLNILSTYIG 430
            VAAGN N +AC  SPA+A  AITVGA    +D  A FSNWG CVDIF  G+ + S    
Sbjct: 292 VVAAGNSNINACWNSPASAPEAITVGAFDDRTDTIAKFSNWGPCVDIFASGVKVKSLSAF 351

Query: 431 SDTATATLSGTSMATPHVVGLLTYFLSLQPDADSEYFHAAGGITPSQLKKKLIDFSTKNV 490
                   SGTSMA+P V GL+   L               G+ P  +K KL++ +T ++
Sbjct: 352 PPHKPIAFSGTSMASPSVTGLVAILLD-------------KGVEPENIKAKLVELATHDL 398

Query: 491 LSD----LPEDTVNYLIYNGGGQDLDDLWGKDYSIGKEPSANPEFSLESLINSLDS 542
           L          T N + +NG  ++ D+          + +  P   LESL+  L +
Sbjct: 399 LQRRTLFFKPGTPNRIAFNGMEREDDEY---------DDAVYPIVDLESLVQELQN 445

>Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON}
           (138312..139868) [1557 nt, 519 aa]
          Length = 518

 Score =  202 bits (515), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 131/317 (41%), Positives = 171/317 (53%), Gaps = 33/317 (10%)

Query: 206 NTQNSAPWGLARISHREKL--------NLGSFNKYLYDDD-AGKGVTAYVVDTGVNVNHK 256
           N Q  AP  L RIS R +L            F  Y Y+D   G  + AY++DTG+   H 
Sbjct: 152 NVQYGAPRHLGRISSRGQLPFDIRNENEFKEFIHYYYEDQFKGSNIAAYILDTGIYAEHP 211

Query: 257 DFDGRAVWGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMS 316
           DF+ R + G  +  + P  D NGHGTH AG +GS  +GVAKN  +V VKVL   GSG ++
Sbjct: 212 DFENRVIVGADMTGEGPG-DSNGHGTHVAGILGSKTFGVAKNVTLVEVKVLTGRGSGNLT 270

Query: 317 DVVKGVEYVAEAHKKAVEEQKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAG 376
            V+ G+++  +  +   E Q    K   ANMSLG  ++  ++ A++ A KAG+   VAAG
Sbjct: 271 TVLSGIQFAVDHCRLMRETQG---KQCVANMSLGTVRNNIINAAIHEAFKAGLIMVVAAG 327

Query: 377 NENQDACNTSPAAAENAITVGA-STLSDERAYFSNWGKCVDIFGPGLNI--LSTYIGSDT 433
           N N  AC TSPA+A+NAITVGA    ++  AYFSNWG CVDIF PG+ I  LS    S  
Sbjct: 328 NSNVSACWTSPASAKNAITVGAFDDRTETIAYFSNWGACVDIFAPGVKIRSLSNSPESHH 387

Query: 434 ATATLSGTSMATPHVVGLLTYFLSLQPDADSEYFHAAGGITPSQLKKKLIDFSTKNVLSD 493
              T SGTSMA+P V GL    L               G+ P  +K KL+  STK+V + 
Sbjct: 388 KHVTHSGTSMASPVVAGLAAILLD-------------KGVEPFDVKDKLLHLSTKDVFNK 434

Query: 494 L----PEDTVNYLIYNG 506
           L       T N + YNG
Sbjct: 435 LTLFFKYGTPNKIAYNG 451

>YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}
           RRT12Probable subtilisin-family protease with a role in
           formation of the dityrosine layer of spore walls;
           localizes to the spore wall and also the nuclear
           envelope and ER region in mature spores
          Length = 491

 Score =  199 bits (507), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 147/401 (36%), Positives = 201/401 (50%), Gaps = 62/401 (15%)

Query: 156 LEGGIQDSFDIAGSLSGYVGYFTKEVIDFIRRSPLV---------EFVEEDSMVFSNS-- 204
           ++  I+  F I GS  G     +K +++ +++SPLV         E  E DS+  + S  
Sbjct: 45  IDNKIEKKFSI-GSFRGVTMNLSKNLVNKLKKSPLVADIVPNFRFEAFEGDSVNSAESSY 103

Query: 205 -FNT-----------------QNSAPWGLARISHREKLNL---------GSFNKYLYDDD 237
            FN                  Q  AP  LARIS   +L             FN Y   D 
Sbjct: 104 TFNATAKYSYEDVEEEQNITYQPDAPRHLARISRHYQLPFDVGDKDRYKSWFNYYYEHDY 163

Query: 238 AGKGVTAYVVDTGVNVNHKDFDGRAVWGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAK 297
            G+ V AY++DTG+  +H +F+ R + G  + K+    D NGHGTH AG +GS  YG AK
Sbjct: 164 QGQDVNAYIMDTGIFADHPEFEDRVIQGIDLTKEGFG-DQNGHGTHVAGLVGSKTYGAAK 222

Query: 298 NADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQKKGFKGSTANMSLGGGKSPAL 357
             ++V VKVL  +GSG  S+V+ G+E++ E   K    Q    K   AN+SLG  +SP +
Sbjct: 223 RVNLVEVKVLGKDGSGEASNVLSGLEFIVEHCTKVSRPQG---KKCVANLSLGSFRSPII 279

Query: 358 DLAVNAAVKAGVHFAVAAGNENQDACNTSPAAAENAITVGA-STLSDERAYFSNWGKCVD 416
           ++AV  A++ G+ F  AAGN N DA   SPA+AEN ITVGA     D  A FSNWG CV+
Sbjct: 280 NMAVEGAIEEGIVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVN 339

Query: 417 IFGPGLNILSTYIGSDTATATLSGTSMATPHVVGLLTYFLSLQPDADSEYFHAAGGITPS 476
           IF PG+ I S    +   T  LSGTSM+TP V G+    LS              GI P 
Sbjct: 340 IFAPGVEIESLSHLNYNDTLILSGTSMSTPIVTGVAAILLS-------------KGIEPE 386

Query: 477 QLKKKLIDFSTKNVLSD----LPEDTVNYLIYNGGGQDLDD 513
            + +++   ST+NV           T N ++YNG  + LDD
Sbjct: 387 MIAQEIEYLSTRNVFHRRTLFFKPSTPNQILYNGVDK-LDD 426

>Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON}
           YCR045C (REAL)
          Length = 540

 Score =  200 bits (508), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 145/401 (36%), Positives = 202/401 (50%), Gaps = 62/401 (15%)

Query: 156 LEGGIQDSFDIAGSLSGYVGYFTKEVIDFIRRSPLV---------EFVEEDSM---VFSN 203
           ++  I+  F I GS  G     +K +++ +++SPLV         E  E D       + 
Sbjct: 94  IDNKIEKKFSI-GSFRGVTMNLSKNLVNKLKKSPLVADIVPNFRFEAFENDGTNDAELNY 152

Query: 204 SFNT-----------------QNSAPWGLARISHREKLNL---------GSFNKYLYDDD 237
           +FN                  Q+ AP  LARIS   +L             FN Y  DD 
Sbjct: 153 TFNATAKYLYEDIDEAQNITYQSDAPRHLARISRHYQLPFDIEDKNRYKSWFNYYYEDDY 212

Query: 238 AGKGVTAYVVDTGVNVNHKDFDGRAVWGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAK 297
            G+ V AY++DTG+  +H +F+ R + G  + K+    D NGHGTH AG +GS  YG AK
Sbjct: 213 LGQDVNAYIMDTGIFSDHPEFEDRVIQGIDLTKEGFG-DQNGHGTHVAGLVGSKTYGAAK 271

Query: 298 NADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQKKGFKGSTANMSLGGGKSPAL 357
             ++V VKVL  +GSG  S+V+ G+E++ E   +    Q    K   AN+SLG  +SP +
Sbjct: 272 KVNLVEVKVLGKDGSGEASNVLSGLEFIVEHCTRVSRPQG---KKCVANLSLGSFRSPII 328

Query: 358 DLAVNAAVKAGVHFAVAAGNENQDACNTSPAAAENAITVGA-STLSDERAYFSNWGKCVD 416
           ++AV  A++ G+ F  AAGN N DA   SPA+AEN ITVGA     D  A FSNWG CV+
Sbjct: 329 NMAVEGAIEEGIVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVN 388

Query: 417 IFGPGLNILSTYIGSDTATATLSGTSMATPHVVGLLTYFLSLQPDADSEYFHAAGGITPS 476
           IF PG+ I S    +   T  LSGTSM+TP V G+    LS              GI P+
Sbjct: 389 IFAPGVEIESLSHLNYEDTLILSGTSMSTPIVTGVAAVLLS-------------KGIEPA 435

Query: 477 QLKKKLIDFSTKNVLSD----LPEDTVNYLIYNGGGQDLDD 513
            + +++   ST+NV           T N ++YNG  + LDD
Sbjct: 436 LIAQEIEYLSTRNVFHRRTLFFKPSTANQILYNGVDK-LDD 475

>Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON}
           (14365..15762) [1398 nt, 466 aa]
          Length = 465

 Score =  196 bits (499), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 131/367 (35%), Positives = 194/367 (52%), Gaps = 47/367 (12%)

Query: 199 MVFSNSFNTQNSAPWGLARISHREKL-----NLGSF-NKYLYDDDA---GKGVTAYVVDT 249
           + +S+    Q  AP  L+R+S R +L     N+  + N + Y  DA   G  V AY++DT
Sbjct: 106 LTYSDKIIIQREAPRHLSRLSRRGQLPYDINNIDRYDNAFDYYFDAKYQGSSVNAYIIDT 165

Query: 250 GVNVNHKDFDGRAVWGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRS 309
           G+   H +F+GR  +   + ++ P  D NGHGTH AG +GS  +GVAK  +I+ VK L  
Sbjct: 166 GIYKEHPEFEGRVKFAIDLTQEGPG-DENGHGTHIAGIVGSKTFGVAKKVNIIDVKALDK 224

Query: 310 NGSGTMSDVVKGVEYVAEAHKKAVEEQKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGV 369
            G G +S ++K +E+     K++V+      K   AN+S G  ++  +D A+  A  AG+
Sbjct: 225 KGQGQLSTILKALEFTIRHCKESVD------KKCVANLSFGAIRTAIIDEAIKEAHNAGI 278

Query: 370 HFAVAAGNENQDACNTSPAAAENAITVGA-STLSDERAYFSNWGKCVDIFGPGLNI--LS 426
              VAAGN N DAC  SPA++++ ITVGA    ++  A FSNWG CVD+F PG+ +  LS
Sbjct: 279 VLVVAAGNSNIDACWNSPASSKDVITVGAFDDRTETIARFSNWGSCVDVFAPGVKVKSLS 338

