Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D00902g6.13ON49249226190.0
SAKL0E00946g6.13ON49349122570.0
KLTH0C11462g6.13ON49246022060.0
TDEL0G045806.13ON48449122010.0
Kwal_56.223626.13ON49346122000.0
Ecym_30166.13ON48948721840.0
ACR013C6.13ON48846221700.0
CAGL0A01045g6.13ON48346621410.0
Kpol_1032.46.13ON46746021320.0
TPHA0J002706.13ON49649520680.0
Kpol_1045.766.13ON48546020530.0
NCAS0D026206.13ON49349020490.0
ZYRO0C07964g6.13ON50549820490.0
YPL262W (FUM1)6.13ON48849220350.0
KNAG0E027506.13ON49849720350.0
Suva_16.436.13ON48849220330.0
Smik_6.4706.13ON48849220310.0
Skud_16.166.13ON48849220280.0
KAFR0B065206.13ON49547920270.0
TBLA0G010006.13ON46546519390.0
NDAI0I024706.13ON47546219370.0
TBLA0A071306.13ON50045918740.0
SAKL0D09746g1.354ON4642381125e-05
KLLA0A08404g1.354ON4612281125e-05
AEL019W1.354ON4692971116e-05
KNAG0I015601.354ON4622441099e-05
Ecym_27491.354ON4702891091e-04
Kpol_1018.1251.354ON4602451081e-04
Suva_15.2011.354ON4632391062e-04
Skud_8.701.354ON4632391053e-04
NCAS0A090101.354ON4622381053e-04
NDAI0G059401.354ON4622431044e-04
Smik_8.831.354ON4632391044e-04
YHR018C (ARG4)1.354ON4632391035e-04
CAGL0I08987g1.354ON4612861027e-04
TPHA0A021901.354ON4632411010.001
ZYRO0G00748g1.354ON4622451000.001
Kwal_27.127821.354ON465264980.002
TBLA0F034801.354ON466237970.003
Ecym_24524.197ON482209940.006
CAGL0B02794g4.197ON482230930.008
YLR359W (ADE13)4.197ON482224920.011
KLTH0G19338g1.354ON465249910.014
Smik_12.4464.197ON482224910.014
TDEL0D022201.354ON465241910.016
SAKL0B04972g4.197ON482230890.029
TPHA0B010404.197ON482232890.030
Suva_10.4594.197ON482186880.032
Skud_12.4434.197ON482224850.080
NDAI0J019504.197ON482232830.14
KLLA0B13189g4.197ON482183830.14
Kwal_47.180664.197ON482227830.14
Kpol_1042.164.197ON482232820.17
TBLA0A083204.197ON482213810.23
NCAS0J012004.197ON482230810.25
KNAG0B058404.197ON482230810.26
KLTH0A03344g4.197ON482192790.44
KAFR0A062304.197ON482168790.45
TDEL0E017604.197ON482230760.99
ZYRO0B07964g4.197ON482186761.0
Kpol_543.286.91ON29550741.3
Kwal_23.40023.426ON121294741.9
KLLA0D15081g3.438ON1010115688.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D00902g
         (492 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly s...  1013   0.0  
SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly s...   874   0.0  
KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {...   854   0.0  
TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {O...   852   0.0  
Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W ...   852   0.0  
Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to ...   845   0.0  
ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON} S...   840   0.0  
CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {...   829   0.0  
Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..516...   825   0.0  
TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13...   801   0.0  
Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa] ...   795   0.0  
NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {O...   793   0.0  
ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {...   793   0.0  
YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumaras...   788   0.0  
KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.1...   788   0.0  
Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W (...   787   0.0  
Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON...   786   0.0  
Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W (...   785   0.0  
KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6...   785   0.0  
TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.1...   751   0.0  
NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {O...   750   0.0  
TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6...   726   0.0  
SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {...    48   5e-05
KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {...    48   5e-05
AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic ho...    47   6e-05
KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.3...    47   9e-05
Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {O...    47   1e-04
Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa]...    46   1e-04
Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {...    45   2e-04
Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}...    45   3e-04
NCAS0A09010 Chr1 complement(1783858..1785246) [1389 bp, 462 aa] ...    45   3e-04
NDAI0G05940 Chr7 (1470741..1472129) [1389 bp, 462 aa] {ON} Anc_1...    45   4e-04
Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}...    45   4e-04
YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}  ...    44   5e-04
CAGL0I08987g Chr9 complement(871699..873084) [1386 bp, 461 aa] {...    44   7e-04
TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.3...    44   0.001
ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly s...    43   0.001
Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa]...    42   0.002
TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.3...    42   0.003
Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar t...    41   0.006
CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {...    40   0.008
YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}  ADE13Aden...    40   0.011
KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa]...    40   0.014
Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359...    40   0.014
TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.3...    40   0.016
SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly...    39   0.029
TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {O...    39   0.030
Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359...    39   0.032
Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359...    37   0.080
NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4....    37   0.14 
KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa]...    37   0.14 
Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359...    37   0.14 
Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON} (40749....    36   0.17 
TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa] ...    36   0.23 
NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4....    36   0.25 
KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON} Anc_4...    36   0.26 
KLTH0A03344g Chr1 (289188..290636) [1449 bp, 482 aa] {ON} highly...    35   0.44 
KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa] ...    35   0.45 
TDEL0E01760 Chr5 complement(337315..338763) [1449 bp, 482 aa] {O...    34   0.99 
ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {...    34   1.0  
Kpol_543.28 s543 complement(57467..58354) [888 bp, 295 aa] {ON} ...    33   1.3  
Kwal_23.4002 s23 complement(521323..524961) [3639 bp, 1212 aa] {...    33   1.9  
KLLA0D15081g Chr4 (1271696..1274728) [3033 bp, 1010 aa] {ON} som...    31   8.8  

>KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly
           similar to uniprot|P08417 Saccharomyces cerevisiae
           YPL262W FUM1 Fumarase converts fumaric acid to L-malic
           acid in the TCA cycle cytosolic and mitochondrial
           localization determined by the N-terminal mitochondrial
           targeting sequence and protein conformation
          Length = 492

 Score = 1013 bits (2619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/492 (100%), Positives = 492/492 (100%)

Query: 1   MLRNSIVSRGLAQTRVSAKVNRLASLRMVSYRVETDAFGEIQVPSDKYWGAQTQRSLQNF 60
           MLRNSIVSRGLAQTRVSAKVNRLASLRMVSYRVETDAFGEIQVPSDKYWGAQTQRSLQNF
Sbjct: 1   MLRNSIVSRGLAQTRVSAKVNRLASLRMVSYRVETDAFGEIQVPSDKYWGAQTQRSLQNF 60

Query: 61  KIGGPRERMPEPIVKAFGVLKKSAAVVNERLGTLDPEIAKPIKQAADEVAQGKLMEHFPL 120
           KIGGPRERMPEPIVKAFGVLKKSAAVVNERLGTLDPEIAKPIKQAADEVAQGKLMEHFPL
Sbjct: 61  KIGGPRERMPEPIVKAFGVLKKSAAVVNERLGTLDPEIAKPIKQAADEVAQGKLMEHFPL 120

Query: 121 VVFQTGSGTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAA 180
           VVFQTGSGTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAA
Sbjct: 121 VVFQTGSGTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAA 180

Query: 181 VTEITHHLLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGI 240
           VTEITHHLLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGI
Sbjct: 181 VTEITHHLLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGI 240

Query: 241 ARVKQSLYHLKFLAQGGTAVGTGLNTKVGFAEDIAEQVSKETGIDFKTAPNKFEALAAHD 300
           ARVKQSLYHLKFLAQGGTAVGTGLNTKVGFAEDIAEQVSKETGIDFKTAPNKFEALAAHD
Sbjct: 241 ARVKQSLYHLKFLAQGGTAVGTGLNTKVGFAEDIAEQVSKETGIDFKTAPNKFEALAAHD 300

Query: 301 AVVEASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA 360
           AVVEASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA
Sbjct: 301 AVVEASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA 360

Query: 361 MTQVCVQVMGNHAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDASNSFRIHCVEGIK 420
           MTQVCVQVMGNHAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDASNSFRIHCVEGIK
Sbjct: 361 MTQVCVQVMGNHAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDASNSFRIHCVEGIK 420

Query: 421 ANEDRIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLSSEEFDQ 480
           ANEDRIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLSSEEFDQ
Sbjct: 421 ANEDRIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLSSEEFDQ 480

Query: 481 WVIPEKMIGPKE 492
           WVIPEKMIGPKE
Sbjct: 481 WVIPEKMIGPKE 492

>SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly
           similar to uniprot|P08417 Saccharomyces cerevisiae
           YPL262W FUM1 Fumarase converts fumaric acid to L-malic
           acid in the TCA cycle cytosolic and mitochondrial
           localization determined by the N-terminal mitochondrial
           targeting sequence and protein conformation
          Length = 493

 Score =  874 bits (2257), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/491 (85%), Positives = 454/491 (92%), Gaps = 13/491 (2%)

Query: 15  RVSAKVNR----LASLRMVS---------YRVETDAFGEIQVPSDKYWGAQTQRSLQNFK 61
           R++A  NR     +S+RM+S         YR+ETDAFGEI+VP+DKYWGAQTQRS +NFK
Sbjct: 3   RITAAANRNLLPSSSIRMLSTSSSLAQQKYRIETDAFGEIKVPADKYWGAQTQRSFENFK 62

Query: 62  IGGPRERMPEPIVKAFGVLKKSAAVVNERLGTLDPEIAKPIKQAADEVAQGKLMEHFPLV 121
           IGG RERMPE +V+AFGVLKKSAA+VNE LGTLDPEI+KPI++AADEV QGKLM+HFPLV
Sbjct: 63  IGGARERMPEAVVRAFGVLKKSAAIVNESLGTLDPEISKPIQKAADEVIQGKLMDHFPLV 122

Query: 122 VFQTGSGTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAV 181
           VFQTGSGTQSNMNANEVISNRAIE+IGGE GSK++HPNNHCNQAQSSNDTFPSVMHIAAV
Sbjct: 123 VFQTGSGTQSNMNANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAV 182

Query: 182 TEITHHLLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIA 241
           TEITH LLPEL  L+ + ++KSDEF  IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGIA
Sbjct: 183 TEITHSLLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIA 242

Query: 242 RVKQSLYHLKFLAQGGTAVGTGLNTKVGFAEDIAEQVSKETGIDFKTAPNKFEALAAHDA 301
           RV+QSL+HLKFLAQGGTAVGTGLNTKVGFAE IAEQVSKETGIDFKTAPNKFEALAAHDA
Sbjct: 243 RVEQSLHHLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDA 302

Query: 302 VVEASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAM 361
           VVE SGALNTLA SLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAM
Sbjct: 303 VVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAM 362

Query: 362 TQVCVQVMGNHAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDASNSFRIHCVEGIKA 421
           TQVCVQVMGN+AAITFAGASGQFELNVFKPVMISNLLSS+RLL DAS SFR+HCV+GIKA
Sbjct: 363 TQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGIKA 422

Query: 422 NEDRIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLSSEEFDQW 481
           NEDRI+KLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESAL+L VL+ +EFD+W
Sbjct: 423 NEDRISKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALQLGVLNEKEFDEW 482

Query: 482 VIPEKMIGPKE 492
           VIPEKMIGPKE
Sbjct: 483 VIPEKMIGPKE 493

>KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262W FUM1 Fumarase converts fumaric acid
           to L-malic acid in the TCA cycle cytosolic and
           mitochondrial localization determined by the N-terminal
           mitochondrial targeting sequence and protein
           conformation
          Length = 492

 Score =  854 bits (2206), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/460 (87%), Positives = 434/460 (94%)

Query: 32  RVETDAFGEIQVPSDKYWGAQTQRSLQNFKIGGPRERMPEPIVKAFGVLKKSAAVVNERL 91
           RVETDAFGEI VP+DKYWGAQTQRSL+NFKIGG RERMPEP+V+AFG+LKKSAA+VNE L
Sbjct: 33  RVETDAFGEINVPADKYWGAQTQRSLENFKIGGARERMPEPVVRAFGILKKSAAIVNESL 92

Query: 92  GTLDPEIAKPIKQAADEVAQGKLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGEL 151
           GTLDP+I+KPI+QAADEV  GKL++HFPLVVFQTGSGTQSNMNANEVISNRAIE++GG++
Sbjct: 93  GTLDPKISKPIQQAADEVISGKLVDHFPLVVFQTGSGTQSNMNANEVISNRAIEIVGGKM 152

Query: 152 GSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHHLLPELEGLKVALKQKSDEFQHIVK 211
           G+K IHPNNHCNQAQSSNDTFPSVMHIAAVTEITH LLPEL  L+ +   KS EF+ IVK
Sbjct: 153 GTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFATKSKEFESIVK 212

Query: 212 IGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSLYHLKFLAQGGTAVGTGLNTKVGFA 271
           IGRTHLQDATPLTLGQEFSGYVQQ+ NGI+RV+QSL HLKFLAQGGTAVGTGLNTKVGF 
Sbjct: 213 IGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLAQGGTAVGTGLNTKVGFG 272

Query: 272 EDIAEQVSKETGIDFKTAPNKFEALAAHDAVVEASGALNTLAVSLFKIANDIRYLGSGPR 331
           E IAEQVSKETGIDFKTAPNKFEALAAHDA+VE SGALNTLA SLFKIANDIRYLGSGPR
Sbjct: 273 EKIAEQVSKETGIDFKTAPNKFEALAAHDAIVECSGALNTLACSLFKIANDIRYLGSGPR 332