Query: 427 TYIGSDTATATLSGTSMATPHVVGLLTYFLSLQPDADSEYFHAAGGITPSQLKKKLIDFS 486
              GSD     LSGTSMA+P V G+    L               G+ P  +K K+I+ S
Sbjct: 339 HINGSD--VLLLSGTSMASPSVSGIAAILLD-------------KGLNPKFVKSKIIESS 383

Query: 487 TKNVLSD----LPEDTVNYLIYNGGGQDLDDLWGKDYSIGKEPSANPEFSLESLINSLDS 542
           TKN+       +  +T N +++N G + +DD +        E +  P    E LIN L S
Sbjct: 384 TKNIFHQGTIMIKPNTPNLIVFN-GIEKMDDSF--------EGARFPRIDFEGLINELKS 434

Query: 543 KTDAIFD 549
              ++ D
Sbjct: 435 YRVSVLD 441

>NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {ON}
           Anc_6.313
          Length = 492

 Score =  197 bits (500), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 151/429 (35%), Positives = 216/429 (50%), Gaps = 69/429 (16%)

Query: 117 HQELVSVEHAKALGSLADNDPFFTATSGEHSEFGVKAHSLEGGIQDSFDIAGSLSGYVGY 176
            + LVS++   ++ S  D+    T T G      VK + L   I  +F I GS  G+   
Sbjct: 24  REYLVSLKQNDSIQSFMDS----TITRGR----SVKEY-LRDKIGKTFSI-GSFKGFTVD 73

Query: 177 FTKEVIDFIRRSPLVEFV-----------------EEDSMVFSN-------SFNTQNSAP 212
            T ++++ I+++PLV  V                 ++D   F N       S   Q  AP
Sbjct: 74  LTDDLLEAIKKNPLVSDVVPNLRVHAFEDVKDEEGDDDGGQFDNKMQKGKCSVKVQYGAP 133

Query: 213 WGLARISHREKL---------NLGSFNKYLYDDDA-GKGVTAYVVDTGVNVNHKDFDGRA 262
             LAR+S R++L          L S  KY YD  + G  V AY++D+G+ + H++F+GRA
Sbjct: 134 RHLARLSRRKQLPYDFEDKEAYLDSL-KYFYDKRSQGASVNAYIIDSGIYLEHEEFNGRA 192

Query: 263 VWGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKGV 322
           + G  +  +    D NGHGTH AG +GS  YGVAK   ++ +KVL   G G+++ V+ G+
Sbjct: 193 IPGIDLTGEGSG-DYNGHGTHVAGIVGSKSYGVAKKVKLIEIKVLNRLGQGSLAMVLGGI 251

Query: 323 EYVAEAHKKAVEEQKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQDA 382
           E+   A K   E  KKG     AN+SLG  ++  L+ A+ AA+ AG+   VAAGN N +A
Sbjct: 252 EF---AVKHCQETSKKG--RCVANLSLGSMRTAILNKAIKAAIDAGLVVVVAAGNNNLNA 306

Query: 383 CNTSPAAAENAITVGA-STLSDERAYFSNWGKCVDIFGPGLNILSTYIGSDTATATLSGT 441
           C  SPA+A  AITVGA     D  A FSNWG+C+DIF PG+ I S  I  D    T SGT
Sbjct: 307 CWYSPASAPEAITVGAFDDRIDAIAKFSNWGQCLDIFAPGVVIKSLSIFKDKEDVTYSGT 366

Query: 442 SMATPHVVGLLTYFLSLQPDADSEYFHAAGGITPSQLKKKLIDFSTKNVLSD----LPED 497
           SMA+P V GL    L               G++  ++K  +++  T NV           
Sbjct: 367 SMASPTVAGLAALTLD-------------QGVSAEEVKDYILEMGTDNVFHRRSLLFKPG 413

Query: 498 TVNYLIYNG 506
           T N + +NG
Sbjct: 414 TPNKICFNG 422

>KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {ON}
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 496

 Score =  193 bits (491), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 123/298 (41%), Positives = 167/298 (56%), Gaps = 31/298 (10%)

Query: 204 SFNTQNSAPWGLARISHR-------EKLNLGSFN-KYLYDDD-AGKGVTAYVVDTGVNVN 254
           S   Q  AP  LARIS R       E +++ + N  Y YDD+ +G  V AYV+DTG+   
Sbjct: 131 SIVAQKKAPRHLARISRRTALPYDPENISVPATNFSYYYDDEFSGTCVNAYVIDTGIYKE 190

Query: 255 HKDFDGRAVWGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGT 314
           H   +GRA +G  +  + P  D NGHGTH AG IGS  +GVAK+  ++ VK L + G G 
Sbjct: 191 HPQLEGRAKFGADLVGEGPG-DFNGHGTHVAGLIGSRKFGVAKDVSLIEVKALNAKGQGN 249

Query: 315 MSDVVKGVEYVAEAHKKAVEEQKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVA 374
           ++ V+  +E+        V   +K  +G  AN+SLG  ++  L+ AV AA++AGV   VA
Sbjct: 250 LTSVISAIEF-------TVNHCRKSRRGCVANLSLGSFRNTVLNQAVEAALEAGVVIVVA 302

Query: 375 AGNENQDACNTSPAAAENAITVGA-STLSDERAYFSNWGKCVDIFGPGLNILSTYIGSDT 433
           AGN N +AC +SPA++ +AITVGA    +D  A FSNWG CVDIF PG+ I S       
Sbjct: 303 AGNSNANACWSSPASSLSAITVGAFDDRTDTIARFSNWGNCVDIFAPGVKIESLSNVPPF 362

Query: 434 ATATLSGTSMATPHVVGLLTYFLSLQPDADSEYFHAAGGITPSQLKKKLIDFSTKNVL 491
                SGTSMA+P V G++   L      DS       GI P  +K +LID +T +V 
Sbjct: 363 KPVAFSGTSMASPIVSGMVANLL------DS-------GIHPFDIKTELIDLATDSVF 407

>KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {ON}
           Anc_6.313 YCR045C
          Length = 475

 Score =  189 bits (480), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 142/411 (34%), Positives = 199/411 (48%), Gaps = 55/411 (13%)

Query: 158 GGIQDSFDIAGSLSGYVGYFTKEVIDFIRRSPLVEFVEEDSMV------------FSNSF 205
           G I   F I G L G     + +V+D I+R P V+ V  + MV            +    
Sbjct: 50  GKINKRFQI-GELKGLTMNLSHDVLDKIKRHPFVKEVVPNIMVKAFEGDAVEDESWLPKM 108

Query: 206 NTQNSAPWGLARISHREKLNLGSFNK--------YLYDDDA-GKGVTAYVVDTGVNVNHK 256
             Q  AP  LARIS R +L     NK        Y YD  A G    AY++DTGV  +HK
Sbjct: 109 KRQRGAPRHLARISRRMQLPYDMNNKTRYRDSFNYYYDRWAQGATTRAYILDTGVMRDHK 168

Query: 257 DFDGRAVWGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMS 316
           +F+ R  +G T    + + D NGHGTH AG +GS  +GVAK+  +V VK L + G+GT+ 
Sbjct: 169 EFEDRVEFG-TDCTGEGEGDLNGHGTHVAGLVGSKTFGVAKHVQLVDVKCLDALGAGTLV 227

Query: 317 DVVKGVEYVAEAHKKAVEEQKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAG 376
            ++  +E+  +  ++  + Q         NMSLG  KS  L+ A+N   K G+   VAAG
Sbjct: 228 SILSALEFAVQDCQEHEDSQ------CVLNMSLGSVKSNILNQAINEVEKKGIVVVVAAG 281

Query: 377 NENQDACNTSPAAAENAITVGA-STLSDERAYFSNWGKCVDIFGPGLNILSTYIGSDTAT 435
           N N +AC TSP++A  AITVGA     D  A FSNWG CVDIF PG+N+ S       + 
Sbjct: 282 NFNMNACWTSPSSATGAITVGAFDDRFDTIAKFSNWGPCVDIFAPGVNVASLVNRDWPSF 341

Query: 436 ATLSGTSMATPHVVGLLTYFLSLQPDADSEYFHAAGGITPSQLKKKLIDFSTKNVLSD-- 493
              SGTSMA+P V G++   L               G+ P  ++  L + +T  V     
Sbjct: 342 VKYSGTSMASPIVCGMVALLLD-------------DGVPPEDIRDYLQELATDGVFKKRT 388

Query: 494 --LPEDTVNYLIYNGGGQDLDDLWGKDYSIGKEPSANPEFSLESLINSLDS 542
                 T N ++YNG  +  DD +  D          P+  L+ L+  L++
Sbjct: 389 LVFKPGTPNSVLYNGNKKH-DDEYEDDLQY-------PQVELDDLVQELEN 431

>TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {ON}
           Anc_6.313 YCR045C
          Length = 734

 Score =  190 bits (483), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 126/336 (37%), Positives = 175/336 (52%), Gaps = 40/336 (11%)

Query: 205 FNTQNSAPWGLARISHREKL-----NLGSFNK---YLYDD-DAGKGVTAYVVDTGVNVNH 255
           F  Q  AP  LARIS R+KL     N   F +   Y YDD D G+GV AYV+DTG+   H
Sbjct: 284 FKVQRGAPRHLARISTRDKLPFNFRNANQFEEQLNYYYDDNDKGEGVLAYVIDTGILKEH 343

Query: 256 KDFDGRAVWGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTM 315
           KDF+ R  +G  +  +    D NGHGTH AG IGS  YGV K   I+ VK +   GS  +
Sbjct: 344 KDFEDRVEFGTDLTGEGAG-DLNGHGTHVAGLIGSKTYGVDKKVKIIDVKAVSLTGSTQL 402

Query: 316 SDVVKGVEYVAEAHKKAVEEQKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAA 375
           S +++ +EY        V++     K    NMSLG      ++ AV +A+  GV F VAA
Sbjct: 403 SHIIEAIEYTVNDCNSRVDK-----KACVVNMSLGSFYVKVINEAVESAIAEGVVFVVAA 457

Query: 376 GNENQDACNTSPAAAENAITVGA-STLSDERAYFSNWGKCVDIFGPGLNILSTYIGSDTA 434
           GN N DAC +SP +++NAITVGA     D  A FSNWG+CVDIF  G+ + S        
Sbjct: 458 GNNNIDACWSSPGSSKNAITVGAFDDRLDVIAKFSNWGECVDIFASGVEVKSLSSQVPYK 517

Query: 435 TATLSGTSMATPHVVGLLTYFLSLQPDADSEYFHAAGGITPSQLKKKLIDFSTKNVLSD- 493
               SGTSMA+P V G ++  LS              G+ P+ ++++++  STK   +  
Sbjct: 518 YIKYSGTSMASPIVCGFVSILLS-------------QGVKPNDVQEEMVKLSTKGDFTRR 564

Query: 494 ---LPEDTVNYLIYNG-------GGQDLDDLWGKDY 519
                  T N +++NG          ++++  G+DY
Sbjct: 565 SLIFKPFTSNRILFNGMDPRDSYENDEMENDCGEDY 600

>NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313
          Length = 483

 Score =  184 bits (467), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 152/467 (32%), Positives = 222/467 (47%), Gaps = 75/467 (16%)

Query: 117 HQELVSVEHAKALGSLADNDPFFTATSGEHSEFGVKAHSLEGGIQDSFDIAGSLSGYVGY 176
           H+ LVS++++ ++ S  D+    T   G+     +    L G I  +F   GS  G    
Sbjct: 22  HEYLVSLKNSDSIQSFMDS----TYAHGQ-----LMKDYLHGKISKTFSF-GSFRGLTVN 71

Query: 177 FTKEVIDFIRRSPLV------------------------EFVEEDSMVFSNSF--NTQNS 210
            TK+V+  I+ +PLV                        +  + + +   NS+    QN 
Sbjct: 72  LTKDVVSAIKENPLVVDVVPNMKIHAFDYDDFENNDGYDDIKQPEELFDKNSYLVKVQNG 131

Query: 211 APWGLARISHREKLNLGSFNKYLYDDD---------AGKGVTAYVVDTGVNVNHKDFDGR 261
           AP  LAR+S R  L     +K  Y+D           G  V AY++D+G+++N ++F+GR
Sbjct: 132 APRHLARLSRRMPLPYDFDDKDAYNDSLSYYYSKWHQGTDVNAYIIDSGIDINQEEFEGR 191

Query: 262 AVWGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKG 321
           A  G  +  + P  D NGHGTH AG +GS  YGVAKN  +V VK L   GSG++  V+  
Sbjct: 192 ATHGLDLTGEGPG-DRNGHGTHVAGLVGSKTYGVAKNVTLVEVKALDRQGSGSLITVISA 250

Query: 322 VEYVAEAHKKAVEEQKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQD 381
           +E+V     K+        K   AN+SLG    P L+ A+ A V +GV   VAAGN N D
Sbjct: 251 LEFVVNHCGKSKS------KKCVANLSLGAFMMPLLNEAIKATVDSGVVVVVAAGNGNID 304

Query: 382 ACNTSPAAAENAITVGA-STLSDERAYFSNWGKCVDIFGPGLNILSTYIGSDTATATLSG 440
           AC  SPA+ ++AITVGA     D  A FSNWG CVDIF PG+ I S  I  +  +   SG
Sbjct: 305 ACWCSPASEKSAITVGAFDDRIDTIAKFSNWGSCVDIFAPGVAISSLSIKDNQKSVEFSG 364

Query: 441 TSMATPHVVGLLTYFLSLQPDADSEYFHAAGGITPSQLKKKLIDFSTKNVLSD----LPE 496
           TSMA+P V G+++  L               G+    ++  L + +T +V          
Sbjct: 365 TSMASPQVAGIVSILLD-------------QGVENEDIRDYLFELATDDVFQKRTLLFKP 411

Query: 497 DTVNYLIYNGGGQDLDDLWGKDYSIGKEPSANPEFSLESLINSLDSK 543
            T N + +NG  +       +D+  G  P  N +  L+ L N +  K
Sbjct: 412 RTPNRITFNGISKK-----DEDFEDGIFPEINVDVLLDELQNYVPKK 453

>AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR045C
          Length = 768

 Score =  189 bits (479), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 120/300 (40%), Positives = 164/300 (54%), Gaps = 33/300 (11%)

Query: 203 NSFNTQNSAPWGLARISHREKLNLG-------SFNKYLYDDDAGKGVTAYVVDTGVNVNH 255
           + +  Q  AP  LAR   R  L          +FN Y  ++  G+GV  YV+D+G+  +H
Sbjct: 423 HQYAIQVDAPRHLARTCRRTGLPFDPSGDKEYTFNYYYDEEHLGEGVNVYVLDSGIYKSH 482

Query: 256 KDFDGRAVWGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTM 315
            +FDGRA +G    K+ P  D NGHGTH AG +GS  +G+AK A+I  +KV+  +G G+ 
Sbjct: 483 PEFDGRAHFGIDTTKEGPG-DLNGHGTHVAGLVGSRTFGIAKKANIYEIKVMTVDGRGST 541

Query: 316 SDVVKGVEYVAEAHKKAVEEQKKGFKGSTANMSLGG---GKSPALDLAVNAAVKAGVHFA 372
           S+++ GVE+       AV+  ++  K   ANMSLGG   G S ALD AV AA++ G+ F 
Sbjct: 542 SNIIAGVEF-------AVKHCQQSGKRCVANMSLGGLSFGHS-ALDSAVEAAIEEGLVFV 593

Query: 373 VAAGNENQDACNTSPAAAENAITVGA-STLSDERAYFSNWGKCVDIFGPGLNILSTYIGS 431
           VAAGN  + AC  SPA  + AITVGA    SD  A FSN+GKCVDIF PG+ + S     
Sbjct: 594 VAAGNSKERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVASLSNSP 653

Query: 432 DTATATLSGTSMATPHVVGLLTYFLSLQPDADSEYFHAAGGITPSQLKKKLIDFSTKNVL 491
                 L+GTSM+ P   G++   L               GI P ++K  L+  STK + 
Sbjct: 654 SNTMRVLNGTSMSAPITAGVVAVLLDQ-------------GIEPHEVKDHLLSISTKGLF 700

>Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar to
           Ashbya gossypii AAR069W
          Length = 610

 Score =  182 bits (461), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 126/322 (39%), Positives = 174/322 (54%), Gaps = 37/322 (11%)

Query: 208 QNSAPWGLARISHREKLNLGS-------FNKYLYDDDAGKGVTAYVVDTGVNVNHKDFDG 260
           Q+ AP  LAR   R  L   +       FN Y   +  G+ V  Y++D+G++ +H +F+G
Sbjct: 270 QSGAPRHLARNCRRSGLPFDTSGSKDYEFNYYYDAEHLGETVNVYILDSGIHKSHPEFEG 329

Query: 261 RAVWGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVK 320
           RAV+G     + P  D NGHGTH AG +GS  YG AK A I  VKV+  +G G+ S+++ 
Sbjct: 330 RAVFGIDTTNEGPG-DLNGHGTHVAGLVGSKTYGAAKKATIYEVKVMTVDGRGSTSNIIA 388

Query: 321 GVEYVAEAHKKAVEEQKKGFKGSTANMSLGG---GKSPALDLAVNAAVKAGVHFAVAAGN 377
           GVE+       AV+  ++  K   ANMSLGG   G S ALD AV AA++ G+ F VAAGN
Sbjct: 389 GVEF-------AVKHCQQSGKKCVANMSLGGLSFGHS-ALDSAVEAAIEEGLVFVVAAGN 440

Query: 378 ENQDACNTSPAAAENAITVGA-STLSDERAYFSNWGKCVDIFGPGLNILSTYIGSDTATA 436
             + AC  SPA  + AITVGA    SD  A FSN+GKCVDIF PG+ + S          
Sbjct: 441 SKERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVSSLSNSPYNTVR 500

Query: 437 TLSGTSMATPHVVGLLTYFLSLQPDADSEYFHAAGGITPSQLKKKLIDFSTKNVLSD--- 493
            L+GTSM+ P   G++   L               G+    +K++LID STK V      
Sbjct: 501 VLNGTSMSAPITAGVVAVLLDQ-------------GVKHEDVKERLIDLSTKGVFHRRRL 547

Query: 494 LPEDTVNYLIYNGGGQDLDDLW 515
           +   T +  ++NG  Q+ DD++
Sbjct: 548 VSSRTPDRTLFNGVPQE-DDVF 568

>Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa]
           {ON} YCR045C - Hypothetical ORF [contig 15] FULL
          Length = 493

 Score =  177 bits (449), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 120/297 (40%), Positives = 163/297 (54%), Gaps = 31/297 (10%)

Query: 205 FNTQNSAPWGLARISHREKLNLGSFN--------KYLYDDD-AGKGVTAYVVDTGVNVNH 255
           F  Q +AP  LARIS R  L     N         Y YDD   G  V AYV+DTG+   H
Sbjct: 130 FVAQKNAPRHLARISRRSALPYNPENIAPKTSNFSYYYDDSFPGTCVNAYVIDTGIFKEH 189

Query: 256 KDFDGRAVWGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTM 315
           + F GRA +G  +  + P  D NGHGTH AG IGS  YGVAK+  ++ VK L + G G +
Sbjct: 190 RQFQGRAKFGADLVGEGPG-DLNGHGTHVAGLIGSQKYGVAKDVSLIEVKALNAKGQGNL 248

Query: 316 SDVVKGVEYVAEAHKKAVEEQKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAA 375
           + V+  +E+        V   +K  +G  AN+SLG  ++  L+ AV AA++AGV   VAA
Sbjct: 249 TSVISAIEFT-------VNHCRKSKRGCVANLSLGSFRNSVLNQAVEAALEAGVVVVVAA 301

Query: 376 GNENQDACNTSPAAAENAITVGA-STLSDERAYFSNWGKCVDIFGPGLNILSTYIGSDTA 434
           GN N +AC +SPA++ +AI+VGA    +D  A FSNWG CVD+F PG+ I S        
Sbjct: 302 GNSNANACWSSPASSLSAISVGAFDDRTDTIARFSNWGNCVDLFAPGVKIASLSNIPPFK 361

Query: 435 TATLSGTSMATPHVVGLLTYFLSLQPDADSEYFHAAGGITPSQLKKKLIDFSTKNVL 491
           +   SGTSMA+P V G++   L               GI P  +K++LI+ +T +V 
Sbjct: 362 SVAYSGTSMASPLVTGMVAVLLD-------------SGIHPFDIKEELINTATDSVF 405

>KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {ON}
           Anc_6.313 YCR045C
          Length = 478

 Score =  176 bits (447), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 132/351 (37%), Positives = 181/351 (51%), Gaps = 45/351 (12%)

Query: 207 TQNSAPWGLARISHREKL-----NLGS----FNKYLYDDDAGKGVTAYVVDTGVNVNHKD 257
            Q+ AP  LARIS R+KL     N+ S    FN Y   +  G  V AY++D+GV+ N  D
Sbjct: 118 VQSEAPRHLARISRRDKLPYDFTNVSSYKKSFNYYYGKEHKGADVRAYILDSGVSRNLTD 177

Query: 258 FDGRAVWGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSD 317
           F+GR  +G     D  + D NGHGTH AG +GS  YGVAK   +V VK L   G GT+  
Sbjct: 178 FEGRVEFGFDFTGDG-EGDSNGHGTHVAGLVGSKTYGVAKGVTMVDVKCLDEIGFGTLIT 236