Query: 332 CGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNHAAITFAGASGQFELNVFKP 391
           CGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN+AAITFAGASGQFELNVFKP
Sbjct: 333 CGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFKP 392

Query: 392 VMISNLLSSIRLLGDASNSFRIHCVEGIKANEDRIAKLLHESLMLVTALNPKIGYDAASK 451
           VMISNLLSS+RLLGDA  SFR+HCV+GI+AN D+IAKLLHESLMLVTALNPKIGYDAASK
Sbjct: 393 VMISNLLSSVRLLGDACYSFRVHCVDGIEANRDKIAKLLHESLMLVTALNPKIGYDAASK 452

Query: 452 VAKNAHKKGITLKESALELKVLSSEEFDQWVIPEKMIGPK 491
           VAKNAHKKGITLKESALELKVL+S EFDQWV+PE M+GPK
Sbjct: 453 VAKNAHKKGITLKESALELKVLTSAEFDQWVVPENMVGPK 492

>TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {ON}
           Anc_6.13 YPL262W
          Length = 484

 Score =  852 bits (2201), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/491 (83%), Positives = 446/491 (90%), Gaps = 8/491 (1%)

Query: 1   MLRNSIVSRGLAQTRVSAKVNRLASLRMVSYRVETDAFGEIQVPSDKYWGAQTQRSLQNF 60
           MLR  ++SR L+  ++S K  +        +RVETDAFGEI+V +D+YWGAQTQRSL+NF
Sbjct: 1   MLRTGLLSRPLSVVKMSTKAGQ--------FRVETDAFGEIKVAADRYWGAQTQRSLENF 52

Query: 61  KIGGPRERMPEPIVKAFGVLKKSAAVVNERLGTLDPEIAKPIKQAADEVAQGKLMEHFPL 120
           +IGGPRERMPEPIV+AFGVLKKSAAVVNE LGTLDP++A+PIKQAADEVAQGKL  HFPL
Sbjct: 53  RIGGPRERMPEPIVRAFGVLKKSAAVVNESLGTLDPKVAEPIKQAADEVAQGKLTAHFPL 112

Query: 121 VVFQTGSGTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAA 180
           VVFQTGSGTQSNMNANEVISNRAIELIGGELGSK+IHPNNHCNQAQSSNDTFPSVMHIAA
Sbjct: 113 VVFQTGSGTQSNMNANEVISNRAIELIGGELGSKQIHPNNHCNQAQSSNDTFPSVMHIAA 172

Query: 181 VTEITHHLLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGI 240
           VTEIT HLLPEL  L+ +L  KS EF  IVKIGRTHLQDATPLTLGQEFSGYVQQV NGI
Sbjct: 173 VTEITRHLLPELAHLRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGI 232

Query: 241 ARVKQSLYHLKFLAQGGTAVGTGLNTKVGFAEDIAEQVSKETGIDFKTAPNKFEALAAHD 300
            RV+ SL+ LK+LAQGGTAVGTGLNTK+GFAE IAEQVSKETG+DFKTAPNKFEALAAHD
Sbjct: 233 DRVEGSLHRLKYLAQGGTAVGTGLNTKIGFAEKIAEQVSKETGLDFKTAPNKFEALAAHD 292

Query: 301 AVVEASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA 360
           AVVEASGALNT+A SLFKIA DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA
Sbjct: 293 AVVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA 352

Query: 361 MTQVCVQVMGNHAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDASNSFRIHCVEGIK 420
           +TQVCVQVMGN+AAITFAGASGQFELNVFKPVMISNLLSS+RLL DAS SFR+HCV+GI 
Sbjct: 353 LTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGII 412

Query: 421 ANEDRIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLSSEEFDQ 480
           AN DRI KL+HESLMLVTALNPKIGYDAASKVAKNAHKKGITLK+SAL+L VL+  EFD+
Sbjct: 413 ANRDRIGKLMHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKQSALDLGVLTESEFDE 472

Query: 481 WVIPEKMIGPK 491
           WV+PE MIGPK
Sbjct: 473 WVVPENMIGPK 483

>Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W
           (FUM1) - mitochondrial and cytoplasmic fumarase
           (fumarate hydralase) [contig 186] FULL
          Length = 493

 Score =  852 bits (2200), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/461 (87%), Positives = 435/461 (94%)

Query: 31  YRVETDAFGEIQVPSDKYWGAQTQRSLQNFKIGGPRERMPEPIVKAFGVLKKSAAVVNER 90
           YRVETDAFGEI+VP+DK WGAQTQRSL+NFKIGG RERMPEPIVKAFG+LKKSAA+VNE 
Sbjct: 32  YRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEPIVKAFGILKKSAAIVNES 91

Query: 91  LGTLDPEIAKPIKQAADEVAQGKLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGE 150
           LGTLDP+++KPI+ AADEV  GKL++HFPLVVFQTGSGTQSNMNANEVISNRAI+L+GGE
Sbjct: 92  LGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSNMNANEVISNRAIQLVGGE 151

Query: 151 LGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHHLLPELEGLKVALKQKSDEFQHIV 210
           +GSK IHPNNHCNQAQSSNDTFPSVMHIAAVTE+TH LLPEL  L+ A  +K+ EF  IV
Sbjct: 152 VGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKKAQEFDSIV 211

Query: 211 KIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSLYHLKFLAQGGTAVGTGLNTKVGF 270
           KIGRTHLQDATPLTLGQEFSGYVQQ+ NGI+RV+ SL++LKFLAQGGTAVGTGLNTKVGF
Sbjct: 212 KIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVGTGLNTKVGF 271

Query: 271 AEDIAEQVSKETGIDFKTAPNKFEALAAHDAVVEASGALNTLAVSLFKIANDIRYLGSGP 330
           AE IAEQVSKETGIDFKTAPNKFEALAAHDAVVE SGALNTLA SLFKIANDIRYLGSGP
Sbjct: 272 AEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGP 331

Query: 331 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNHAAITFAGASGQFELNVFK 390
           RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN+AAITFAGASGQFELNVFK
Sbjct: 332 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 391

Query: 391 PVMISNLLSSIRLLGDASNSFRIHCVEGIKANEDRIAKLLHESLMLVTALNPKIGYDAAS 450
           PVMISNLLSSIRLLGDA  SFR+HCVEGI+ANED+IAKLLHESLMLVTALNPKIGYDAAS
Sbjct: 392 PVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLLHESLMLVTALNPKIGYDAAS 451

Query: 451 KVAKNAHKKGITLKESALELKVLSSEEFDQWVIPEKMIGPK 491
           KVAKNAHKKGITLKESALEL VLSS EFD+WV+PE M+GPK
Sbjct: 452 KVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGPK 492

>Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to
           Ashbya gossypii ACR013C
          Length = 489

 Score =  845 bits (2184), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/487 (82%), Positives = 447/487 (91%), Gaps = 11/487 (2%)

Query: 12  AQTRVSAKVNRLASLRMVS--------YRVETDAFGEIQVPSDKYWGAQTQRSLQNFKIG 63
           A  ++ AK  R+A  RM+S        +R+ETDAFGEI+VP++KYWGAQTQRSL+NFKIG
Sbjct: 4   ASKKIPAK--RIAD-RMMSTTAGLNQKFRIETDAFGEIKVPANKYWGAQTQRSLENFKIG 60

Query: 64  GPRERMPEPIVKAFGVLKKSAAVVNERLGTLDPEIAKPIKQAADEVAQGKLMEHFPLVVF 123
           GPRERMPEPI+KAFG+LKKSAA+VNE LGTLDP+I+KPI+QAADEV +GKL++HFPLVVF
Sbjct: 61  GPRERMPEPIIKAFGILKKSAAIVNESLGTLDPKISKPIQQAADEVIEGKLLDHFPLVVF 120

Query: 124 QTGSGTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTE 183
           QTGSGTQSNMNANEVISNRAIELIGGELG+K+IHPNNHCNQAQSSNDTFPSVMHIAAVTE
Sbjct: 121 QTGSGTQSNMNANEVISNRAIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTE 180

Query: 184 ITHHLLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIARV 243
           IT+ LLPEL  L+ + ++K++EF HIVKIGRTHLQDATPLTLGQEF GY QQ+ NGI RV
Sbjct: 181 ITNTLLPELTALRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRV 240

Query: 244 KQSLYHLKFLAQGGTAVGTGLNTKVGFAEDIAEQVSKETGIDFKTAPNKFEALAAHDAVV 303
           +QSL+HLKFLAQGGTAVGTGLNTKVGFAE IAEQVSKET I+FKTAPNKFEALAAHDAVV
Sbjct: 241 EQSLHHLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVV 300

Query: 304 EASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQ 363
           E SGALNT+A SLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQ
Sbjct: 301 ECSGALNTVACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQ 360

Query: 364 VCVQVMGNHAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDASNSFRIHCVEGIKANE 423
            CVQVMGN++ ITFAGASGQFELNVFKPVMISNLL+SIRLL DAS SFR+HCV+GIKANE
Sbjct: 361 ACVQVMGNNSTITFAGASGQFELNVFKPVMISNLLNSIRLLADASYSFRVHCVDGIKANE 420

Query: 424 DRIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLSSEEFDQWVI 483
           D+IAK+LHESLMLVTALNPKIGYD+A KVAKNAHKK ITLKESALEL VLS EEF +WV+
Sbjct: 421 DKIAKILHESLMLVTALNPKIGYDSACKVAKNAHKKNITLKESALELGVLSEEEFSEWVV 480

Query: 484 PEKMIGP 490
           PEKMIGP
Sbjct: 481 PEKMIGP 487

>ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL262W
           (FUM1)
          Length = 488

 Score =  840 bits (2170), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/462 (85%), Positives = 435/462 (94%)

Query: 31  YRVETDAFGEIQVPSDKYWGAQTQRSLQNFKIGGPRERMPEPIVKAFGVLKKSAAVVNER 90
           +RVETDAFGEI+VP+DKYWGAQTQRSL+NF+IGG RERMPEP+V+AFGVLKKSAAVVNE+
Sbjct: 27  FRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARERMPEPVVRAFGVLKKSAAVVNEQ 86

Query: 91  LGTLDPEIAKPIKQAADEVAQGKLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGE 150
           LGTL+P IAK I+QAADEVAQG+LMEHFPLVVFQTGSGTQSNMNANEVISNRAIEL+GGE
Sbjct: 87  LGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGE 146

Query: 151 LGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHHLLPELEGLKVALKQKSDEFQHIV 210
           LGSK++HPNNHCNQAQSSNDTFPSVMHIAAVTEIT  LLPELE L+V+ ++K+DEF HIV
Sbjct: 147 LGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEALRVSFQRKTDEFAHIV 206

Query: 211 KIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSLYHLKFLAQGGTAVGTGLNTKVGF 270
           KIGRTHLQDATPLTLGQEFSGY QQ+ NGIARV+ +   L+FLAQGGTAVGTGLNT+ GF
Sbjct: 207 KIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGTAVGTGLNTRRGF 266

Query: 271 AEDIAEQVSKETGIDFKTAPNKFEALAAHDAVVEASGALNTLAVSLFKIANDIRYLGSGP 330
           AE IA QVS+ETG++F+TAPNKFEALAAHDAVVEASGALNTLA SLFKIANDIRYLGSGP
Sbjct: 267 AEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFKIANDIRYLGSGP 326

Query: 331 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNHAAITFAGASGQFELNVFK 390
           RCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQ CVQVMGN+AAITFAGASGQFELNVFK
Sbjct: 327 RCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAAITFAGASGQFELNVFK 386

Query: 391 PVMISNLLSSIRLLGDASNSFRIHCVEGIKANEDRIAKLLHESLMLVTALNPKIGYDAAS 450
           PVMI+NLLSS+RLL DA+ SFR+HCV+GI+ NEDRIAKLLHESLMLVTALNPKIGYDAAS
Sbjct: 387 PVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAKLLHESLMLVTALNPKIGYDAAS 446

Query: 451 KVAKNAHKKGITLKESALELKVLSSEEFDQWVIPEKMIGPKE 492
            VAKNAHKKGITL+ SALEL VL+  EFD+WV+PEKMIGP++
Sbjct: 447 AVAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMIGPRD 488

>CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262w FUM1 fumarate hydratase
          Length = 483

 Score =  829 bits (2141), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/466 (85%), Positives = 432/466 (92%)

Query: 25  SLRMVSYRVETDAFGEIQVPSDKYWGAQTQRSLQNFKIGGPRERMPEPIVKAFGVLKKSA 84
           S RM+ YRVETD FGEI+VP+DKYWGAQTQRS QNFKIGG RERMPEPIV+AFGVLKKSA
Sbjct: 16  SARMMHYRVETDTFGEIKVPADKYWGAQTQRSFQNFKIGGARERMPEPIVRAFGVLKKSA 75

Query: 85  AVVNERLGTLDPEIAKPIKQAADEVAQGKLMEHFPLVVFQTGSGTQSNMNANEVISNRAI 144
           A+VNE+LGTLD EIA PI+QAADEVA+GKL +HFPLVVFQTGSGTQSNMNANEVISNRAI
Sbjct: 76  AIVNEKLGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAI 135

Query: 145 ELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHHLLPELEGLKVALKQKSD 204
           ELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEIT+ LLPE+  LK AL +K++
Sbjct: 136 ELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEITQLKDALHKKAE 195

Query: 205 EFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSLYHLKFLAQGGTAVGTGL 264
           EFQ IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGIAR++ +L HLK+LAQGGTAVGTGL
Sbjct: 196 EFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKYLAQGGTAVGTGL 255

Query: 265 NTKVGFAEDIAEQVSKETGIDFKTAPNKFEALAAHDAVVEASGALNTLAVSLFKIANDIR 324
           NTK GF + IAEQ+SKETGIDFKTAPNKFEALAAHDA+VEASGALNT+A SLFKIA DIR
Sbjct: 256 NTKEGFDKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIR 315

Query: 325 YLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNHAAITFAGASGQF 384
           YLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN+AA+TFAGA+GQF
Sbjct: 316 YLGSGPRCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGANGQF 375

Query: 385 ELNVFKPVMISNLLSSIRLLGDASNSFRIHCVEGIKANEDRIAKLLHESLMLVTALNPKI 444
           ELNVFKPVMISNLLSSIRLL DA +SFR+HCVEGI+AN ++I   LH SLMLVTALNPKI
Sbjct: 376 ELNVFKPVMISNLLSSIRLLADACHSFRVHCVEGIEANREKINHNLHNSLMLVTALNPKI 435

Query: 445 GYDAASKVAKNAHKKGITLKESALELKVLSSEEFDQWVIPEKMIGP 490
           GYDAASK+AKNA KK ITLKESALELK L+SEEFD+WVIPE M+GP
Sbjct: 436 GYDAASKIAKNAFKKNITLKESALELKYLTSEEFDEWVIPENMVGP 481

>Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..5164)
           [1404 nt, 468 aa]
          Length = 467

 Score =  825 bits (2132), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/460 (85%), Positives = 430/460 (93%)

Query: 31  YRVETDAFGEIQVPSDKYWGAQTQRSLQNFKIGGPRERMPEPIVKAFGVLKKSAAVVNER 90
           +R+ETD FGEI+VP+DKYWGAQTQRS +NFKIGGPRERMPEP+VKAFGVLKKSAA+VNE 
Sbjct: 7   FRLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAAIVNEE 66

Query: 91  LGTLDPEIAKPIKQAADEVAQGKLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGE 150
            G LD  I+K I+QAADEV +GKL EHFPLVVFQTGSGTQSNMNANEVISNRAIEL GG 
Sbjct: 67  FGILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGI 126

Query: 151 LGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHHLLPELEGLKVALKQKSDEFQHIV 210
           +GSK+IHPNNHCN AQSSNDTFP+VMHIAAVTEITHHL+P++  LK AL  KS EF+HIV
Sbjct: 127 MGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIV 186

Query: 211 KIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSLYHLKFLAQGGTAVGTGLNTKVGF 270
           KIGRTHLQDATPLTLGQEFSGYVQQ+ NGIAR++ SL +LKFLAQGGTAVGTGLNTK+GF
Sbjct: 187 KIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTKIGF 246

Query: 271 AEDIAEQVSKETGIDFKTAPNKFEALAAHDAVVEASGALNTLAVSLFKIANDIRYLGSGP 330
           AE IAEQVSKETGI+FKTAPNKFEALAAHDA+VE+SGALNT+A SLFKIA DIRYLGSGP
Sbjct: 247 AERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGP 306

Query: 331 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNHAAITFAGASGQFELNVFK 390
           RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN+AAITFAGASGQFELNVFK
Sbjct: 307 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 366

Query: 391 PVMISNLLSSIRLLGDASNSFRIHCVEGIKANEDRIAKLLHESLMLVTALNPKIGYDAAS 450
           PVMISNLLSSIRLLGDA +SF IHCVEGI+ANED+I KLLHESLMLVTALNPKIGYD+A+
Sbjct: 367 PVMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIGYDSAT 426

Query: 451 KVAKNAHKKGITLKESALELKVLSSEEFDQWVIPEKMIGP 490
           KVAKNAHKKGITLKESALEL VL+ +EFD+WV+PEKM+GP
Sbjct: 427 KVAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGP 466

>TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13
           YPL262W
          Length = 496

 Score =  801 bits (2068), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/495 (76%), Positives = 436/495 (88%), Gaps = 6/495 (1%)

Query: 1   MLRNSIVSRGLAQTRVSAKVNRLASLRMVS----YRVETDAFGEIQVPSDKYWGAQTQRS 56
           ++RN  V RG+       K     S+R +S    +R+ETD FGEI+VP++KYWGAQT+RS
Sbjct: 4   VIRN--VPRGVKSVAKVQKTGMHQSMRCLSDEAGFRIETDGFGEIKVPANKYWGAQTERS 61

Query: 57  LQNFKIGGPRERMPEPIVKAFGVLKKSAAVVNERLGTLDPEIAKPIKQAADEVAQGKLME 116
            +NF+IGGPRERMP+P+VKAFGVLKKSAA+VNE  GTLDP+I+K I++AADEV QGKL +
Sbjct: 62  FENFRIGGPRERMPDPVVKAFGVLKKSAAIVNEGYGTLDPQISKVIQEAADEVIQGKLND 121

Query: 117 HFPLVVFQTGSGTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVM 176
           HFPLVVFQTGSGTQSNMNANEVISNRAIEL+GG LGSK++HPNNH NQAQSSND+FP+VM
Sbjct: 122 HFPLVVFQTGSGTQSNMNANEVISNRAIELLGGTLGSKQVHPNNHVNQAQSSNDSFPTVM 181

Query: 177 HIAAVTEITHHLLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQV 236
           HIAAVTEIT HL+PE+  L+ AL+ KS +F HIVKIGRTHLQDATPLTLGQEFSGYVQQ+
Sbjct: 182 HIAAVTEITDHLIPEVANLRDALESKSKDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQL 241

Query: 237 ENGIARVKQSLYHLKFLAQGGTAVGTGLNTKVGFAEDIAEQVSKETGIDFKTAPNKFEAL 296
            NGI R++ SL +LKFLAQGGTAVGTGLNT++GFAE IAEQ+SKETG+ FKTAPNKFEAL
Sbjct: 242 TNGIGRIEHSLINLKFLAQGGTAVGTGLNTRIGFAEKIAEQISKETGVAFKTAPNKFEAL 301

Query: 297 AAHDAVVEASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPT 356
           AAHDA+VEASGA+ T+A SLFKIA DIRYLGSGPRCGYGELSLPENEPGSSIMPGK+NPT
Sbjct: 302 AAHDAIVEASGAITTVATSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKINPT 361

Query: 357 QNEAMTQVCVQVMGNHAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDASNSFRIHCV 416
           QNEA+TQVC Q++GN+  I FAG  GQFELNVFKPVMISNLLSSIRLLGD S SFRIHCV
Sbjct: 362 QNEAVTQVCAQIIGNNQTIIFAGTQGQFELNVFKPVMISNLLSSIRLLGDVSKSFRIHCV 421

Query: 417 EGIKANEDRIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLSSE 476
           EGIKANE+RIA L+++SLMLVTALNPKIGYD A+KVAKNAHKKGITLKESA++L  L+  
Sbjct: 422 EGIKANEERIADLMNKSLMLVTALNPKIGYDEATKVAKNAHKKGITLKESAMQLGSLTES 481

Query: 477 EFDQWVIPEKMIGPK 491
           EFD+WV+PEKMIGPK
Sbjct: 482 EFDEWVVPEKMIGPK 496

>Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa]
           {ON} complement(177449..178906) [1458 nt, 486 aa]
          Length = 485

 Score =  795 bits (2053), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/460 (81%), Positives = 422/460 (91%)

Query: 31  YRVETDAFGEIQVPSDKYWGAQTQRSLQNFKIGGPRERMPEPIVKAFGVLKKSAAVVNER 90
           +RVETD FGEI+VP++KYWGAQT+RS +NFKIGG RERMPE +V+AFGVLKK AA+VN  
Sbjct: 24  FRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEAVVRAFGVLKKCAAIVNTE 83

Query: 91  LGTLDPEIAKPIKQAADEVAQGKLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGE 150
           LG LDP  +K I+QAADEVA GKL +HFPLVVFQTGSGTQSNMNANEVISNRAIEL GG 
Sbjct: 84  LGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGV 143

Query: 151 LGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHHLLPELEGLKVALKQKSDEFQHIV 210
           LGSK+IHPNNHCN AQSSNDTFP+VMHIAAVT+I+ HLLPEL  L+ AL  KS EF+HIV
Sbjct: 144 LGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFEHIV 203

Query: 211 KIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSLYHLKFLAQGGTAVGTGLNTKVGF 270
           KIGRTHLQDATPLTLGQEFSGYVQQ+ NGI R++++  +L+FLAQGGTAVGTGLNTK G+
Sbjct: 204 KIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTKNGW 263

Query: 271 AEDIAEQVSKETGIDFKTAPNKFEALAAHDAVVEASGALNTLAVSLFKIANDIRYLGSGP 330
           AE IA ++SKETG+ FKTAPNKFEALAAHDA+VEASGALNT+A SLFKIA DIRYLGSGP
Sbjct: 264 AERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGP 323

Query: 331 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNHAAITFAGASGQFELNVFK 390
           RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN+AA+TFAGASGQFELNVFK
Sbjct: 324 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGASGQFELNVFK 383

Query: 391 PVMISNLLSSIRLLGDASNSFRIHCVEGIKANEDRIAKLLHESLMLVTALNPKIGYDAAS 450
           PV+ISNLLSS++LLGDAS SFR+HCVEGIKANE +I++LLH SLMLVTALNPKIGYDAA+
Sbjct: 384 PVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELLHRSLMLVTALNPKIGYDAAT 443

Query: 451 KVAKNAHKKGITLKESALELKVLSSEEFDQWVIPEKMIGP 490
           KVAKNAHKKGITLKESALEL VL+ +EFD+WV+PEKM+GP
Sbjct: 444 KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKMLGP 483

>NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {ON}
           Anc_6.13 YPL262W
          Length = 493

 Score =  793 bits (2049), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/490 (76%), Positives = 433/490 (88%), Gaps = 3/490 (0%)

Query: 2   LRNSIVSRGLAQTRVSAKVNRLASLRMVSYRVETDAFGEIQVPSDKYWGAQTQRSLQNFK 61
           L N  + R L  +R+S      AS +   YR+ETD+FGEI+VP+DKYWGAQTQRS QNFK
Sbjct: 6   LANPTILR-LQASRMSLSTTTAASQQ--QYRIETDSFGEIKVPADKYWGAQTQRSFQNFK 62

Query: 62  IGGPRERMPEPIVKAFGVLKKSAAVVNERLGTLDPEIAKPIKQAADEVAQGKLMEHFPLV 121
           IGG RER+P+PI+ AFG+LKKSAA+VNE LGTLDP++A PIK+AADEV QGKL +HFPLV
Sbjct: 63  IGGSRERIPDPIITAFGILKKSAAIVNESLGTLDPKVADPIKKAADEVVQGKLKDHFPLV 122

Query: 122 VFQTGSGTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAV 181
           VFQTGSGTQ+NMN NEVISNRAIEL+GG+LGSK+IHPNNHCNQ+QSSNDTFPSVMHIAAV
Sbjct: 123 VFQTGSGTQTNMNVNEVISNRAIELVGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAV 182

Query: 182 TEITHHLLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIA 241
            EIT+ L+PEL  LK AL  K+ EF  IVKIGRTHLQDATPLTLGQEFSGYVQQ+ENGI 
Sbjct: 183 LEITNSLIPELTKLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIY 242

Query: 242 RVKQSLYHLKFLAQGGTAVGTGLNTKVGFAEDIAEQVSKETGIDFKTAPNKFEALAAHDA 301
           R++ SLYHLKFLAQGGTAVGTGLNTK+GF + IAE+VSKETGI+FKTAPNKFEALAAHDA
Sbjct: 243 RIESSLYHLKFLAQGGTAVGTGLNTKIGFDKLIAEEVSKETGIEFKTAPNKFEALAAHDA 302

Query: 302 VVEASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAM 361
           +V ASGALNT+A SLFKIA DIRYLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEAM
Sbjct: 303 IVFASGALNTVAGSLFKIAQDIRYLGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAM 362

Query: 362 TQVCVQVMGNHAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDASNSFRIHCVEGIKA 421
           TQVCVQ+MGN+  I+ AG+ GQFELNV+KP+MI+NLL+SIRL+ DA  SFRIHC++ +KA
Sbjct: 363 TQVCVQIMGNNQTISIAGSQGQFELNVYKPLMIANLLNSIRLMTDACKSFRIHCIDDLKA 422

Query: 422 NEDRIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLSSEEFDQW 481
           N+D+I + L++SLMLVTALNPKIGYDAASK+AKNAH K ITLKESALELK L++EEFD+W
Sbjct: 423 NKDKINENLNKSLMLVTALNPKIGYDAASKIAKNAHLKNITLKESALELKYLTAEEFDEW 482

Query: 482 VIPEKMIGPK 491
           V+PE MIGPK
Sbjct: 483 VVPENMIGPK 492

>ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262W FUM1 Fumarase converts fumaric acid
           to L-malic acid in the TCA cycle cytosolic and
           mitochondrial localization determined by the N-terminal
           mitochondrial targeting sequence and protein
           conformation
          Length = 505

 Score =  793 bits (2049), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/498 (77%), Positives = 438/498 (87%), Gaps = 8/498 (1%)

Query: 1   MLRNSIVSRGLAQTRVSAK--VNRLASLRMVS-----YRVETDAFGEIQVPSDKYWGAQT 53
           +L+NS V + ++  R+++K  +++++ L   +     +RVETDAFGEI+VP+DKYWGAQT
Sbjct: 8   VLKNSCVCQ-VSSPRLTSKTPMSQISQLHTTTPWLQEHRVETDAFGEIKVPADKYWGAQT 66