Query: 318 VVKGVEY-VAEAHKKAVEEQKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAG 376
           V+  +E+ V + H+          K   AN+SLG  K+  ++ A+ AA + GV   VAAG
Sbjct: 237 VLSAIEFAVNDCHEHPE-------KRCVANLSLGSFKNAIINKAIQAATEDGVVMVVAAG 289

Query: 377 NENQDACNTSPAAAENAITVGA-STLSDERAYFSNWGKCVDIFGPGLNILSTYIGSDTAT 435
           N N +AC TSPA+AE AITVGA     D  A FSNWG CVDI+ PG+ + S         
Sbjct: 290 NFNINACWTSPASAEEAITVGAFDDRIDTIAKFSNWGPCVDIYAPGVAVESLANFPMVKN 349

Query: 436 ATLSGTSMATPHVVGLLTYFLSLQPDADSEYFHAAGGITPSQLKKKLIDFSTKNVLSD-- 493
            + SGTSMA+P V G +   L               GI    +K  LI  +T +V     
Sbjct: 350 ISYSGTSMASPIVCGQVAILLD-------------KGIPNDDIKSTLIKMATDDVFQKRT 396

Query: 494 --LPEDTVNYLIYNGGGQDLDDLWGKDYSIGKEPSANPEFSLESLINSLDS 542
                +T N +++NG  ++ DD + K+Y         P+  L+ L+  L++
Sbjct: 397 LLFKPNTPNRVLFNGIEKE-DDQY-KEY-------IYPQVDLDILVEELNN 438

>TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {ON}
           Anc_6.313 YCR045C
          Length = 607

 Score =  174 bits (442), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 121/315 (38%), Positives = 163/315 (51%), Gaps = 31/315 (9%)

Query: 206 NTQNSAPWGLARISHREKL--------NLGSFNKYLYDDD-AGKGVTAYVVDTGVNVNHK 256
           + Q  AP  L ++S R +L            F  Y YD    G     Y++DTGV   HK
Sbjct: 148 DIQFGAPRHLGKLSSRHQLPYNVKDEKEFKEFIHYYYDRYYQGTNSVVYIIDTGVYKEHK 207

Query: 257 DFDGRAVWGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMS 316
           +F  R  +G     +    D NGHGTH AG IGS  +GVAKN  +  VKVL   G G ++
Sbjct: 208 EFGNRVHFGGDFIGEGKG-DYNGHGTHVAGLIGSKTFGVAKNVTLFDVKVLDQKGFGNLT 266

Query: 317 DVVKGVEYVAEAHKKAVEEQKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAG 376
            V++G+E+     K  +++Q  G K    NMSLG  ++P ++ A+  A  +G+   VAAG
Sbjct: 267 SVLEGIEFAVNNCK--LKQQPMG-KNCVINMSLGTIRNPIINEAIKEAFLSGITPVVAAG 323

Query: 377 NENQDACNTSPAAAENAITVGA-STLSDERAYFSNWGKCVDIFGPGLNILSTYIGSDTAT 435
           N N  AC TSPA++  AITVGA    +D  A FSNWG+CVDIF PG+ I S         
Sbjct: 324 NNNFSACWTSPASSNFAITVGAMDDRTDTIAVFSNWGQCVDIFAPGVRIKSLSNRMLENG 383

Query: 436 ATLSGTSMATPHVVGLLTYFLSLQPDADSEYFHAAGGITPSQLKKKLIDFSTKNVLSDL- 494
              SGTSMA+P V GL+   +               G    ++K+KLID S+K++ S L 
Sbjct: 384 VIHSGTSMASPIVAGLVAILME-------------KGYKCDEIKQKLIDDSSKSIFSKLT 430

Query: 495 ---PEDTVNYLIYNG 506
                 T N +IYNG
Sbjct: 431 LFFKYGTPNRVIYNG 445

>KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some
           similarities with uniprot|P25036 Saccharomyces
           cerevisiae YOR003W YSP3 subtilisin-like protease III
          Length = 508

 Score =  171 bits (432), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 130/327 (39%), Positives = 178/327 (54%), Gaps = 35/327 (10%)

Query: 201 FSNSFNTQNSAPWGLARISHR------EKLNLGSFNKYLYDDD-AGKGVTAYVVDTGVNV 253
           FS+ F +Q+ AP  LARIS R      EK +  S  KY Y ++  G+GV  YV+D+GVN 
Sbjct: 147 FSDDFISQSRAPRHLARISRRAQLPVIEKDDTSSGLKYHYHEEHQGEGVFVYVLDSGVNH 206

Query: 254 NHKDFDGRAVWGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSG 313
           +H DF+GRA+ G     +    D  GHGTH AG IGS  YGVAK  +IV VKVL S G G
Sbjct: 207 DHPDFEGRAMKGIDTTGEGSG-DLVGHGTHVAGLIGSKTYGVAKKVNIVEVKVLDSMGKG 265

Query: 314 TMSDVVKGVEYVAEAHKKAVEEQKKGFKGSTANMSLGG-GKSPALDLAVNAAVKAGVHFA 372
           T++++++G+EYV     + + +++K       NMSLG  G    LD AV+A ++ GV   
Sbjct: 266 TVTNIIEGLEYVVN---QCIGKKRK----CVINMSLGAPGTHSILDKAVSAVIEEGVVVV 318

Query: 373 VAAGNENQDACNTSPAAAENAITVGA-STLSDERAYFSNWGKCVDIFGPGLNILSTYIGS 431
           VA GN   +AC  SPA    AITV A    +D  A FSNWG C+DI+ PG+N+ S     
Sbjct: 319 VAGGNSGLNACWYSPAKVRKAITVAAMDDRTDLMAPFSNWGACIDIWAPGVNVKSLS-NK 377

Query: 432 DTATATLSGTSMATPHVVGLLTYFLSLQPDADSEYFHAAGGITPSQLKKKLIDFSTKNVL 491
              T  LSGTSMA+P V G    +L               G  P++++K L   +T+ V 
Sbjct: 378 GRGTFVLSGTSMASPIVAGAAAIYLD-------------QGADPAEVRKILSKTATRGVF 424

Query: 492 SD----LPEDTVNYLIYNGGGQDLDDL 514
                 +   T N ++Y G  Q+ D+ 
Sbjct: 425 KKRAIAVRPRTPNKVLYTGNNQEDDEF 451

>TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON}
           Anc_6.313 YCR045C
          Length = 497

 Score =  150 bits (380), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 116/360 (32%), Positives = 176/360 (48%), Gaps = 34/360 (9%)

Query: 205 FNTQNSAPWGLARISHREKLNLGS---FNKYLYDDDAGKGVTAYVVDTGVNVNHKDFDGR 261
           ++TQ +AP  L+R S   KL   S   +N Y   D  G  VT YV+D+G+ ++H +F+GR
Sbjct: 142 YSTQFNAPRHLSRASRITKLPTASNFTYNYYYPRDYQGANVTVYVLDSGIRMDHPEFEGR 201

Query: 262 AVWGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKG 321
            +       D    D  GHGT  AG IGS  YGVAKN +++ +KVL + G G +  +++G
Sbjct: 202 ILEAYDF-TDSGVGDNYGHGTSVAGIIGSKTYGVAKNVNLIDIKVLNNKGKGNVFSILQG 260

Query: 322 VEYVAEAHKKAVEEQKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQD 381
           ++++     K  EE   G      N SLG      L+ A      AG+    AAGN   +
Sbjct: 261 LQFIT----KHCEENTNG--NCIINASLGAINIQILNKAFEEVHNAGIPVICAAGNNAVN 314

Query: 382 ACNTSPAAAENAITVGASTLSDER-AYFSNWGKCVDIFGPGLNILSTYIGSDTATATLSG 440
           AC  +PA ++   TVG+    D+  A FSNWG+CVD+  PG+ + +    +   +   SG
Sbjct: 315 ACWITPAGSKGVFTVGSFDDRDDTIATFSNWGRCVDMMAPGVYVRTLLYTNQKGSRESSG 374

Query: 441 TSMATPHVVGLLTYFLSLQPDADSEYFHAAGGITPSQLKKKLIDFSTKNVL-----SDLP 495
           TS++TP V GL    LS              G+    L  ++    ++++L     S LP
Sbjct: 375 TSVSTPIVTGLAAILLS-------------KGVPKENLYDEIRKMGSRDLLRNKEFSRLP 421

Query: 496 EDTVNYLIYNGGGQDLDDLWGKDYSIGKEPSANPEFSLESLINSLDSKTDAIFDDVRQLL 555
             T N LI N G Q  DD++  D  I +E       +  + +++L+ K    F D   L+
Sbjct: 422 -GTPN-LIVNIGPQKEDDVYPDDAYIDEERRYT---TPATFVDTLNQKKRIHFTDNYDLV 476

>KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 380

 Score =  136 bits (343), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 101/315 (32%), Positives = 168/315 (53%), Gaps = 19/315 (6%)

Query: 153 AHSLEGGIQDSFDIAGSLSGYVGYFTKEVIDFIRRSPLVEFVEEDSMVFSNSFNTQNSAP 212
           A ++ GG   +  +  S     G F +++++   RS  +  +  D  +    +  Q  AP
Sbjct: 38  AATVAGGGVGAITLGNSFRAIYGEFPQQLLEDFYRSGQIVAMSMDRPLGVAEYMVQQHAP 97

Query: 213 WGLARISHREKLNLGSFN---KYLYDDDAGKGVTAYVVDTGVNVNHKDFDGRAVWGKTIP 269
             LAR+S +  L  G+ +    Y+Y  +AG GV  Y++DTG++  H  F+GR V      
Sbjct: 98  NHLARLSQKSSLRGGNGSDNGAYIYHSNAGNGVDVYLLDTGIDGTHPAFEGR-VQKAADF 156

Query: 270 KDDPDVDG--NGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVAE 327
             DP   G  +GHGT  AG IGS  +GVAK  ++  V+V  S G  ++  V++ +E+   
Sbjct: 157 SSDPVATGDPHGHGTAVAGVIGSSVFGVAKKCNLFDVRVANSTGHASLIGVLRALEH--- 213

Query: 328 AHKKAVEEQKKGFKGSTANMSLGGGKSPALDLAVNAAVK-AGVHFAVAAGNENQDACNTS 386
           A K A   ++     S   + L   ++  L+ AV A V+   +   VAAGNEN+ AC+ S
Sbjct: 214 ASKLAAVTKRP----SLITIPLEMPRNTILNSAVEAVVRDLSIPVVVAAGNENRSACSVS 269

Query: 387 PAAAENAITVGASTLS--DERAYFSNWGKCVDIFGPGLNILSTYIGSD-TATATLSGTSM 443
           PA A  A+T+G+  ++  D  A F+N+ +CVD+F  G+++ +  +G D ++   LSGTS+
Sbjct: 270 PAGAYGALTIGSIDVARNDALAPFTNFAECVDLFTAGVDVAT--LGLDHSSEHHLSGTSI 327

Query: 444 ATPHVVGLLTYFLSL 458
           +     GL+ Y++S+
Sbjct: 328 SAGVASGLVAYYMSI 342

>Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045C -
           Hypothetical ORF [contig 118] FULL
          Length = 377

 Score =  136 bits (342), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 95/309 (30%), Positives = 157/309 (50%), Gaps = 21/309 (6%)

Query: 158 GGIQDSFDIAGSLSGYVGYFTKEVIDFIRRSPLVEFVEEDSMVFSNSFNTQNSAPWGLAR 217
           GG+  +  +  S     G F + +++ +     +  +  D ++    +  Q  AP  LAR
Sbjct: 44  GGV-GAISLGNSFRAIYGDFPQRLLENLYYDGRITAMSMDHILTPAEYIVQEHAPAHLAR 102

Query: 218 ISHREKLNLGSFNKYLYDDDAGKGVTAYVVDTGVNVNHKDFDGRA-----VWGKTIPKDD 272
           +S +  L  GS   Y+Y  + G GV  Y++DTG++  H + +GR      +    +   D
Sbjct: 103 LSQKSTLR-GSDGTYIYHSNGGNGVDVYLLDTGIDDLHPELEGRVQKIADLTSNPVSHGD 161

Query: 273 PDVDGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKA 332
           P    +GHGT  AG IGS  +G AK  ++  V+V  S G+ T+  V++ +E+   A K A
Sbjct: 162 P----HGHGTAVAGVIGSATFGSAKKCNLFDVRVADSTGNATLIGVIRALEH---ASKLA 214

Query: 333 VEEQKKGFKGSTANMSLGGGKSPALDLAVNAAVK-AGVHFAVAAGNENQDACNTSPAAAE 391
              Q+     S   +     K+  L+ A+ A ++   +   VA GN NQ+AC++SPA+A 
Sbjct: 215 SVTQRP----SVVVIPFTMRKNVILNSAIEAVIRDQSLPVVVAGGNFNQNACDSSPASAY 270

Query: 392 NAITVGA--STLSDERAYFSNWGKCVDIFGPGLNILSTYIGSDTATATLSGTSMATPHVV 449
            A+T+G+   T  D  A F+N+G C+D F  G+NI S   G   +    SGTS++     
Sbjct: 271 GALTIGSIDVTKGDSLAPFTNYGDCIDTFAAGVNITSLTTGDYESNTQYSGTSISAGIAS 330

Query: 450 GLLTYFLSL 458
           G++ Y++SL
Sbjct: 331 GVVAYYMSL 339

>Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa]
           {ON} complement(151054..152214) [1161 nt, 387 aa]
          Length = 386

 Score =  131 bits (329), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 99/312 (31%), Positives = 162/312 (51%), Gaps = 24/312 (7%)

Query: 162 DSFDIAGSLSGYVGYFTKEVIDFIRRSPLVEFVEEDSMVFSNSFNTQNSAPWGLARISH- 220
           D   I     G+ G F  EV+  +   P V  +  D M++   +  QN AP  LAR+S+ 
Sbjct: 53  DKIVIGSDFHGFSGEFEDEVMSELYGDPRVASISIDRMLYLQEYLRQNDAPEHLARLSNG 112

Query: 221 --REKLNLGSFNKYLYDDDAGKGVTAYVVDTGVNVNHKDFDGRAVWGKTIPKDD---PDV 275
               +++  + N +++   AG GV  Y+VD+G++  H  F  R +  K I   D   P  
Sbjct: 113 VSNSRVSAKNENAFIFHSHAGIGVDVYIVDSGIDSQHPAFMNRHI-SKLIDLTDNPIPVG 171

Query: 276 DGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGT-MSDVVKGVEYVAEAHKKAVE 334
           D +GHGT  AG + S  +GV K A++  V+V+ +  +G  +S ++K +E++ E H +A  
Sbjct: 172 DPHGHGTAIAGLVTSDTFGVMKKANLFDVRVVDAESNGVKLSKLLKSLEFI-ENHSRAT- 229

Query: 335 EQKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQDACNTSPAAAENA- 393
                 + S A +     K+  L+ A+  ++   +   V AGN++  ACN SPA+A N+ 
Sbjct: 230 -----MRPSVAVLPFSMSKNAILNSAIE-SMPNSIAIVVPAGNQHHMACNFSPASARNSQ 283

Query: 394 --ITVGASTL--SDERAYFSNWGKCVDIFGPGLNI--LSTYIGSD-TATATLSGTSMATP 446
             ++VG+     S E A FSN+G+CVD+F  G+ +  L     SD    + +SGTSM+  
Sbjct: 284 SILSVGSLDYRSSIEIASFSNYGECVDVFTSGVQMDTLHATTNSDENYISKVSGTSMSCA 343

Query: 447 HVVGLLTYFLSL 458
              G + Y++SL
Sbjct: 344 IAAGTVGYYMSL 355

>ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]
           {ON} conserved hypothetical protein
          Length = 386

 Score =  110 bits (275), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 88/313 (28%), Positives = 146/313 (46%), Gaps = 24/313 (7%)

Query: 160 IQDSFDIAGSLSGYVGYFTKEVIDFIRRSPLVEFVEEDSMVFSNSFNTQNSAPWGLARIS 219
           I D F++ GS   + G F+  ++  +   P V  +  D  +       QN+AP  L  +S
Sbjct: 45  ITDIFEL-GSFRAFTGDFSGPILQKLYNDPNVLAISRDGSLKLQEIVLQNNAPSHLVGLS 103

Query: 220 HREKLNLGSFNKYLYDDDAGKGVTAYVVDTGVNVNHKDFDGRAVWGKTIPKDDP---DVD 276
               L   S   ++Y  + G GV  Y++DTG+++ H +     +         P     D
Sbjct: 104 SISPL---SHQPFIYRSNGGNGVDVYLLDTGIDIKHPNLSKLNILRMADLTQSPVPQGTD 160

Query: 277 GNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQ 336
             GHGT  AG I S  +GV K  ++V V+V  SNG   +S +++ +       ++ +E  
Sbjct: 161 PQGHGTAMAGIIASETFGVLKKCNLVDVRVADSNGDVKLSTILQALTLT----QRHIEGT 216

Query: 337 KKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQDACNTSPA----AAEN 392
           K+        + +  G +P L  A+ A+    V   + AGN  QDA N SPA      +N
Sbjct: 217 KRP-SVVVIPLEVEDGNNPILTEAI-ASFDQSVPIIIPAGNNAQDALNFSPANVNPKPKN 274

Query: 393 AITVGASTLSDERAYFSNWGKCVDIFGPGLNI-------LSTYIGSDTATATLSGTSMAT 445
            I VG+  +++    F+N+G  VD+F  G  I       L +   S++ T  +SGTS ++
Sbjct: 275 IIVVGSVDVNNNPTKFTNYGSNVDVFTVGEQITTLQSTDLDSQGLSNSLTRQVSGTSASS 334

Query: 446 PHVVGLLTYFLSL 458
               G++ Y++SL
Sbjct: 335 AITAGVIGYYMSL 347

>TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa]
           {ON} Anc_1.78
          Length = 388

 Score =  108 bits (271), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 87/314 (27%), Positives = 152/314 (48%), Gaps = 31/314 (9%)

Query: 164 FDIAGSLSGYVGYFTKEVIDFIRRSPLVEFVEEDSMVFSNSFNTQNSAPWGLARISHREK 223
            +I  S   + G  +KE +  +        +  +  +    +  Q  AP  L R++ ++ 
Sbjct: 53  IEIGNSFIAFSGDLSKEQVSSVFEDNAAAAISTEKYLELQGYLKQTDAPKHLGRLT-KDS 111

Query: 224 LNLGSF----NKYLYDDDAGKGVTAYVVDTGVNVNHKDFDGRAVWG----KTIPKDDPDV 275
           +    +    N+Y++ D +G GV  Y+VDTG+++ H  +    +       T P   P  
Sbjct: 112 IKSSQYHYANNQYIFSDTSGNGVDIYIVDTGIDIQHPIYLQNNIHKLIDLTTSPI--PSG 169

Query: 276 DGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGS-GTMSDVVKGVEYVAEAHKKAVE 334
           D NGHGT  AG I S  +GV K+A++V V+V+ +N    TMS V+  +  + E H     
Sbjct: 170 DFNGHGTAMAGIINSDPFGVLKSANLVDVRVVDANTKHATMSRVLSALSLI-EKH----- 223

Query: 335 EQKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQDACNTSPAAAE--- 391
            ++K  + S   +     K+  L+ A+    K  +   + AGN++Q+AC  SP   +   
Sbjct: 224 -EQKTMRPSIIVLPFQTEKNTILESAIENISKK-IPVIIPAGNKHQNACKLSPMGIKKLS 281

Query: 392 NAITVGASTLSDERAY-----FSNWGKCVDIFGPGLNILSTYIGSDTATATL---SGTSM 443
           N + VG+   S+E+ Y     FSN+G CVDI+  G++I +    S+     +   +GTS 
Sbjct: 282 NVLVVGSLEYSEEQNYLDIAKFSNYGSCVDIYTSGVDISTLKTSSNGGKELIHNVTGTSY 341

Query: 444 ATPHVVGLLTYFLS 457
           +   V G++ Y++S
Sbjct: 342 SCGIVAGVVGYYMS 355

>TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa]
           {ON} Anc_1.78
          Length = 364

 Score = 93.6 bits (231), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 80/290 (27%), Positives = 137/290 (47%), Gaps = 21/290 (7%)

Query: 175 GYFTKEVIDFIRRSPLVEFVEEDSMVFSNSFNTQNSAPWGLARISHREKLNLGSFNKYLY 234
           G F+ E ++++     V  +  D  +    +  Q  +P  L+++S     + GSF    +
Sbjct: 58  GEFSVEDLEYLYHDERVVAISRDRDLKLQEYKVQYGSPRHLSQLS-----SGGSFT---F 109

Query: 235 DDDAGKGVTAYVVDTGVNVNH---KDFDGRAVWGKTIPKDDPDVDGNGHGTHCAGTIGSV 291
           D  +G  V  YV DTG++  H   ++ +   +   T        D +GHGT  AG I S 
Sbjct: 110 DPVSGNLVDVYVFDTGIDFKHPGLQNVNPHKLADFTSSPVPRGADPHGHGTMMAGLIASE 169

Query: 292 HYGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQKKGFKGSTANMSLGG 351
            +GV K+  +V V+V   +G   +S ++KG+   + AH +  +         T      G
Sbjct: 170 TFGVLKSCSLVDVRVADKDGEVKLSTLMKGIS-ASVAHARFTKRPSVFVLPMTI-----G 223