Query: 54  QRSLQNFKIGGPRERMPEPIVKAFGVLKKSAAVVNERLGTLDPEIAKPIKQAADEVAQGK 113
           QRS +NF+IGG RERMPE +V AFG+LKK+ A VNE  G LDP++A  IKQAADEVA GK
Sbjct: 67  QRSFENFRIGGQRERMPEAVVHAFGILKKATATVNEANGQLDPKLAVAIKQAADEVASGK 126

Query: 114 LMEHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFP 173
           L +HFPLVVFQTGSGTQSNMNANEVISNRAIEL+GG+LGSK +HPNNH N +QSSNDTFP
Sbjct: 127 LKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFP 186

Query: 174 SVMHIAAVTEITHHLLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYV 233
           +VMHIAAV  IT  LLP L  LK +L++KS+EF  IVKIGRTHLQDATPLTLGQEFSGYV
Sbjct: 187 TVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYV 246

Query: 234 QQVENGIARVKQSLYHLKFLAQGGTAVGTGLNTKVGFAEDIAEQVSKETGIDFKTAPNKF 293
           QQV NGI RV+ +L  LK LAQGGTAVGTGLNTK+G+AE++A +V+KETGIDF+TAPNKF
Sbjct: 247 QQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQTAPNKF 306

Query: 294 EALAAHDAVVEASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 353
           EALAAHDAVVEASGALNTLAVSLFKIA DIRYLGSGPRCGYGELSLPENEPGSSIMPGKV
Sbjct: 307 EALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 366

Query: 354 NPTQNEAMTQVCVQVMGNHAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDASNSFRI 413
           NPTQNEA+TQVCVQV GNH+AITFAGASGQFELNVFKPVMISNLLSSI LL DAS SFR+
Sbjct: 367 NPTQNEALTQVCVQVFGNHSAITFAGASGQFELNVFKPVMISNLLSSINLLSDASYSFRV 426

Query: 414 HCVEGIKANEDRIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVL 473
           HCV+GI+AN + IAKLLHESLMLVTALNPKIGYDAASKVAKNAHK GITLKESAL+L +L
Sbjct: 427 HCVDGIQANRENIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKNGITLKESALQLNIL 486

Query: 474 SSEEFDQWVIPEKMIGPK 491
           ++EEFD WV+PE MIGPK
Sbjct: 487 TAEEFDHWVVPEHMIGPK 504

>YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumarase,
           converts fumaric acid to L-malic acid in the TCA cycle;
           cytosolic and mitochondrial distribution determined by
           the N-terminal targeting sequence, protein conformation,
           and status of glyoxylate shunt; phosphorylated in
           mitochondria
          Length = 488

 Score =  788 bits (2035), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/492 (77%), Positives = 428/492 (86%), Gaps = 5/492 (1%)

Query: 1   MLRNSIVS-RGLAQTRVSAKVNRLASLRMVSYRVETDAFGEIQVPSDKYWGAQTQRSLQN 59
           MLR +  S +   ++     + R+ S    S+R ETDAFGEI VP+DKYWGAQTQRS QN
Sbjct: 1   MLRFTNCSCKTFVKSSYKLNIRRMNS----SFRTETDAFGEIHVPADKYWGAQTQRSFQN 56

Query: 60  FKIGGPRERMPEPIVKAFGVLKKSAAVVNERLGTLDPEIAKPIKQAADEVAQGKLMEHFP 119
           FKIGG RERMP P+V AFGVLKKSAA+VNE LG LDP+I+K I+QAADEVA GKL +HFP
Sbjct: 57  FKIGGARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKISKAIQQAADEVASGKLDDHFP 116

Query: 120 LVVFQTGSGTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIA 179
           LVVFQTGSGTQSNMNANEVISNRAIE++GG++GSK++HPNNHCNQ+QSSNDTFP+VMHIA
Sbjct: 117 LVVFQTGSGTQSNMNANEVISNRAIEILGGKIGSKQVHPNNHCNQSQSSNDTFPTVMHIA 176

Query: 180 AVTEITHHLLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENG 239
           A  +I + L+PEL  LK AL+ KS EF HIVKIGRTHLQDATPLTLGQEFSGYVQQVENG
Sbjct: 177 ASLQIQNELIPELTNLKNALEAKSKEFDHIVKIGRTHLQDATPLTLGQEFSGYVQQVENG 236

Query: 240 IARVKQSLYHLKFLAQGGTAVGTGLNTKVGFAEDIAEQVSKETGIDFKTAPNKFEALAAH 299
           I RV  SL  L FLAQGGTAVGTGLNTK GF   IAEQ+SKETG+ F+TAPNKFEALAAH
Sbjct: 237 IQRVAHSLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAH 296

Query: 300 DAVVEASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 359
           DA+VE SGALNTLA SLFKIA DIRYLGSGPRCGY EL LPENEPGSSIMPGKVNPTQNE
Sbjct: 297 DAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNE 356

Query: 360 AMTQVCVQVMGNHAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDASNSFRIHCVEGI 419
           A+TQVCVQVMGN+AAITFAG+ GQFELNVFKPVMI+NLL+SIRL+ DA+ SFR+HCVEGI
Sbjct: 357 ALTQVCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLITDAAYSFRVHCVEGI 416

Query: 420 KANEDRIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLSSEEFD 479
           KANE RI +LL +SLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALEL VL+ +EFD
Sbjct: 417 KANEPRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFD 476

Query: 480 QWVIPEKMIGPK 491
           +WV+PE M+GPK
Sbjct: 477 EWVVPEHMLGPK 488

>KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.13
           YPL262W
          Length = 498

 Score =  788 bits (2035), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/497 (76%), Positives = 431/497 (86%), Gaps = 6/497 (1%)

Query: 1   MLRNSIVSRGLAQTRVSAKVNRL------ASLRMVSYRVETDAFGEIQVPSDKYWGAQTQ 54
           M+R+   S G A  +V+   N L      +++    +RVETD+FGEI VP+D+YWGAQTQ
Sbjct: 1   MIRSVFNSSGKASVKVALLRNNLRRNMSASAITNQEFRVETDSFGEINVPADRYWGAQTQ 60

Query: 55  RSLQNFKIGGPRERMPEPIVKAFGVLKKSAAVVNERLGTLDPEIAKPIKQAADEVAQGKL 114
           RS QNFKIGG RE++PEP+V+AFG+LKKSAA VNE LGTLD  IA  IK AADEVA+GKL
Sbjct: 61  RSFQNFKIGGDREKIPEPVVRAFGILKKSAATVNENLGTLDKSIAAKIKLAADEVAEGKL 120

Query: 115 MEHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPS 174
            +HFPLVVFQTGSGTQSNMNANEVISNRAIEL+GGELGSK++HPNNH NQ+QSSNDTFP+
Sbjct: 121 SDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGELGSKQVHPNNHVNQSQSSNDTFPT 180

Query: 175 VMHIAAVTEITHHLLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQ 234
           VMHIAA TEI + L+PEL+ LK AL+ K +EF  IVKIGRTHLQDATPLTLGQEFSGYVQ
Sbjct: 181 VMHIAATTEIANKLIPELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQ 240

Query: 235 QVENGIARVKQSLYHLKFLAQGGTAVGTGLNTKVGFAEDIAEQVSKETGIDFKTAPNKFE 294
           QVENGI RV+ SLYHL FLAQGGTAVGTGLNTKVGF + +AE+VSKETG+ F+TAPNKFE
Sbjct: 241 QVENGIQRVQSSLYHLHFLAQGGTAVGTGLNTKVGFDKLVAEEVSKETGLHFETAPNKFE 300

Query: 295 ALAAHDAVVEASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVN 354
           ALAAHDA+VEASGALNTLA SLFKIA DIRYLGSGPRCGYGEL LP NEPGSSIMPGKVN
Sbjct: 301 ALAAHDAIVEASGALNTLACSLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVN 360

Query: 355 PTQNEAMTQVCVQVMGNHAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDASNSFRIH 414
           PTQNEAMTQVCVQVMGN++ ITFAG+ GQFELNV+KP+MISNLLSSIRLL DAS SFRIH
Sbjct: 361 PTQNEAMTQVCVQVMGNNSTITFAGSQGQFELNVYKPLMISNLLSSIRLLTDASKSFRIH 420

Query: 415 CVEGIKANEDRIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLS 474
           C+  +KAN+D+I + L++SLMLVTALNPKIGYDAA+KVAKNAH K ITLKESALEL VL+
Sbjct: 421 CLNDLKANKDKIDENLNKSLMLVTALNPKIGYDAAAKVAKNAHHKNITLKESALELGVLT 480

Query: 475 SEEFDQWVIPEKMIGPK 491
            +EFD+WVIPE MI PK
Sbjct: 481 EKEFDEWVIPENMISPK 497

>Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W
           (REAL)
          Length = 488

 Score =  787 bits (2033), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/492 (77%), Positives = 427/492 (86%), Gaps = 5/492 (1%)

Query: 1   MLRNSIVS-RGLAQTRVSAKVNRLASLRMVSYRVETDAFGEIQVPSDKYWGAQTQRSLQN 59
           MLR S  S + + Q+     + R+ S    ++R ETDAFGEI VP+DKYWGAQTQRS QN
Sbjct: 1   MLRFSNSSCKAILQSSYKVNIRRMNS----TFRTETDAFGEINVPADKYWGAQTQRSFQN 56

Query: 60  FKIGGPRERMPEPIVKAFGVLKKSAAVVNERLGTLDPEIAKPIKQAADEVAQGKLMEHFP 119
           FKIGG RERMP P+V AFGVLKKSAA+VNE LG LDP+++K I+QAADEVA GKL +HFP
Sbjct: 57  FKIGGARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKVSKAIQQAADEVAAGKLDDHFP 116

Query: 120 LVVFQTGSGTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIA 179
           LVVFQTGSGTQSNMNANEVISNRAIE++GG++GSK++HPNN CNQ+QSSNDTFP+VMHIA
Sbjct: 117 LVVFQTGSGTQSNMNANEVISNRAIEILGGKIGSKQVHPNNDCNQSQSSNDTFPTVMHIA 176

Query: 180 AVTEITHHLLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENG 239
           A  +I   L+PEL  LK AL+ KS EF+HIVKIGRTHLQDATPLTLGQEFSGYVQQVENG
Sbjct: 177 ASLQIEKELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENG 236

Query: 240 IARVKQSLYHLKFLAQGGTAVGTGLNTKVGFAEDIAEQVSKETGIDFKTAPNKFEALAAH 299
           I RV  +L  L FLAQGGTAVGTGLNTK GF   IAEQ+SKETG+ F+TAPNKFEALAAH
Sbjct: 237 IQRVAHTLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAH 296

Query: 300 DAVVEASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 359
           DA+VE SGALNTLA SLFKIA DIRYLGSGPRCGY EL LPENEPGSSIMPGKVNPTQNE
Sbjct: 297 DAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGKVNPTQNE 356

Query: 360 AMTQVCVQVMGNHAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDASNSFRIHCVEGI 419
           A+TQVCVQVMGN+AAITF G+ GQFELNVFKPVMI+NLL+SIRL+ DAS SFRIHCVEGI
Sbjct: 357 ALTQVCVQVMGNNAAITFGGSQGQFELNVFKPVMIANLLNSIRLIADASRSFRIHCVEGI 416

Query: 420 KANEDRIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLSSEEFD 479
           KANE RI +LL +SLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALEL VL+ +EFD
Sbjct: 417 KANEPRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFD 476

Query: 480 QWVIPEKMIGPK 491
           +WV+PE M+GPK
Sbjct: 477 EWVVPENMLGPK 488

>Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON}
           YPL262W (REAL)
          Length = 488

 Score =  786 bits (2031), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/492 (77%), Positives = 428/492 (86%), Gaps = 5/492 (1%)

Query: 1   MLRNSIVS-RGLAQTRVSAKVNRLASLRMVSYRVETDAFGEIQVPSDKYWGAQTQRSLQN 59
           MLR +  S +   Q+     + R+ S    ++R ETDAFGEI VP+DKYWGAQTQRS QN
Sbjct: 1   MLRLTNSSCKAFVQSSYKFNIRRMNS----TFRTETDAFGEINVPADKYWGAQTQRSFQN 56

Query: 60  FKIGGPRERMPEPIVKAFGVLKKSAAVVNERLGTLDPEIAKPIKQAADEVAQGKLMEHFP 119
           FKIGG RERMP P+V AFGVLKKSAA+VNE LG LDP+I+K I++AADEVA GKL +HFP
Sbjct: 57  FKIGGARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKISKAIQEAADEVASGKLDDHFP 116

Query: 120 LVVFQTGSGTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIA 179
           LVVFQTGSGTQSNMNANEVISNRAIE++GG++GSK++HPNNHCNQ+QSSNDTFP+VMHIA
Sbjct: 117 LVVFQTGSGTQSNMNANEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIA 176

Query: 180 AVTEITHHLLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENG 239
           A  +I + L+PEL  LK AL+ KS EF HIVKIGRTHLQDATPLTLGQEFSGYVQQVENG
Sbjct: 177 ASLQIQNELIPELANLKNALEAKSKEFDHIVKIGRTHLQDATPLTLGQEFSGYVQQVENG 236

Query: 240 IARVKQSLYHLKFLAQGGTAVGTGLNTKVGFAEDIAEQVSKETGIDFKTAPNKFEALAAH 299
           I RV  SL  L FLAQGGTAVGTGLNTK GF   IAEQ+SKETG+ F+TAPNKFEALAAH
Sbjct: 237 IQRVAHSLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAH 296

Query: 300 DAVVEASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 359
           DA+VE SGALNTLA SLFKIA DIRYLGSGPRCGY EL LPENEPGSSIMPGKVNPTQNE
Sbjct: 297 DAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNE 356

Query: 360 AMTQVCVQVMGNHAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDASNSFRIHCVEGI 419
           A+TQVCVQVMGN+AAITFAG+ GQFELNVFKPVMI+NLL+SIRL+ DA+ SFR+HCVEGI
Sbjct: 357 ALTQVCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLITDAAYSFRVHCVEGI 416

Query: 420 KANEDRIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLSSEEFD 479
           KANE RI +LL +SLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALEL VL+ +EFD
Sbjct: 417 KANEPRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFD 476

Query: 480 QWVIPEKMIGPK 491
           +WV+PE M+GPK
Sbjct: 477 EWVVPENMLGPK 488

>Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W
           (REAL)
          Length = 488

 Score =  785 bits (2028), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/492 (77%), Positives = 428/492 (86%), Gaps = 5/492 (1%)

Query: 1   MLRNS-IVSRGLAQTRVSAKVNRLASLRMVSYRVETDAFGEIQVPSDKYWGAQTQRSLQN 59
           MLR S    + + Q+     + R+ S    ++R+ETDAFGEI VP+DKYWGAQTQRS QN
Sbjct: 1   MLRFSNFNCKAVLQSSYKVNLRRMNS----TFRIETDAFGEINVPADKYWGAQTQRSFQN 56

Query: 60  FKIGGPRERMPEPIVKAFGVLKKSAAVVNERLGTLDPEIAKPIKQAADEVAQGKLMEHFP 119
           FKIGG RERMP P+V AFGVLKKSAAVVNE LG LDP+I+K I+QAADEV  GKL +HFP
Sbjct: 57  FKIGGARERMPLPLVHAFGVLKKSAAVVNESLGGLDPKISKAIQQAADEVTSGKLDDHFP 116

Query: 120 LVVFQTGSGTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIA 179
           LVVFQTGSGTQSNMNANEVISNRAIE++GG++GSK++HPNNHCNQ+QSSNDTFP+VMHIA
Sbjct: 117 LVVFQTGSGTQSNMNANEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIA 176

Query: 180 AVTEITHHLLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENG 239
           A  +I + L+PEL  LK AL+ KS EF+HIVKIGRTHLQDATPLTLGQEFSGYVQQVENG
Sbjct: 177 ASLQIQNELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENG 236

Query: 240 IARVKQSLYHLKFLAQGGTAVGTGLNTKVGFAEDIAEQVSKETGIDFKTAPNKFEALAAH 299
           I RV  SL  L FLAQGGTAVGTGLNTK GF   IAEQ+S ETG+ F+TAPNKFEALAAH
Sbjct: 237 IQRVAHSLKTLSFLAQGGTAVGTGLNTKPGFDIKIAEQISSETGLKFQTAPNKFEALAAH 296

Query: 300 DAVVEASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 359
           DA+VE SGALNTLA SLFKIA DIRYLGSGPRCGY EL LPENEPGSSIMPGKVNPTQNE
Sbjct: 297 DAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNE 356

Query: 360 AMTQVCVQVMGNHAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDASNSFRIHCVEGI 419
           A+TQVCVQVMGN+AAITFAG+ GQFELNVFKPVMI+NLL+SIRL+ D++ SFR+HCVEGI
Sbjct: 357 ALTQVCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLITDSAYSFRVHCVEGI 416

Query: 420 KANEDRIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLSSEEFD 479
           KANE RI +LL +SLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALEL VL+ +EFD
Sbjct: 417 KANEPRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFD 476

Query: 480 QWVIPEKMIGPK 491
           +WV+PE M+GPK
Sbjct: 477 EWVVPENMLGPK 488

>KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6.13
           YPL262W
          Length = 495

 Score =  785 bits (2027), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/479 (77%), Positives = 428/479 (89%), Gaps = 1/479 (0%)

Query: 14  TRVSAKVNRLASLRMVSYRVETDAFGEIQVPSDKYWGAQTQRSLQNFKIGGPRERMPEPI 73
           T  +++   ++S++  S+R ETD+FGEI VP+DKYWGAQTQRSLQNFKIGG RE++P PI
Sbjct: 18  TSYTSRFYTMSSIKS-SFRAETDSFGEINVPNDKYWGAQTQRSLQNFKIGGEREKIPIPI 76

Query: 74  VKAFGVLKKSAAVVNERLGTLDPEIAKPIKQAADEVAQGKLMEHFPLVVFQTGSGTQSNM 133
           ++AFG+LKKSAA+VNERLGTLD E+AK I  AADEV+QGKL +HFPLVVFQTGSGTQSNM
Sbjct: 77  IEAFGILKKSAAIVNERLGTLDSELAKNIIIAADEVSQGKLNDHFPLVVFQTGSGTQSNM 136

Query: 134 NANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHHLLPELE 193
           NANEVISNRAIEL+GG+LGSK +HPNNH NQ+QSSNDTFP+VMHIAA+ EIT  LLPEL 
Sbjct: 137 NANEVISNRAIELMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELN 196

Query: 194 GLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSLYHLKFL 253
            LK +L +KS+EF  IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI R++ +LYHLKFL
Sbjct: 197 SLKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFL 256

Query: 254 AQGGTAVGTGLNTKVGFAEDIAEQVSKETGIDFKTAPNKFEALAAHDAVVEASGALNTLA 313
           AQGGTAVGTGLNTK GF + IAEQ+S+ETGI+F+TAPNKFEALAAHDA+VE SGALNTLA
Sbjct: 257 AQGGTAVGTGLNTKAGFDKLIAEQISEETGINFETAPNKFEALAAHDAIVEVSGALNTLA 316

Query: 314 VSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNHA 373
            SLFKIA DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVC+QVMGNH+
Sbjct: 317 CSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGNHS 376

Query: 374 AITFAGASGQFELNVFKPVMISNLLSSIRLLGDASNSFRIHCVEGIKANEDRIAKLLHES 433
            ITFAG+ GQFELNV+KP++ISNLLSSIRLL DAS SFR+HC++G+KAN + I + L++S
Sbjct: 377 TITFAGSQGQFELNVYKPLLISNLLSSIRLLTDASYSFRVHCIDGLKANRENITENLNKS 436

Query: 434 LMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLSSEEFDQWVIPEKMIGPKE 492
           LMLVTALNP IGYD ASK+AKNAH K ITLKESALEL +L+ E+F +WVIPEKMIGPK+
Sbjct: 437 LMLVTALNPYIGYDNASKIAKNAHHKNITLKESALELGLLTEEQFSEWVIPEKMIGPKQ 495

>TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.13
           YPL262W
          Length = 465

 Score =  751 bits (1939), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/465 (74%), Positives = 412/465 (88%)

Query: 28  MVSYRVETDAFGEIQVPSDKYWGAQTQRSLQNFKIGGPRERMPEPIVKAFGVLKKSAAVV 87
           M   R+E D FGE++VP++KYWGAQTQR+L NF IGG RERMPEP++ A+G+LKKS A+V
Sbjct: 1   MPETRIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIV 60

Query: 88  NERLGTLDPEIAKPIKQAADEVAQGKLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELI 147
           NE LGTLDP+I+K I++AADEVA+G L EHFPLVVFQTGSGTQ+NMN NEVISNRAIE++
Sbjct: 61  NESLGTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEIL 120

Query: 148 GGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHHLLPELEGLKVALKQKSDEFQ 207
           GG+LGSK +HPNNH NQ+QS+ND+FP+ MHI+AV E+   LLPELE L+ ALK KS EF 
Sbjct: 121 GGQLGSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFN 180

Query: 208 HIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSLYHLKFLAQGGTAVGTGLNTK 267
            IVKIGRTHLQDATPLTLGQEFSGYVQQVENGI RV+ SL +LKF+AQGGTAVGTG+NTK
Sbjct: 181 KIVKIGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTK 240

Query: 268 VGFAEDIAEQVSKETGIDFKTAPNKFEALAAHDAVVEASGALNTLAVSLFKIANDIRYLG 327
             F   +A+Q+S ETGI+FKTAPNKFEALA+HDA+VE SGALNTLA SLFKI+ DIR+LG
Sbjct: 241 KDFDILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLG 300

Query: 328 SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNHAAITFAGASGQFELN 387
           SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAM Q C+QVMGN++AITFAGASGQFELN
Sbjct: 301 SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELN 360

Query: 388 VFKPVMISNLLSSIRLLGDASNSFRIHCVEGIKANEDRIAKLLHESLMLVTALNPKIGYD 447
            +KP+MISNLL+SIRLL D+ NSFRIHC+ GI+ANED+I KLL+ESLMLVTALNPKIGYD
Sbjct: 361 TYKPLMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYD 420

Query: 448 AASKVAKNAHKKGITLKESALELKVLSSEEFDQWVIPEKMIGPKE 492
           AA+ +AK+AHK G+TLKE+AL+ K+L++E+FD+W++PE M+ P E
Sbjct: 421 AATAIAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHPSE 465

>NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {ON}
           Anc_6.13 YPL262W
          Length = 475

 Score =  750 bits (1937), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/462 (78%), Positives = 414/462 (89%)

Query: 30  SYRVETDAFGEIQVPSDKYWGAQTQRSLQNFKIGGPRERMPEPIVKAFGVLKKSAAVVNE 89
           S+RVETD+FGEI+VPS+KYWGAQTQRS QNFKIGG RE++P PI+KAFG+LKKSAA+VN+
Sbjct: 13  SFRVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAFGILKKSAAIVNQ 72

Query: 90  RLGTLDPEIAKPIKQAADEVAQGKLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELIGG 149
            LGTLDP IA PI +A+DEV QGKL +HFPLVVFQTGSGTQ+NMNANEVISNRA ELIG 
Sbjct: 73  SLGTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANEVISNRANELIGA 132

Query: 150 ELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHHLLPELEGLKVALKQKSDEFQHI 209
           ELGSKKIHPNNH NQ+QSSNDTFPSVMHIAAV E+ ++L+P+L  LK +L  K+ E+ +I
Sbjct: 133 ELGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKNSLDNKAKEYANI 192

Query: 210 VKIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSLYHLKFLAQGGTAVGTGLNTKVG 269
           VKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI R++ SLYHLKFLAQGGTAVGTGLNTKVG
Sbjct: 193 VKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGGTAVGTGLNTKVG 252

Query: 270 FAEDIAEQVSKETGIDFKTAPNKFEALAAHDAVVEASGALNTLAVSLFKIANDIRYLGSG 329
           F + IA++VSKETGIDF+TAPNKFEALAAHDA+V AS A+ T+A SLFKIA DIRYLGSG
Sbjct: 253 FDKMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRYLGSG 312

Query: 330 PRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNHAAITFAGASGQFELNVF 389
           PRCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQV +Q+MGN+  I  AG+ GQFELNV+
Sbjct: 313 PRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQGQFELNVY 372

Query: 390 KPVMISNLLSSIRLLGDASNSFRIHCVEGIKANEDRIAKLLHESLMLVTALNPKIGYDAA 449
           KP+MI+NLL+SIRL+ DA +SF+IHCV+G+KAN D+I + LH+SLMLVTALNPKIGYDAA
Sbjct: 373 KPLMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLVTALNPKIGYDAA 432

Query: 450 SKVAKNAHKKGITLKESALELKVLSSEEFDQWVIPEKMIGPK 491
           SK+AKNAH K ITLKESALEL +L+ EEFDQWVIPE MIGPK
Sbjct: 433 SKLAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGPK 474

>TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6.13
           YPL262W
          Length = 500

 Score =  726 bits (1874), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/459 (73%), Positives = 395/459 (86%)

Query: 32  RVETDAFGEIQVPSDKYWGAQTQRSLQNFKIGGPRERMPEPIVKAFGVLKKSAAVVNERL 91
           R ETD+FGEIQVP++KYWGAQTQRS  NFKIGG RERMPEPI++AFG  KK+AA+VN  L
Sbjct: 41  RTETDSFGEIQVPANKYWGAQTQRSFMNFKIGGERERMPEPIIRAFGQQKKAAAIVNNSL 100

Query: 92  GTLDPEIAKPIKQAADEVAQGKLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGEL 151
           GTLD  +   I QAA+EV+QG L EHFPLVVFQTGSGTQSNMNANEVISNRAIEL+GG L
Sbjct: 101 GTLDDTLKDAIVQAAEEVSQGLLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGTL 160

Query: 152 GSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHHLLPELEGLKVALKQKSDEFQHIVK 211
           GSK++HPNNH NQ+QSSNDTFP+VMHIAA+TEIT+ LLP L  L+  L  K+ EF+ I+K
Sbjct: 161 GSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIVLRETLDSKAKEFEKIIK 220

Query: 212 IGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSLYHLKFLAQGGTAVGTGLNTKVGFA 271
           IGRTHLQDATPLTLGQEFSGY QQ+ N I R++++L  L+++AQGGTAVGTGLNTK+GFA
Sbjct: 221 IGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIAQGGTAVGTGLNTKIGFA 280

Query: 272 EDIAEQVSKETGIDFKTAPNKFEALAAHDAVVEASGALNTLAVSLFKIANDIRYLGSGPR 331
           E  A Q+S +T + F T+PNKFE+LAAHDA+V    +LNTLA SLFKI+ DIRYL SGPR
Sbjct: 281 EQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHASLNTLACSLFKISQDIRYLASGPR 340

Query: 332 CGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNHAAITFAGASGQFELNVFKP 391
           CGYGELS+PENEPGSSIMPGKVNPTQNEAM Q CVQVMGN++ I+FAGASGQFELN +KP
Sbjct: 341 CGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMGNNSTISFAGASGQFELNTYKP 400