Query: 352 GKSPALDLAVNAAVKAGVHFAVAAGNENQDACNTSPAAAENAITVGASTLSDERAYFSNW 411
            K+  LD  + A  K  +   + AGN+  DAC+ SP    N + +G+    +  A FSN+
Sbjct: 224 KKNHILDNFLQAIPK-DIAIVLPAGNQQTDACDLSPPNDHNILVIGSLDRDNRLADFSNY 282

Query: 412 GKCVDIFGPGLNIL---STYIGSDTATATLSGTSMATPHVVGLLTYFLSL 458
           G CVD++  G +IL   ST  G++    + +GTS +     G++ Y +S+
Sbjct: 283 GNCVDVYTSGTDILTLRSTDSGNEVLLQSSNGTSASCAIGAGIVGYHMSM 332

>TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1.78
          Length = 382

 Score = 86.3 bits (212), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 77/265 (29%), Positives = 121/265 (45%), Gaps = 26/265 (9%)

Query: 207 TQNSAPWGLARISHREKLNLGSFNKYLYDDDAGKGVTAYVVDTGVNVNHKDFDGRAVWGK 266
            Q  AP  L ++   E  +    N+++YD  AG GV  Y+ DTG+  N        +   
Sbjct: 96  VQKDAPRHLTKLLETEAGD----NEFVYDSTAGNGVDIYIFDTGIARNSPGLSASRIHDM 151

Query: 267 TIPKDDP--DVDGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVEY 324
                 P  D +   HGT  +G IGS  +GV K  +++ V V   NG   MS V+KG+  
Sbjct: 152 PGMPGPPIRDQEILEHGTAMSGLIGSPAFGVLKKCNLIDVNVGDENGKVFMSKVLKGLNL 211

Query: 325 VAEAHKKAVEEQKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQDACN 384
           V + H K         + S  N S    K+  L+ A +   +  V  AVAAGN  Q  C+
Sbjct: 212 V-QQHVKHTN------RPSVINFSYCTLKNAILNSAFDNFPR-DVPIAVAAGNYKQPGCS 263

Query: 385 TSPAAAE---NAITVGASTLSDE---RAYFSNWGKCVDIFGPGLNILSTYI------GSD 432
            SP   +   + +  G+  ++D+    + FSN+G CV  + PG  +L+  I       S 
Sbjct: 264 FSPVGCQRNKSLLAFGSLLMNDDGITLSDFSNYGSCVGSYAPGEGLLTFGIPDTSRPNSR 323

Query: 433 TATATLSGTSMATPHVVGLLTYFLS 457
                +SGTS ++    G++ Y+++
Sbjct: 324 DTVIIISGTSGSSALGAGVIGYYMA 348

>SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar to
           uniprot|P13134 YNL238W Saccharomyces cerevisiae KEX2
           Subtilisin-like protease (proprotein convertase)
          Length = 836

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 67/258 (25%), Positives = 101/258 (39%), Gaps = 45/258 (17%)

Query: 234 YDDDAGKGVTAYVVDTGVNVNHKD----FDGRAVW--GKTIPKDDPDVDGNGHGTHCAGT 287
           Y++  G GV A +VD G++  ++D    F     W      P   P +  + HGT CAG 
Sbjct: 185 YENITGHGVVAAIVDDGLDYENRDLKDNFCAEGSWDFNDNTPLPKPRLRDDYHGTRCAGE 244

Query: 288 IGSVH-----YGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQKKGFKG 342
           I +V       GVA NA +  +++L  +G  T  D     E  +  +   V +      G
Sbjct: 245 IAAVKNDACGVGVAYNAKVAGIRIL--SGEITSED-----EAASLVYGLGVNDIYSCSWG 297

Query: 343 STANMSLGGGKSPALDLAVNAAVKAGVH-----------FAVAAGNENQDACNTSPAA-A 390
              +    G +  A D  V  A+  GV            FA   G    D CN      +
Sbjct: 298 PADD----GRQMQAPDELVKKAIVKGVLEGRDEKGALYVFASGNGGLYDDNCNYDGYTNS 353

Query: 391 ENAITVGASTLSDERAYFSNWGK-CVDIF------GPGLNILSTYIGSDTATATLSGTSM 443
             +ITVGA    D +     + + C  +       G G +I ST + ++  +    GTS 
Sbjct: 354 IYSITVGAI---DHKGLHPPYAEACSAVLVVTYSSGSGEHIHSTDV-NNQCSHRHGGTSA 409

Query: 444 ATPHVVGLLTYFLSLQPD 461
           A P   G+ +  L   PD
Sbjct: 410 AAPLAAGIYSLVLEANPD 427

>NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6
           YNL238W
          Length = 833

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 72/260 (27%), Positives = 103/260 (39%), Gaps = 42/260 (16%)

Query: 231 KYLYDDDAGKGVTAYVVDTGV---NVNHKD-FDGRAVW----GKTIPKDDPDVDGNGHGT 282
           +  Y++  G G+ A +VD GV   N N KD F     W       +PK  P +  + HGT
Sbjct: 183 QLWYENVTGTGIVAAIVDDGVDYDNDNIKDNFSREGSWDFNDNGPLPK--PKLKDDYHGT 240

Query: 283 HCAGTI------GSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQ 336
            CAG I      G    GVA +A +  +++L  +G  T  D     E  +  H   V + 
Sbjct: 241 RCAGEIAASKNNGICGVGVAYDAKVAGIRIL--SGELTAED-----EAASLVHALDVNDI 293

Query: 337 KKGFKGSTANMSLGGGKSPALDLAVNAAVKA--------GVHFAVAAGNENQ--DACNTS 386
                G   + +   G +   DL   A ++         G  +  A+GN     D CN  
Sbjct: 294 YSCSWGPRDDGTHLQGPT---DLVKKAMIRGVTEGRDQKGALYVFASGNGGAYGDNCNYD 350

Query: 387 PAA-AENAITVGASTLSDERAYFSNWGKCVDIF----GPGLNILSTYIGSDTATATLSGT 441
               +  +ITVGA         +S     V +     G G  I +T IG D  + T  GT
Sbjct: 351 GYTNSIYSITVGAIDHKGLHPPYSESCSAVMVVTCSSGSGEFIHTTDIG-DKCSNTHGGT 409

Query: 442 SMATPHVVGLLTYFLSLQPD 461
           S A P   G+ T  L   P+
Sbjct: 410 SAAAPLAAGVYTLVLQANPE 429

>TBLA0B00130 Chr2 (12377..14905) [2529 bp, 842 aa] {ON} Anc_2.6
           YNL238W
          Length = 842

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 51/102 (50%), Gaps = 17/102 (16%)

Query: 238 AGKGVTAYVVDTGVNVNHKD------FDGRAVWGKTIPKDDPDVDGNGHGTHCAGTIGSV 291
            GK VT  +VD GV+  ++D      F+G   +     K  P +  + HGT CAG I +V
Sbjct: 166 TGKNVTVAIVDDGVDYENEDLKDKFCFEGSWDFNDNTAKPKPRLSDDYHGTRCAGEIAAV 225

Query: 292 H-----YGVAKNADIVAVKVLRSNGSGTMSD----VVKGVEY 324
                  GVA +A I  +++L  +G  T+ D    ++ G++Y
Sbjct: 226 RNDYCGVGVAFDAHISGLRIL--SGELTVEDEAAALIYGLKY 265

>ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]
           {ON} similar to uniprot|P13134 YNL238W Saccharomyces
           cerevisiae KEX2 Subtilisin-like protease (proprotein
           convertase)
          Length = 790

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 43/87 (49%), Gaps = 15/87 (17%)

Query: 234 YDDDAGKGVTAYVVDTGVNVNHKD----FDGRAVW----GKTIPKDDPDVDGNGHGTHCA 285
           Y++  G GV A +VD G++   +D    F     W       +PK  P +D + HGT CA
Sbjct: 154 YENITGHGVVAAIVDDGLDYESEDLKDNFCKEGSWDFNDNTKLPK--PRLDDDYHGTRCA 211

Query: 286 GTIGSV-----HYGVAKNADIVAVKVL 307
           G I +V       GVA NA +  +++L
Sbjct: 212 GEIAAVPNDFCAVGVAFNAKLSGIRIL 238

>Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238W
           (REAL)
          Length = 819

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 68/259 (26%), Positives = 97/259 (37%), Gaps = 42/259 (16%)

Query: 231 KYLYDDDAGKGVTAYVVDTGVNVNHKD----FDGRAVW----GKTIPKDDPDVDGNGHGT 282
           K  Y++  G GV A +VD G++  ++D    F     W       +PK  P +  + HGT
Sbjct: 158 KLWYNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPK--PRLSDDYHGT 215

Query: 283 HCAGTIGS------VHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQ 336
            CAG I +         GV  NA I  +++L  +G  T  D    + Y  + +       
Sbjct: 216 RCAGEIAAKKGNNFCGVGVGYNAKISGIRIL--SGDITTEDEAASLIYGLDTNDI----- 268

Query: 337 KKGFKGSTANMSLGGGKSPALDLAVNAAVKA--------GVHFAVAAGN--ENQDACNTS 386
              +  S      G       DL   A VK         G  +  A+GN     D CN  
Sbjct: 269 ---YSCSWGPADDGRHLQGPNDLVKKALVKGVTQGRDSKGAIYVFASGNGGARGDNCNYD 325

Query: 387 PAA-AENAITVGASTLSDERAYFSNWGKCVDIF----GPGLNILSTYIGSDTATATLSGT 441
               +  +IT+GA    D    +S     V +     G G  I S+ I    +  T  GT
Sbjct: 326 GYTNSIYSITIGAIDHKDLHPPYSEGCSAVMVVTYSSGSGEYIHSSDINGGCSN-THGGT 384

Query: 442 SMATPHVVGLLTYFLSLQP 460
           S A P   G+ T  L   P
Sbjct: 385 SAAAPLAAGVYTLLLEANP 403

>KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa]
           {ON} Anc_2.6 YNL238W
          Length = 766

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 70/257 (27%), Positives = 101/257 (39%), Gaps = 42/257 (16%)

Query: 234 YDDDAGKGVTAYVVDTGVNVNHKD----FDGRAVW----GKTIPKDDPDVDGNGHGTHCA 285
           Y +  GKGV A VVD G++  + D    F     W       +PK  P +  + HGT CA
Sbjct: 152 YQNITGKGVVAAVVDDGLDYENPDIKDNFCKEGSWDFNANTNLPK--PTLADDYHGTRCA 209

Query: 286 GTIGSVH------YGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQKKG 339
           G I +V        GVA +A +  +++L  +G  T  D     E  A  +   + +    
Sbjct: 210 GEIAAVKNNGICGIGVAYDAKVAGIRIL--SGEITAED-----EAAALINALDINDIYSC 262

Query: 340 FKGSTANMSLGGGKSPALDLAVNAAVKA--------GVHFAVAAGNENQ--DACNTSPAA 389
             G   + +   G S   DL   A +K         G  +  A+GN     D CN     
Sbjct: 263 SWGPQDDGTHLQGPS---DLVKKALIKGVNDGRKNKGAIYVFASGNGGSFGDNCNYDGYT 319

Query: 390 -AENAITVGASTLSDERAYFSNWGKCVDIF----GPGLNILSTYIGSDTATATLSGTSMA 444
            +  +ITVGA    D    +S     V +     G G  I +T I ++       GTS A
Sbjct: 320 NSIYSITVGAIDHKDLHPPYSESCSAVMVVTYSSGSGEYIHTTDI-NNKCNDRHGGTSAA 378

Query: 445 TPHVVGLLTYFLSLQPD 461
            P   G+ T  L   P+
Sbjct: 379 APLAAGIYTLLLQANPN 395

>NDAI0F03890 Chr6 complement(921561..924062) [2502 bp, 833 aa] {ON}
           Anc_2.6 YNL238W
          Length = 833

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 67/262 (25%), Positives = 101/262 (38%), Gaps = 46/262 (17%)

Query: 231 KYLYDDDAGKGVTAYVVDTGVNVNHKD----FDGRAVW----GKTIPKDDPDVDGNGHGT 282
           K  Y++  G+G+   +VD G++  + D    F     W       +PK  P +  + HGT
Sbjct: 172 KLWYENITGEGIVVAIVDDGLDYENPDLKDNFSAEGSWDFNDNTQLPK--PRLADDYHGT 229

Query: 283 HCAGTI------GSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQ 336
            CAG I      G    GVA NA +  +++L  +G  T  D     E  +  H   V + 
Sbjct: 230 RCAGEIAATKDNGFCGIGVAYNAKVAGIRIL--SGELTAED-----EAASLVHALDVNDI 282

Query: 337 KKGFKGSTANMSLGGGKSPALDLAVNAAV--------KAGVHFAVAAGNENQ--DACNTS 386
                G   + +   G +   DL   A +        K G  +  A+GN     D CN  
Sbjct: 283 YSCSWGPKDDGTHLQGPT---DLVKKAMIRGTSDGRDKKGAIYVFASGNGGAFGDNCNYD 339

Query: 387 PAAAE-NAITVGASTLSDERAYFSNWGKCVDIF------GPGLNILSTYIGSDTATATLS 439
                  +IT+GA         +S    C  +       G G  I ST IG +  +    
Sbjct: 340 GYTNSIYSITIGALDHKGLHPPYSE--SCSAVMAVTYSSGSGEYIHSTDIG-NKCSDHHG 396

Query: 440 GTSMATPHVVGLLTYFLSLQPD 461
           GTS A P   G+ +  L + P+
Sbjct: 397 GTSAAAPLAAGIFSLVLQVNPN 418

>CAGL0J07546g Chr10 complement(733686..736055) [2370 bp, 789 aa]
           {ON} similar to uniprot|P13134 Saccharomyces cerevisiae
           YNL238w KEX2 endoproteinase of late golgi compartment
          Length = 789

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 66/250 (26%), Positives = 92/250 (36%), Gaps = 36/250 (14%)

Query: 238 AGKGVTAYVVDTGVNVNHKD----FDGRAVW----GKTIPKDDPDVDGNGHGTHCAGTIG 289
            GKGV A ++D GV+    D    F     W     + +P   P +  + HGT CAG I 
Sbjct: 169 TGKGVVAAIIDDGVDYTSPDLKDNFCKEGSWDFNENQQLPM--PLLSDDNHGTRCAGEIA 226

Query: 290 SVH------YGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQKKGFKGS 343
           ++        GVA +A +  +++L  +G  T  D     E  +  H   V +      G 
Sbjct: 227 AIRNNNYCGVGVAYDAKVSGIRIL--SGPLTAED-----EAASLVHALDVNDIYSCSWGP 279

Query: 344 TANMSLGGGKSPALDLAVNAAVKAG-------VHFAVAAGNENQDACNTSPAAAE-NAIT 395
           T +     G SP +  A+   V  G         FA   G  + D CN         +IT
Sbjct: 280 TDDGKHLQGPSPLVKKAMKKGVTEGRGNKGAIYVFASGNGGMHGDNCNYDGYTNSIYSIT 339

Query: 396 VGASTLSDERAYFSNWGKCVDIF----GPGLNILSTYIGSDTATATLSGTSMATPHVVGL 451
           VGA         +S     V +     G G  I ST I          GTS A P   G+
Sbjct: 340 VGAIDHKGLHPPYSESCSAVLVVTYSSGSGEYIHSTDINGGCYDRH-GGTSAAAPIAAGI 398

Query: 452 LTYFLSLQPD 461
               L   P+
Sbjct: 399 YALVLEANPN 408

>TPHA0P01790 Chr16 complement(373247..375646) [2400 bp, 799 aa] {ON}
           Anc_2.6 YNL238W
          Length = 799

 Score = 39.7 bits (91), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 46/99 (46%), Gaps = 17/99 (17%)

Query: 239 GKGVTAYVVDTGVNVNHKD----FDGRAVW----GKTIPKDDPDVDGNGHGTHCAGTIGS 290
           GKGV A +VD G++ N +D    F     W     K +P   P +  + HGT CAG I +
Sbjct: 163 GKGVVAAIVDDGLDHNSEDLKDNFCEEGSWDFNENKKLPT--PKLIDDYHGTRCAGEIAA 220

Query: 291 VH-----YGVAKNADIVAVKVLRSNGSGTMSDVVKGVEY 324
           V       GVA  A +  +++L  +G  T  D    + Y
Sbjct: 221 VKNEYCGLGVAYGAKVAGIRIL--SGQITAEDEAASLMY 257

>KLTH0H00418g Chr8 (46022..48457) [2436 bp, 811 aa] {ON} similar to
           uniprot|P13134 YNL238W Saccharomyces cerevisiae KEX2
           Subtilisin-like protease (proprotein convertase)
          Length = 811

 Score = 39.3 bits (90), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 38/85 (44%), Gaps = 11/85 (12%)

Query: 234 YDDDAGKGVTAYVVDTGVNVNHKD----FDGRAVW--GKTIPKDDPDVDGNGHGTHCAGT 287
           Y++  G  V   VVD G++   +D    F     W      P   P +  + HGT CAG 
Sbjct: 155 YENVTGHNVVVAVVDDGLDYESEDLKDNFSAEGSWDFNDNGPMPKPRLSDDYHGTRCAGE 214

Query: 288 IGSVH-----YGVAKNADIVAVKVL 307
           I +V       GVA NA +  +++L
Sbjct: 215 IAAVKNKACGIGVAYNAKVAGIRIL 239

>Ecym_6486 Chr6 complement(941694..944039) [2346 bp, 781 aa] {ON}
           similar to Ashbya gossypii ABL203W
          Length = 781

 Score = 38.9 bits (89), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 43/90 (47%), Gaps = 15/90 (16%)

Query: 234 YDDDAGKGVTAYVVDTGVNVNHKD----FDGRAVW----GKTIPKDDPDVDGNGHGTHCA 285
           Y++  G GV A +VD G++   +D    F     W       +PK  P +  + HGT CA
Sbjct: 154 YNNITGHGVVAAIVDDGLDYESEDLKDNFCAEGSWDFNANTALPK--PILGDDNHGTRCA 211

Query: 286 GTIGSVH-----YGVAKNADIVAVKVLRSN 310
           G I +        GVA NA +  +++L ++
Sbjct: 212 GEIAAAKNKVCGVGVAYNAKVSGIRILSAD 241

>YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}
           KEX2Subtilisin-like protease (proprotein convertase), a
           calcium-dependent serine protease involved in the
           activation of proproteins of the secretory pathway
          Length = 814

 Score = 38.5 bits (88), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 41/88 (46%), Gaps = 16/88 (18%)

Query: 234 YDDDAGKGVTAYVVDTGVNVNHKD----FDGRAVW----GKTIPKDDPDVDGNGHGTHCA 285
           Y++  G GV A +VD G++  ++D    F     W       +PK  P +  + HGT CA
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPK--PRLSDDYHGTRCA 218

Query: 286 GTIGS------VHYGVAKNADIVAVKVL 307
           G I +         GV  NA I  +++L
Sbjct: 219 GEIAAKKGNNFCGVGVGYNAKISGIRIL 246

>Suva_14.106 Chr14 (196428..198857) [2430 bp, 809 aa] {ON} YNL238W
           (REAL)
          Length = 809

 Score = 38.5 bits (88), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 66/258 (25%), Positives = 96/258 (37%), Gaps = 46/258 (17%)

Query: 234 YDDDAGKGVTAYVVDTGVNVNHKD----FDGRAVW----GKTIPKDDPDVDGNGHGTHCA 285
           Y++  G GV A +VD G++  ++D    F     W       +PK  P +  + HGT CA
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPK--PRLSDDYHGTRCA 218

Query: 286 GTIGS------VHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQKKG 339
           G I +         GV  NA I  +++L  +G  T  D    + Y  + +          
Sbjct: 219 GEIAAKKGNDFCGVGVGYNAKISGIRIL--SGEITTEDEAASLIYGLDTNDI-------- 268

Query: 340 FKGSTANMSLGGGKSPALDLAVNAAVKA--------GVHFAVAAGN--ENQDACNTSPAA 389
           +  S      G       DL   A VK         G  +  A+GN     D CN     
Sbjct: 269 YSCSWGPADDGRHLQGPSDLVKKALVKGVTEGRDSKGAIYVFASGNGGARGDNCNYDGYT 328

Query: 390 -AENAITVGASTLSDERAYFSNWGKCVDIF------GPGLNILSTYIGSDTATATLSGTS 442
            +  +IT+GA    D    +S    C  +       G G  I S+ I    + +   GTS
Sbjct: 329 NSIYSITIGAIDHKDLHPPYSE--SCSAVMAVTYSSGSGEYIHSSDINGKCSDSH-GGTS 385

Query: 443 MATPHVVGLLTYFLSLQP 460
            A P   G+ T  L   P
Sbjct: 386 AAAPLAAGVYTLLLEANP 403

>KLLA0D19811g Chr4 complement(1672338..1674608) [2271 bp, 756 aa]
           {ON} uniprot|P09231 Kluyveromyces lactis KLLA0D19811g
           KEX1 protease precursor
          Length = 756

 Score = 38.1 bits (87), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 62/250 (24%), Positives = 95/250 (38%), Gaps = 39/250 (15%)