Query: 392 VMISNLLSSIRLLGDASNSFRIHCVEGIKANEDRIAKLLHESLMLVTALNPKIGYDAASK 451
           +MI+NLLSS RLL DA  SF +HC  GI+AN+D+I +LLHESLMLVT+LNPKIGYDAASK
Sbjct: 401 LMIANLLSSTRLLSDAIFSFNLHCATGIQANKDKIDRLLHESLMLVTSLNPKIGYDAASK 460

Query: 452 VAKNAHKKGITLKESALELKVLSSEEFDQWVIPEKMIGP 490
           VAKNAH KGITLK+SALEL +LSS++FD+WV PE M+GP
Sbjct: 461 VAKNAHHKGITLKQSALELDILSSKQFDEWVRPENMLGP 499

>SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 464

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 93/238 (39%), Gaps = 21/238 (8%)

Query: 134 NANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHHLLPELE 193
            ANE    R  E+IG E+ S K+H        +S ND   + M I     +   LLP L+
Sbjct: 91  TANE---RRLGEIIGREI-SGKVHT------GRSRNDQVATDMRIYCRDILNEVLLPALQ 140

Query: 194 GLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSLYHLKFL 253
                L  ++ E   ++  G THLQ A P+      S Y         R+KQ +  L   
Sbjct: 141 AFIKVLTTRAKEEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDYNRLKQIVERLNKS 200

Query: 254 AQGGTAVGTGLNTKVGFAEDIAEQVSKETGIDFK-TAPNKFEALAAHDAVVEASGALNTL 312
             G  A+        G    I  +     G+ F+    N   A++  D VVE        
Sbjct: 201 PLGAGALA-------GHPYGIDREFLAR-GLGFQGVIGNSLTAVSDRDFVVEIMFWGTLF 252

Query: 313 AVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMG 370
              + + + D+  + S    G+ +LS      GSS+MP K NP   E +     +V G
Sbjct: 253 MNHISRFSEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNPDSLELLRGKAGRVFG 308

>KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 461

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 89/228 (39%), Gaps = 13/228 (5%)

Query: 149 GELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHHLLPELEGLKVALKQKSDEFQH 208
           GE+  + I    H    +S ND   + M I     +   +LP L  L   + Q+++E   
Sbjct: 96  GEIIGRGIAGKVHT--GRSRNDQVATDMRIYCRDILNGTVLPALSSLIKVILQRAEEEID 153

Query: 209 IVKIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSLYHLKFLAQGGTAVGTGLNTKV 268
           ++  G THLQ A P+      S Y         R++Q +  L     G  A+        
Sbjct: 154 VLMPGYTHLQRAQPIRWAHWLSCYATYFTEDYKRLQQIVERLNVSPLGAGALA------- 206

Query: 269 GFAEDIAEQVSKETGIDFK-TAPNKFEALAAHDAVVEASGALNTLAVSLFKIANDIRYLG 327
           G    I  +     G++F     N   A+A  D VVE     +     + + A D+  + 
Sbjct: 207 GHPYGIDREFLA-AGLNFNGVIGNSLTAVADRDFVVEIMFWGSLFMNHISRFAEDL-IIY 264

Query: 328 SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNHAAI 375
           S    G+ +LS      GSS+MP K NP   E +     +V G  A  
Sbjct: 265 STAEFGFIQLS-DAYSTGSSLMPQKKNPDSLELLRGKSGRVFGQLAGF 311

>AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR018C (ARG4)
          Length = 469

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 73/297 (24%), Positives = 119/297 (40%), Gaps = 34/297 (11%)

Query: 80  LKKSAAVVNERLGTLDPEIAKPIKQAADEVAQGKLMEHFPLVVFQTGSGTQSNMNANEVI 139
           L+K+  +  + L +    I + +KQ   E  QG  ++H            +    ANE  
Sbjct: 49  LQKTGLLTKDELES----IHEGLKQVEQEWEQGVFVKHVD---------DEDIHTANE-- 93

Query: 140 SNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHHLLPEL-EGLKVA 198
             R  E+IG  + S K+H        +S ND   + M +     +   + P L E +KV 
Sbjct: 94  -RRLGEIIGRHI-SGKVHT------GRSRNDQVATDMRLYCREMLQDKVEPALFELIKVL 145

Query: 199 LKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSLYHLKFLAQGGT 258
           L +  +E   ++  G THLQ A P+      S Y         R+K+ +  L       +
Sbjct: 146 LHRAREEID-VLMPGYTHLQRAQPIRWSHWLSCYATYFVEDFKRLKEVIARLN-----QS 199

Query: 259 AVGTGLNTKVGFAEDIAEQVSKETGIDFKTAPNKFEALAAHDAVVEASGALNTLAVSLFK 318
            +G G      +  D  E ++ E G D     N   A++  D VVE     +     + +
Sbjct: 200 PLGAGALAGHPYGID-REYLACELGFD-GVIGNSMTAVSDRDFVVEIMSWGSLFMNHISR 257

Query: 319 IANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNHAAI 375
           +A D+  + S    G+ +L+      GSS+MP K NP   E +     +V G  A  
Sbjct: 258 LAEDL-IIYSTAEFGFVKLA-DAYSTGSSLMPQKRNPDSLELLRGKSGRVFGQLAGF 312

>KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.354
           YHR018C
          Length = 462

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 65/244 (26%), Positives = 95/244 (38%), Gaps = 23/244 (9%)

Query: 134 NANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHHLLPELE 193
            ANE    R  E+IG  +  K        +  +S ND   + M I     +   LLP + 
Sbjct: 90  TANE---RRLGEIIGRHIAGK-------VHTGRSRNDQVVTDMRIYCRDILNEKLLPFMA 139

Query: 194 GL-KVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSLYHLKF 252
            L KV +K+  +E   ++  G THLQ A P+      S Y         R+KQ L  L  
Sbjct: 140 DLIKVLVKRAENEIDTLMP-GYTHLQRAQPIRWAHWLSSYATYFTEDYKRLKQILERLNV 198

Query: 253 LAQGGTAVGTGLNTKVGFAEDIAEQVSKETGIDF-KTAPNKFEALAAHDAVVEASGALNT 311
              G  A+        G    I  +   E G++F     N   A++  D VVE       
Sbjct: 199 SPLGAGALA-------GHPYGIDREFLAE-GLNFGGVIGNSLVAVSDRDFVVELMFWGTL 250

Query: 312 LAVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 371
               + + A D+  + S    G+ +LS      GSS+MP K N    E +     +V G+
Sbjct: 251 FMNHISRFAEDL-IIYSTAEFGFVKLS-DSYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

Query: 372 HAAI 375
            A  
Sbjct: 309 LAGF 312

>Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {ON}
           similar to Ashbya gossypii AEL019W
          Length = 470

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 71/289 (24%), Positives = 112/289 (38%), Gaps = 40/289 (13%)

Query: 90  RLGTLDPE----IAKPIKQAADEVAQGKLMEHFPLVVFQTGSGTQSNMNANEVISNRAIE 145
           ++G LD E    I K + +   E + GK  EH            +    ANE    R  E
Sbjct: 51  KIGLLDVEELSLIHKGLLEIESEWSSGKFEEH---------PDDEDIHTANE---RRLGE 98

Query: 146 LIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHHLLPELEGLKVALKQKSDE 205
           LIG  +  K +H        +S ND   + M I     +   +LP +      L  ++ E
Sbjct: 99  LIGTAVAGK-VHT------GRSRNDQVATDMRIYCREILNEKILPAVSSFIRVLINRARE 151

Query: 206 FQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSLYHLKFLAQGGTAVG---T 262
              ++  G THLQ A P+      S Y         R++Q +  L     G  A+     
Sbjct: 152 EVDVLMPGYTHLQRAQPIRWSHWLSCYATYFTEDYNRLRQVVERLNQSPLGAGALAGHPY 211

Query: 263 GLNTKVGFAEDIAEQVSKETGIDFKTAPNKFEALAAHDAVVEASGALNTLAVSLFKIAND 322
           G++ K      +AEQ+    GI      N   A++  D V+E     +     + + A D
Sbjct: 212 GIDRKY-----LAEQLGF-NGI----IGNSLVAVSDRDFVIEIMFWGSLFMNHISRFAED 261

Query: 323 IRYLGSGPRCGYGELSLPE-NEPGSSIMPGKVNPTQNEAMTQVCVQVMG 370
           +    +     +G ++L +    GSS+MP K NP   E +     +V G
Sbjct: 262 LIIYSTAE---FGFINLADAYSTGSSLMPQKKNPDSLELLRGKSGRVFG 307

>Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa]
           {ON} complement(330965..332347) [1383 nt, 461 aa]
          Length = 460

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 70/245 (28%), Positives = 97/245 (39%), Gaps = 25/245 (10%)

Query: 134 NANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHHLLPELE 193
            ANE    R  ELIG ++ S K+H        +S ND   + + I     I   LLP L+
Sbjct: 88  TANE---RRLGELIGTDI-SGKVHT------GRSRNDQCVTDLRIYCRDIIQDKLLPSLK 137

Query: 194 GLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSLYHLKFL 253
            L   L ++ +    I+  G THLQ A P+      S Y         R+KQ L  L   
Sbjct: 138 SLIQVLVKRGEGEIGILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLKQLLDRLNVS 197

Query: 254 AQGGTAVGTGLNTKVGFAEDIAEQVSKETGIDFK-TAPNKFEALAAHDAVVEA--SGALN 310
             G  A+        G    I  +     G+ F     N   A++  D VVE    G L 
Sbjct: 198 PLGAGALA-------GHPYGIDREFLA-NGLGFNGVIGNSLVAVSDRDFVVELLFWGTLF 249

Query: 311 TLAVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMG 370
              +S F  A D+  + S    G+  LS      GSS+MP K N    E +     +V G
Sbjct: 250 MNHISRF--AEDL-IIYSTAEFGFITLS-DAYSTGSSLMPQKKNSDSLELLRGKSGRVFG 305

Query: 371 NHAAI 375
           N + +
Sbjct: 306 NLSGL 310

>Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 59/239 (24%), Positives = 93/239 (38%), Gaps = 21/239 (8%)

Query: 134 NANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHHLLPELE 193
            ANE    R  ELIG ++  K        +  +S ND   + + I     +   L P ++
Sbjct: 90  TANE---RRLGELIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDVVNDSLFPAMK 139

Query: 194 GLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSLYHLKFL 253
           GL   L ++++    I+  G THLQ A P+      S Y         R+ Q L+ L   
Sbjct: 140 GLVDVLVKRAEGEMDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLVQILHRLNQS 199

Query: 254 AQGGTAVGTGLNTKVGFAEDIAEQVSKETGIDFKTA-PNKFEALAAHDAVVEASGALNTL 312
             G  A+        G    I  +   E G+ F +   N   A++  D +VE        
Sbjct: 200 PLGAGALA-------GHPYGIDREFLAE-GLGFNSVIGNSLVAVSDRDFIVELMFWGTLF 251

Query: 313 AVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 371
              + + A D+  +      G+ +LS      GSS+MP K N    E +     +V G+
Sbjct: 252 MNHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 59/239 (24%), Positives = 94/239 (39%), Gaps = 21/239 (8%)

Query: 134 NANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHHLLPELE 193
            ANE    R  E+IG ++  K        +  +S ND   + + I     +  +L P L+
Sbjct: 90  TANE---RRLGEIIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDVVNDNLFPALK 139

Query: 194 GLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSLYHLKFL 253
           GL   L +++    +I+  G THLQ A P+      S Y         R+ Q L+ L   
Sbjct: 140 GLVDVLIKRAKGEINILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLDQILHRLNQS 199

Query: 254 AQGGTAVGTGLNTKVGFAEDIAEQVSKETGIDFKTA-PNKFEALAAHDAVVEASGALNTL 312
             G  A+        G    I  +   E G+ F +   N   A++  D +VE        
Sbjct: 200 PLGAGALA-------GHPYGIDREFLAE-GLGFNSVIGNSMVAVSDRDFIVELMFWGTLF 251

Query: 313 AVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 371
              + + A D+  +      G+ +LS      GSS+MP K N    E +     +V G+
Sbjct: 252 MNHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>NCAS0A09010 Chr1 complement(1783858..1785246) [1389 bp, 462 aa]
           {ON} Anc_1.354 YHR018C
          Length = 462

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 60/238 (25%), Positives = 92/238 (38%), Gaps = 21/238 (8%)

Query: 135 ANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHHLLPELEG 194
           ANE    R  E+IG ++  K        +  +S ND   + + I     +   L P L  
Sbjct: 91  ANE---RRLGEIIGRDIAGK-------VHTGRSRNDQCVTDLRIYCRDVLNEKLFPALTS 140

Query: 195 LKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSLYHLKFLA 254
           L   L ++ +E   I+  G THLQ A P+      S Y       + R+KQ L       
Sbjct: 141 LIQVLIKRGEEEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDLNRLKQILVRFNKSP 200

Query: 255 QGGTAVGTGLNTKVGFAEDIAEQVSKETGIDFK-TAPNKFEALAAHDAVVEASGALNTLA 313
            G  A+        G    I  +   E G++F     N   A++  D VVE         
Sbjct: 201 LGAGALA-------GHPYGIDREFLAE-GLEFNGVIGNSLVAVSDRDFVVELMFWSTLFM 252

Query: 314 VSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 371
             + + A D+  + S    G+ +L+      GSS+MP K N    E +     +V G+
Sbjct: 253 NHISRFAEDL-IIYSTAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>NDAI0G05940 Chr7 (1470741..1472129) [1389 bp, 462 aa] {ON}
           Anc_1.354 YHR018C
          Length = 462

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 61/243 (25%), Positives = 93/243 (38%), Gaps = 21/243 (8%)