Query: 239 GKGVTAYVVDTGVNVNHKDF------DGRAVWGKTIPKDDPDVDGNGHGTHCAGTIGSVH 292
           G GV A +VD G++  ++D       +G   +    P   P +  + HGT CAG I +  
Sbjct: 155 GYGVVAALVDDGLDYENEDLKDNFCVEGSWDFNDNNPLPKPRLKDDYHGTRCAGEIAAFR 214

Query: 293 -----YGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQKKGFKGSTANM 347
                 GVA N+ +  +++L  +G  T  D    + Y  + +              +   
Sbjct: 215 NDICGVGVAYNSKVSGIRIL--SGQITAEDEAASLIYGLDVND---------IYSCSWGP 263

Query: 348 SLGGGKSPALDLAVNAAVKAGVH---------FAVAAGNENQ--DACN-TSPAAAENAIT 395
           S  G    A D  V  A+  GV          +  A+GN     D+CN      +  +IT
Sbjct: 264 SDDGKTMQAPDTLVKKAIIKGVTEGRDAKGALYVFASGNGGMFGDSCNFDGYTNSIFSIT 323

Query: 396 VGASTLSDERAYFSNWGKCVDIF----GPGLNILSTYIGSDTATATLSGTSMATPHVVGL 451
           VGA         +S     V +     G G N + T    +  + T  GTS A P   G+
Sbjct: 324 VGAIDWKGLHPPYSESCSAVMVVTYSSGSG-NYIKTTDLDEKCSNTHGGTSAAAPLAAGI 382

Query: 452 LTYFLSLQPD 461
            T  L   P+
Sbjct: 383 YTLVLEANPN 392

>KNAG0F00770 Chr6 (137641..140121) [2481 bp, 826 aa] {ON} Anc_2.6
           YNL238W
          Length = 826

 Score = 38.1 bits (87), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 40/88 (45%), Gaps = 16/88 (18%)

Query: 234 YDDDAGKGVTAYVVDTGVNVNHKD----FDGRAVW----GKTIPKDDPDVDGNGHGTHCA 285
           Y +  G GV   +VD GV+  + D    F     W      T+PK  P +  + HGT CA
Sbjct: 165 YGNVTGSGVVVAIVDDGVDYENPDIADNFCAEGSWDFNDNTTLPK--PRLADDYHGTRCA 222

Query: 286 GTI------GSVHYGVAKNADIVAVKVL 307
           G I      G    GVA N+ +  +++L
Sbjct: 223 GEIAASKNNGFCGIGVAYNSKVSGLRIL 250

>Smik_14.97 Chr14 (181672..184116) [2445 bp, 814 aa] {ON} YNL238W
           (REAL)
          Length = 814

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 41/88 (46%), Gaps = 16/88 (18%)

Query: 234 YDDDAGKGVTAYVVDTGVNVNHKD----FDGRAVW----GKTIPKDDPDVDGNGHGTHCA 285
           Y++  G GV A +VD G++  ++D    F     W       +PK  P +  + HGT CA
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPK--PRLLDDYHGTRCA 218

Query: 286 GTIGS------VHYGVAKNADIVAVKVL 307
           G I +         GV  NA I  +++L
Sbjct: 219 GEIAAKKGNNFCGIGVGYNAKISGIRIL 246

>Kwal_56.24800 s56 complement(1150009..1152420) [2412 bp, 803 aa]
           {ON} YNL238W (KEX2) - Ca2+-dependent serine protease
           [contig 160] FULL
          Length = 803

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 39/87 (44%), Gaps = 15/87 (17%)

Query: 234 YDDDAGKGVTAYVVDTGVNVNHKD----FDGRAVW----GKTIPKDDPDVDGNGHGTHCA 285
           Y++  G  V   VVD G++   +D    F     W       +PK  P +  + HGT CA
Sbjct: 156 YENITGHNVVVAVVDDGLDYESEDLKDNFSAEGSWDFNDNVALPK--PRLSDDYHGTRCA 213

Query: 286 GTIGS-----VHYGVAKNADIVAVKVL 307
           G I +        GVA NA +  +++L
Sbjct: 214 GEIAAGKNQFCGVGVAYNAKVAGLRIL 240

>Kpol_1015.8 s1015
           complement(19725..20576,20692..20940,20990..20998,
           21041..22462) [2532 bp, 843 aa] {ON}
           complement(19725..20576,20692..20940,20990..20998,
           21041..22462) [2532 nt, 844 aa]
          Length = 843

 Score = 34.3 bits (77), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 40/87 (45%), Gaps = 15/87 (17%)

Query: 234 YDDDAGKGVTAYVVDTGVNVNHKD----FDGRAVW----GKTIPKDDPDVDGNGHGTHCA 285
           Y+   GKGV   +VD G++   +D    F     W     + +PK  P +  + HGT CA
Sbjct: 157 YEGITGKGVVVAIVDDGLDYESEDLKDNFCKEGSWDFNENQNLPK--PLLYDDYHGTRCA 214

Query: 286 GTIGSVH-----YGVAKNADIVAVKVL 307
           G I +        GVA  + +  +++L
Sbjct: 215 GEIAAAKNEYCGLGVAYGSKVSGIRIL 241

>ABL203W Chr2 (26256..28562) [2307 bp, 768 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YNL238W (KEX2)
          Length = 768

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 37/82 (45%), Gaps = 15/82 (18%)

Query: 239 GKGVTAYVVDTGVNVNHKD----FDGRAVW----GKTIPKDDPDVDGNGHGTHCAGTIGS 290
           G G+   VVD G++   +D    F     W       +PK  P +  + HGT CAG I +
Sbjct: 156 GHGIVVAVVDDGLDYESEDLKDNFCAEGSWDFNSNTALPK--PMLSDDTHGTRCAGEIAA 213

Query: 291 VH-----YGVAKNADIVAVKVL 307
                   GVA N+ +  +++L
Sbjct: 214 AKNQFCGLGVAFNSKVSGIRIL 235

>TPHA0A01400 Chr1 complement(274602..275294) [693 bp, 230 aa] {ON}
           Anc_8.360 YDR167W
          Length = 230

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 1/45 (2%)

Query: 458 LQPDADSEYFHAAGGITPSQLK-KKLIDFSTKNVLSDLPEDTVNY 501
           L PDA  EY+    GI  S L+ K+L+  +T+  +SD+  D   Y
Sbjct: 117 LIPDAVIEYYMTKNGIECSDLRVKRLLALATQKFISDIASDAYEY 161

>TPHA0H03000 Chr8 (718160..718903) [744 bp, 247 aa] {ON} Anc_7.18
           YAL049C
          Length = 247

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 12/67 (17%)

Query: 117 HQELVSVEHAKALG------SLADNDPFFTATSGEHSEFGVK------AHSLEGGIQDSF 164
           H   VS+E  +A+G      S A+NDP F+  S   +E  +K         L GG++  F
Sbjct: 155 HPSFVSMEELEAIGKNPILISAAENDPIFSEESRHATEAKLKEIGANYVMDLFGGVEHGF 214

Query: 165 DIAGSLS 171
            + G LS
Sbjct: 215 AVRGDLS 221

>NDAI0K02490 Chr11 complement(554669..555802) [1134 bp, 377 aa] {ON}
           
          Length = 377

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 47/89 (52%), Gaps = 10/89 (11%)

Query: 444 ATPHVVGLLTYFLSL-QPDADSEYFHAAGGITPSQLKKKLIDFSTKNVLSDLPEDTVNY- 501
           ++PH + L+ Y     QP  + +   A G      L+KK+ +F TKN+ S+  E TV   
Sbjct: 10  SSPHGLPLIEYHEKFKQPSKEKK--KAYGT---DSLRKKIFNFFTKNIPSEEREKTVTKK 64

Query: 502 -LIYNGGGQD--LDDLWGKDYSIGKEPSA 527
            L+ N GG+D  LDD +    S GK+ S+
Sbjct: 65  ALLENPGGKDFILDDPFIFILSQGKKISS 93

>Kpol_1050.72 s1050 complement(157470..160439) [2970 bp, 989 aa]
           {ON} complement(157470..160439) [2970 nt, 990 aa]
          Length = 989

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%)

Query: 339 GFKGSTANMSLGGGKSPALDLAVNAAVKAGVHF 371
           G K   A M+  GG SP ++ AV A V+AG+H+
Sbjct: 204 GIKKKLAVMT-SGGDSPGMNAAVRAVVRAGIHY 235

>TPHA0G01620 Chr7 complement(334221..335699) [1479 bp, 492 aa] {ON}
           Anc_8.669 YOR241W
          Length = 492

 Score = 31.6 bits (70), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 47/107 (43%), Gaps = 8/107 (7%)

Query: 38  IKDHASSDLDKPQHHANGKARSKSRGRCADSKKFDKLRPVD---DASAILAPLSTVNDIA 94
           IK  ++ D   P     G   S+  GRC   K+  +   +D    A +I A      DIA
Sbjct: 302 IKPISARDATIPAKFIKGLKASRWEGRCQTLKENGRNWYIDGAHTADSINAASEWFKDIA 361

Query: 95  NKIPNRYIIVFKKDASADEVKFHQELVSVEHAKALGSLADNDPFFTA 141
            K PN+ +++F + A     +  + LV+  H K    +  ++  FT+
Sbjct: 362 IKSPNKKVLLFNQQA-----RDAKALVNYIHEKLYPEIQFDEVIFTS 403

>NCAS0F03050 Chr6 (607255..611625) [4371 bp, 1456 aa] {ON} Anc_5.383
          Length = 1456

 Score = 32.0 bits (71), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 33/61 (54%), Gaps = 3/61 (4%)

Query: 98  PNRYIIVFKKDASADEVKFHQELVSVE--HAKALGSLADNDPFFTATSGEHSEFGVKAHS 155
           PN+ +   ++D    E+KF  +L++ E  H K   SL + DP +   S  +S+F +K + 
Sbjct: 9   PNKKVSQLERDEKVAELKFQYDLLTNELYHLKEFVSLFEFDPTYANESEAYSKF-IKENK 67

Query: 156 L 156
           L
Sbjct: 68  L 68

>TDEL0G01090 Chr7 (223036..225987) [2952 bp, 983 aa] {ON} Anc_5.85
           YGR240C
          Length = 983

 Score = 31.6 bits (70), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 24/49 (48%)

Query: 325 VAEAHKKAVEEQKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAV 373
           V  A+ + + +   G K     +   GG SP ++ AV A V+ G+HF  
Sbjct: 184 VQSANAEILRQTLSGQKKKKIAVMTSGGDSPGMNAAVRAVVRTGIHFGC 232

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.131    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 61,772,497
Number of extensions: 2885018
Number of successful extensions: 6534
Number of sequences better than 10.0: 99
Number of HSP's gapped: 6511
Number of HSP's successfully gapped: 103
Length of query: 561
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 446
Effective length of database: 40,294,809
Effective search space: 17971484814
Effective search space used: 17971484814
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 68 (30.8 bits)