Query: 134 NANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHHLLPELE 193
            ANE    R  E+IG ++  K        +  +S ND   + + I     +   L P + 
Sbjct: 90  TANE---RRLGEIIGRDIAGK-------VHTGRSRNDQCVTDLRIYCRDVLNEKLFPGMT 139

Query: 194 GLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSLYHLKFL 253
            L   L ++++E   I+  G THLQ A P+      S Y       + R+KQ L      
Sbjct: 140 SLIEVLIKRAEEEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDLKRLKQILERFNKS 199

Query: 254 AQGGTAVGTGLNTKVGFAEDIAEQVSKETGIDFK-TAPNKFEALAAHDAVVEASGALNTL 312
             G  A+        G    I  +   E G+ F     N   A++  D VVE        
Sbjct: 200 PLGAGALA-------GHPYGIDREFLAE-GLGFDGVIGNSLVAVSDRDFVVELMFWGTLF 251

Query: 313 AVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNH 372
              + + A D+  + S    G+ +LS      GSS+MP K N    E +     +V G+ 
Sbjct: 252 MNHISRFAEDL-VIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGDL 309

Query: 373 AAI 375
           A  
Sbjct: 310 AGF 312

>Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 60/239 (25%), Positives = 93/239 (38%), Gaps = 21/239 (8%)

Query: 134 NANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHHLLPELE 193
            ANE    R  ELIG ++  K        +  +S ND   + + I     +   L P L+
Sbjct: 90  TANE---RRLGELIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDVVNGTLFPALK 139

Query: 194 GLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSLYHLKFL 253
           GL   L ++++    I+  G THLQ A P+      S Y         R+ Q L+ L   
Sbjct: 140 GLVDVLIKRAEGEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLGQILHRLNQS 199

Query: 254 AQGGTAVGTGLNTKVGFAEDIAEQVSKETGIDFKTA-PNKFEALAAHDAVVEASGALNTL 312
             G  A+        G    I  +   E G+ F +   N   A++  D +VE        
Sbjct: 200 PLGAGAL-------AGHPYGIDREFLAE-GLGFNSVIGNSLVAVSDRDFIVELMFWGTLF 251

Query: 313 AVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 371
              + + A D+  +      G+ +LS      GSS+MP K N    E +     +V G+
Sbjct: 252 MNHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}
           ARG4Argininosuccinate lyase, catalyzes the final step in
           the arginine biosynthesis pathway
          Length = 463

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 59/239 (24%), Positives = 93/239 (38%), Gaps = 21/239 (8%)

Query: 134 NANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHHLLPELE 193
            ANE    R  ELIG ++  K        +  +S ND   + + I     +   L P L+
Sbjct: 90  TANE---RRLGELIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDIVNDTLFPALK 139

Query: 194 GLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSLYHLKFL 253
           GL   L ++++    ++  G THLQ A P+      S Y         R+ Q L+ L   
Sbjct: 140 GLVEVLIKRAEGEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLGQILHRLNQS 199

Query: 254 AQGGTAVGTGLNTKVGFAEDIAEQVSKETGIDFKTA-PNKFEALAAHDAVVEASGALNTL 312
             G  A+        G    I  +   E G+ F +   N   A++  D +VE        
Sbjct: 200 PLGAGALA-------GHPYGIDREFLAE-GLGFNSVIGNSLVAVSDRDFIVELMFWGTLF 251

Query: 313 AVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 371
              + + A D+  +      G+ +LS      GSS+MP K N    E +     +V G+
Sbjct: 252 MNHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>CAGL0I08987g Chr9 complement(871699..873084) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018c ARLY
          Length = 461

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 67/286 (23%), Positives = 111/286 (38%), Gaps = 34/286 (11%)

Query: 90  RLGTL-DPEIAK---PIKQAADEVAQGKLMEHFPLVVFQTGSGTQSNMNANEVISNRAIE 145
           +LG + + E+AK    +K   +E  +GK + H            +S+ + +     R  E
Sbjct: 52  KLGLITESELAKIHSGLKDIENEWDEGKFVRH------------ESDEDIHTANERRLGE 99

Query: 146 LIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHHLLPELEGLKVALKQKSDE 205
           LIG ++  K        +  +S ND   + M I     +   + P ++ L   L  ++++
Sbjct: 100 LIGRDIAGK-------VHTGRSRNDQVVTDMRIYCREILNEKIFPAMKSLINVLVNRAEK 152

Query: 206 FQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSLYHLKFLAQGGTAVGTGLN 265
              I+  G THLQ A P+      S Y       + R++Q    L     G  A+     
Sbjct: 153 EIDILMPGYTHLQRAQPIRWAHWLSSYATYFTEDLKRLEQIAERLNKSPLGSGALA---- 208

Query: 266 TKVGFAEDIAEQVSKETGIDFK-TAPNKFEALAAHDAVVEASGALNTLAVSLFKIANDIR 324
              G    I  Q   E G+ F     N   A++  D VVE           + + + D+ 
Sbjct: 209 ---GHPYGIDRQFLAE-GLGFNGVIGNSLVAVSDRDFVVELMFWATLFMNHVSRFSEDL- 263

Query: 325 YLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMG 370
            + S    G+ +LS      GSS+MP K N    E +     +V G
Sbjct: 264 IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFG 308

>TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.354
           YHR018C
          Length = 463

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 62/241 (25%), Positives = 97/241 (40%), Gaps = 19/241 (7%)

Query: 135 ANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHHLLPELEG 194
           ANE    R  E+IG ++ S K+H        +S ND   + + I     ++  LL  LE 
Sbjct: 91  ANE---RRLGEIIGTKI-SGKVHT------GRSRNDQCVTDLRIYCREYLSDKLLKNLET 140

Query: 195 LKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSLYHLKFLA 254
           L   L  +++E    +  G THLQ A P+      S Y         R+ Q    L    
Sbjct: 141 LINVLINRAEEEIEFIMPGYTHLQRAQPIRWSHWLSSYATYFLEDYKRLVQLKERL---- 196

Query: 255 QGGTAVGTGLNTKVGFAEDIAEQVSKETGIDFKTAPNKFEALAAHDAVVEASGALNTLAV 314
              + +G G      +  D  E ++++ G D     N   A++  D VVE          
Sbjct: 197 -NKSPLGAGALAGHPYGID-REYLAEKLGFD-SVIGNSLVAVSDRDFVVEILFWSTLFMN 253

Query: 315 SLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNHAA 374
            + + A D+  + S    G+ +LS      GSS+MP K N    E +     +V GN + 
Sbjct: 254 HISRFAEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGNLSG 311

Query: 375 I 375
           +
Sbjct: 312 L 312

>ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly
           similar to uniprot|P04076 Saccharomyces cerevisiae
           YHR018C ARG4 Argininosuccinate lyase catalyzes the final
           step in the arginine biosynthesis pathway
          Length = 462

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 62/245 (25%), Positives = 99/245 (40%), Gaps = 27/245 (11%)

Query: 135 ANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHHLLPELEG 194
           ANE    R  E+IG ++  K        +  +S ND   + M I     +   LLP L+ 
Sbjct: 91  ANE---RRLGEIIGRDIAGK-------VHTGRSRNDQVVTDMRIFCRDTVNEKLLPGLKE 140

Query: 195 L-KVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSLYHLKFL 253
           L  V +K+   E  +++  G THLQ A P+      S Y       + R++Q L      
Sbjct: 141 LVSVMVKRAEKEIGYLMP-GYTHLQRAQPIRWSHWLSSYATYFTEDLKRLRQLLERFNQS 199

Query: 254 AQGGTAVG---TGLNTKVGFAEDIAEQVSKETGIDFKTAPNKFEALAAHDAVVEASGALN 310
             G  A+     G++      E +AE++  +  I      N   A++  D VVE      
Sbjct: 200 PLGAGALAGHPYGIDR-----EFLAEELGFQGVI-----GNSLVAVSDRDFVVELMFWGT 249

Query: 311 TLAVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMG 370
                + + A D+  + S    G+ +L+      GSS+MP K N    E +     +V G
Sbjct: 250 LFMNHISRFAEDL-IIYSTAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFG 307

Query: 371 NHAAI 375
           + A  
Sbjct: 308 DLAGF 312

>Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa]
           {ON} YHR018C (ARG4) - argininosuccinate lyase [contig
           260] FULL
          Length = 465

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 63/264 (23%), Positives = 99/264 (37%), Gaps = 36/264 (13%)

Query: 123 FQTGSGTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVT 182
           F    G +    ANE    R  E+IG  +  K        +  +S ND   + M I    
Sbjct: 81  FVEKDGDEDIHTANE---RRLGEIIGRHIAGK-------VHTGRSRNDQVATDMRIYC-R 129

Query: 183 EITHHLLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIAR 242
           E   +L   LE L  A+ Q+S++    +  G THLQ A P+      + Y         R
Sbjct: 130 EALDNLAKILEDLIGAILQRSEQEIDALMPGYTHLQRAQPIRWSHWLNLYATYFTEDFKR 189

Query: 243 VKQSLYHLKFLAQGGTAVG--------TGLNTKVGFAEDIAEQVSKETGIDFKTAPNKFE 294
           +KQ    L     G  A+           L  ++GF++ I                N  +
Sbjct: 190 LKQIRERLNVSPLGCGALAGHPYGIDREFLAERLGFSDVIG---------------NSLQ 234

Query: 295 ALAAHDAVVEASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVN 354
           A++  D VVE     +     + + + D+  + S     + +LS      GSS+MP K N
Sbjct: 235 AVSDRDFVVEIMFWCSLFMNHISRFSEDL-IIYSTAEFNFVKLS-DAYSTGSSLMPQKKN 292

Query: 355 PTQNEAMTQVCVQVMGNHAAITFA 378
           P   E +     +V G+ A    +
Sbjct: 293 PDSLELLRGKSGRVFGSLAGFMMS 316

>TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.354
           YHR018C
          Length = 466

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 58/237 (24%), Positives = 91/237 (38%), Gaps = 21/237 (8%)

Query: 135 ANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHHLLPELEG 194
           ANE    R  E+IG  +  K        +  +S ND   + + I     +   LLP +  
Sbjct: 91  ANE---RRLGEIIGTHIAGK-------VHTGRSRNDQCVTDLRIYCRDILVEKLLPFMID 140

Query: 195 LKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSLYHLKFLA 254
           L   + ++++    I+  G THLQ A P+      S Y         R+KQ L  L    
Sbjct: 141 LVQVITKRAENEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLKQVLERLNKCP 200

Query: 255 QGGTAVGTGLNTKVGFAEDIAEQ-VSKETGIDFKTAPNKFEALAAHDAVVEASGALNTLA 313
            G  A+        G    I  Q +S E G +     N   A++  D +V+         
Sbjct: 201 LGAGAIA-------GHPYGIDRQYLSDELGFN-SIIGNSLVAVSDRDFIVDIMFWSTLFM 252

Query: 314 VSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMG 370
             + + + D+  + S    G+ +LS      GSS+MP K N    E +     +V G
Sbjct: 253 NHISRFSEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFG 307

>Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar to
           Ashbya gossypii ABL006C
          Length = 482

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 94/209 (44%), Gaps = 37/209 (17%)

Query: 188 LLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSL 247
           L+P+L  +   L   + +++ +  +G TH Q A   TLG+  + ++Q++   +    ++ 
Sbjct: 128 LIPKLVNVINRLSTFAIKYKDLPVLGWTHYQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 248 YHLKFLAQGGT--------AVGTGLNTKVGFAEDIAEQVSKETGIDF------KTAPNKF 293
             + F    GT        A+  G + KV   E + ++V++ +G D       +T   K 
Sbjct: 188 NDIGFRGVKGTTGTQASFLALFHGDHDKV---EALDKRVAELSGFDIIYPVTGQTYSRKV 244

Query: 294 EALAAHDAVVEASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLP--ENEPGSSIMPG 351
           +        ++  G L++ A +  K+A DIR L +       EL  P   ++ GSS M  
Sbjct: 245 D--------IDVLGPLSSFAATSHKLATDIRLLAN-----LKELEEPFEASQIGSSAMAY 291

Query: 352 KVNPTQNEAMTQVCVQVMGNHAAITFAGA 380
           K NP + E   +VC   +  H    ++GA
Sbjct: 292 KRNPMRCE---RVC--SLARHLGSLYSGA 315

>CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359w ADE13
          Length = 482

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 52/230 (22%), Positives = 100/230 (43%), Gaps = 33/230 (14%)

Query: 188 LLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSL 247
           ++P+L  +   L + + E++ +  +G TH Q A   TLG+  + ++Q++   +   +++ 
Sbjct: 128 VIPKLVNVINRLAKFALEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 248 YHLKFLAQGGT--------AVGTGLNTKVGFAEDIAEQVSKETGIDF------KTAPNKF 293
             +      GT        A+  G + KV   E++ E+V++  G D       +T   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKV---EELDERVTELLGFDTVYPVTGQTYSRKI 244

Query: 294 EALAAHDAVVEASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 353
           +        ++    L++ A S  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVLAPLSSFAASAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKR 293

Query: 354 NPTQNEAMTQVCVQVMGNHAAITFAGASGQFELNVFKPVMISNLLSSIRL 403
           NP + E   +VC   +  H    F+ A     +  F+  +  + +  I L
Sbjct: 294 NPMRCE---RVC--SLARHLGSLFSDAVQTASVQWFERTLDDSAIRRISL 338

>YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}
           ADE13Adenylosuccinate lyase, catalyzes two steps in the
           'de novo' purine nucleotide biosynthetic pathway;
           expression is repressed by adenine and activated by
           Bas1p and Pho2p; mutations in human ortholog ADSL cause
           adenylosuccinase deficiency
          Length = 482

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 51/224 (22%), Positives = 99/224 (44%), Gaps = 21/224 (9%)

Query: 188 LLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSL 247
           ++P+L  +   L + + E++ +  +G TH Q A   TLG+  + ++Q++   +   +++ 
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 248 YHLKFLAQGGT--------AVGTGLNTKVGFAEDIAEQVSKETGIDFKTAPNKFEALAAH 299
             +      GT        A+  G + KV   E + E+V++  G D K  P   +   + 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKV---EALDERVTELLGFD-KVYPVTGQTY-SR 242

Query: 300 DAVVEASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 359
              ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 243 KIDIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

Query: 360 AMTQVCVQVMGNHAAITFAGASGQFELNVFKPVMISNLLSSIRL 403
              +VC   +  H    F+ A     +  F+  +  + +  I L
Sbjct: 300 ---RVC--SLARHLGSLFSDAVQTASVQWFERTLDDSAIRRISL 338

>KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa]
           {ON} highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 465

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 59/249 (23%), Positives = 98/249 (39%), Gaps = 20/249 (8%)

Query: 123 FQTGSGTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVT 182
           F    G +    ANE    R  E+IG  +  K        +  +S ND   + M I    
Sbjct: 81  FVEKDGDEDIHTANE---RRLGEIIGRHIAGK-------VHTGRSRNDQVATDMRIYC-R 129

Query: 183 EITHHLLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIAR 242
           E   ++   L+ L  A+ Q++++    +  G THLQ A P+      + Y         R
Sbjct: 130 EALDNMAKILKDLVGAILQRAEQEIDALMPGYTHLQRAQPIRWSHWLNLYATYFTEDFKR 189

Query: 243 VKQSLYHLKFLAQGGTAVGTGLNTKVGFAEDIAEQVSKETGIDFKTAPNKFEALAAHDAV 302
           +KQ    L       + +G G      +  D  E +++  G D     N  +A++  D V
Sbjct: 190 LKQIRERLNV-----SPLGCGALAGHPYGID-REHIAERLGFD-GVIGNSLQAVSDRDFV 242

Query: 303 VEASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMT 362
           VE     +     + + + D+  + S     + +LS      GSS+MP K NP   E + 
Sbjct: 243 VEILFWCSLFMNHISRFSEDL-IIYSTAEFNFVKLS-DAYSTGSSLMPQKKNPDSLELLR 300

Query: 363 QVCVQVMGN 371
               +V G+
Sbjct: 301 GKSGRVFGS 309

>Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 51/224 (22%), Positives = 98/224 (43%), Gaps = 21/224 (9%)

Query: 188 LLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSL 247
           ++P+L  +   L + + E++ +  +G TH Q A   TLG+  + ++Q++   +   +++ 
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 248 YHLKFLAQGGT--------AVGTGLNTKVGFAEDIAEQVSKETGIDFKTAPNKFEALAAH 299
             +      GT        A+  G + KV   E + E+V++  G D K  P   +   + 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKV---EALDERVTELLGFD-KVYPVTGQTY-SR 242

Query: 300 DAVVEASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 359
              ++    L++ A +  K+A DIR L +       E    + + GSS M  K NP + E
Sbjct: 243 KIDIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKRNPMRCE 299

Query: 360 AMTQVCVQVMGNHAAITFAGASGQFELNVFKPVMISNLLSSIRL 403
              +VC   +  H    F+ A     +  F+  +  + +  I L
Sbjct: 300 ---RVC--SLARHLGSLFSDAVQTASVQWFERTLDDSAIRRISL 338

>TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.354
           YHR018C
          Length = 465

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 55/241 (22%), Positives = 93/241 (38%), Gaps = 19/241 (7%)

Query: 135 ANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHHLLPELEG 194
           ANE    R  E+IG  +  K        +  +S ND   + + I     +   L P+L+ 
Sbjct: 91  ANE---RRLGEIIGRNIAGK-------VHTGRSRNDQCVTDLRIYCRDLLNDKLFPDLQA 140

Query: 195 LKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSLYHLKFLA 254
           L   + ++  E   ++  G THLQ A P+      S Y         R++Q +  +    
Sbjct: 141 LVDVMIKRGKEEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDFKRLRQIMDRIN--- 197

Query: 255 QGGTAVGTGLNTKVGFAEDIAEQVSKETGIDFKTAPNKFEALAAHDAVVEASGALNTLAV 314
              + +G G      +  D  E ++   G D     N   A++  D +VE          
Sbjct: 198 --QSPLGAGALAGHPYGID-REFLAAGLGFD-GVIGNSLVAVSDRDFIVELMFWGTLFMN 253

Query: 315 SLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNHAA 374
            + + A D+  + S    G+ +L+      GSS+MP K N    E +     +V G+ A 
Sbjct: 254 HISRFAEDL-IIYSTAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGDLAG 311

Query: 375 I 375
            
Sbjct: 312 F 312

>SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly
           similar to uniprot|Q05911 Saccharomyces cerevisiae
           YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
           in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 38.9 bits (89), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 52/230 (22%), Positives = 98/230 (42%), Gaps = 33/230 (14%)

Query: 188 LLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSL 247
           L+P+L  +   L Q + E++ +  +G TH Q A   TLG+  + ++Q++   +    ++ 
Sbjct: 128 LIPKLVNVINRLSQFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 248 YHLKFLAQGGT--------AVGTGLNTKVGFAEDIAEQVSKETGIDF------KTAPNKF 293
             +      GT        A+  G + KV   E + ++V++  G D       +T   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKV---EALDKRVTELLGFDTVYPVTGQTYSRKI 244

Query: 294 EALAAHDAVVEASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 353
           +        ++    L++ A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVLAPLSSFAATAHKMATDIRLLANLKEM---EEPFEKSQIGSSAMAYKR 293

Query: 354 NPTQNEAMTQVCVQVMGNHAAITFAGASGQFELNVFKPVMISNLLSSIRL 403
           NP + E   +VC   +  H    F+ A     +  F+  +  + +  I L
Sbjct: 294 NPMRCE---RVC--SLARHLGSLFSDAVQTASVQWFERTLDDSAIRRISL 338

>TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 38.9 bits (89), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 52/232 (22%), Positives = 99/232 (42%), Gaps = 33/232 (14%)

Query: 188 LLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSL 247
           ++P+L  +   L + + E++ +  +G TH Q A   TLG+  + ++Q++   +    ++ 
Sbjct: 128 IIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRSTLWIQELLWDLRNFVRAR 187

Query: 248 YHLKFLAQGGT--------AVGTGLNTKVGFAEDIAEQVSKETGIDF------KTAPNKF 293
             L      GT        A+  G + KV   E++ E+V++  G D       +T   K 
Sbjct: 188 NDLGLRGVKGTTGTQASFLALFHGNHDKV---EELDERVTELLGFDTVYPVTGQTYSRKI 244

Query: 294 EALAAHDAVVEASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 353
           +        ++    L + A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVLAPLASFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKR 293

Query: 354 NPTQNEAMTQVCVQVMGNHAAITFAGASGQFELNVFKPVMISNLLSSIRLLG 405
           NP + E   +VC   +  H    ++ A     +  F+  +  + +  I L G
Sbjct: 294 NPMRCE---RVC--SLARHLGSLYSDAVQTASVQWFERTLDDSAIRRISLPG 340

>Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 38.5 bits (88), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 86/186 (46%), Gaps = 19/186 (10%)

Query: 188 LLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSL 247
           ++P+L  +   L + + E++ +  +G TH Q A   TLG+  + ++Q++   +   +++ 
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDLRNFERAR 187

Query: 248 YHLKFLAQGGT--------AVGTGLNTKVGFAEDIAEQVSKETGIDFKTAPNKFEALAAH 299
             +      GT        A+  G + KV   E + E+V++  G D K  P   +   + 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKV---EALDERVTELLGFD-KVYPVTGQTY-SR 242

Query: 300 DAVVEASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 359
              ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 243 KIDIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

Query: 360 AMTQVC 365
              +VC
Sbjct: 300 ---RVC 302

>Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 37.4 bits (85), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 50/224 (22%), Positives = 98/224 (43%), Gaps = 21/224 (9%)

Query: 188 LLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSL 247
           ++P+L  +   L + + E++ +  +G TH Q A   TLG+  + ++Q++   +   +++ 
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 248 YHLKFLAQGGT--------AVGTGLNTKVGFAEDIAEQVSKETGIDFKTAPNKFEALAAH 299
             +      GT        A+  G + KV   E +  +V++  G D K  P   +   + 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKV---EALDARVTELLGFD-KVYPVTGQTY-SR 242

Query: 300 DAVVEASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 359
              ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 243 KIDIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

Query: 360 AMTQVCVQVMGNHAAITFAGASGQFELNVFKPVMISNLLSSIRL 403
              +VC   +  H    F+ A     +  F+  +  + +  I L
Sbjct: 300 ---RVC--SLARHLGSLFSDAVQTASVQWFERTLDDSAIRRISL 338

>NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4.197
           YLR359W
          Length = 482

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 52/232 (22%), Positives = 100/232 (43%), Gaps = 37/232 (15%)

Query: 188 LLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSL 247
           ++P+L  +   L + + E++ +  +G TH Q A   TLG+  + ++Q++   +    ++ 
Sbjct: 128 VIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFVRAR 187

Query: 248 YHLKFLAQGGT--------AVGTGLNTKVGFAEDIAEQVSKETGIDF------KTAPNKF 293
             +      GT        A+  G + KV   E + ++V++  G D       +T   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKV---EALDKRVTELLGFDTVYPVTGQTYSRKI 244

Query: 294 EALAAHDAVVEASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLP--ENEPGSSIMPG 351
           +        ++    L++ A +  K+A DIR L +       EL  P  +++ GSS M  
Sbjct: 245 D--------IDVLAPLSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAMAY 291

Query: 352 KVNPTQNEAMTQVCVQVMGNHAAITFAGASGQFELNVFKPVMISNLLSSIRL 403
           K NP + E   +VC   +  H    F+ A     +  F+  +  + +  I L
Sbjct: 292 KRNPMRCE---RVC--SLARHLGSLFSDAVQTASVQWFERTLDDSAIRRISL 338

>KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa]
           {ON} highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359W ADE13 Adenylosuccinate lyase
           catalyzes two steps in the 'de novo' purine nucleotide
           biosynthetic pathway
          Length = 482

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 78/183 (42%), Gaps = 13/183 (7%)

Query: 188 LLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSL 247
           L+P+L  +   L + + E++ +  +G TH Q A   TLG+  + ++Q++   +    ++ 
Sbjct: 128 LIPKLVNVINRLSKFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 248 YHLKFL-AQGGTAVGTGLNTKVGFAEDIAEQVSKETG--IDFKTAPNKFEALAAHDAVVE 304
             +     +G T       T      D  E + K     + F T         +    ++
Sbjct: 188 NDIGLRGVKGTTGTQASFLTLFHGDHDKVEALDKRVAELLGFSTVYPVTGQTYSRKIDID 247

Query: 305 ASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLP--ENEPGSSIMPGKVNPTQNEAMT 362
               L++ A +  K+A DIR L +       EL  P  +++ GSS M  K NP + E   
Sbjct: 248 VLAPLSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAMAYKRNPMRCE--- 299

Query: 363 QVC 365
           +VC
Sbjct: 300 RVC 302

>Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359W
           (ADE13) - Adenylosuccinate Lyase [contig 198] FULL
          Length = 482

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 48/227 (21%), Positives = 95/227 (41%), Gaps = 27/227 (11%)

Query: 188 LLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSL 247
           L+P+L  +   L + + E++ +  +G TH Q A   TLG+  + ++Q++   +    ++ 
Sbjct: 128 LIPKLVNVIDRLSKFAMEWKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 248 YHLKFLAQGGTAVGTG-----LNTKVGFAEDIAEQVSKETGIDF------KTAPNKFEAL 296
             +      GT    G      ++     E + ++V++  G D       +T   K +  
Sbjct: 188 NDIGLRGVKGTTGTQGSFLALFHSDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKID-- 245

Query: 297 AAHDAVVEASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPT 356
                 ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP 
Sbjct: 246 ------IDVLAPLSSFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRNPM 296

Query: 357 QNEAMTQVCVQVMGNHAAITFAGASGQFELNVFKPVMISNLLSSIRL 403
           + E   +VC   +  H    F+ A     +  F+  +  + +  I L
Sbjct: 297 RCE---RVC--SLARHLGSLFSDAVQTASVQWFERTLDDSAIRRISL 338

>Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON}
           (40749..42197) [1449 nt, 483 aa]
          Length = 482

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 50/232 (21%), Positives = 98/232 (42%), Gaps = 33/232 (14%)

Query: 188 LLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSL 247
           ++P+L  +   L + + E++ +  +G TH Q A   T+G+  + ++Q++   +    ++ 
Sbjct: 128 IIPKLVNVIDRLAKFASEYKDLPVLGWTHFQPAQLTTMGKRATLWIQELLWDLRNFVRAR 187

Query: 248 YHLKFLAQGGT--------AVGTGLNTKVGFAEDIAEQVSKETGIDF------KTAPNKF 293
             +      GT        A+  G + KV   E + ++V +  G D       +T   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDDDKV---EALDKRVVELLGFDTVYPVTGQTYSRKI 244

Query: 294 EALAAHDAVVEASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 353
           +        ++    L++ A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKR 293

Query: 354 NPTQNEAMTQVCVQVMGNHAAITFAGASGQFELNVFKPVMISNLLSSIRLLG 405
           NP + E   +VC   +  H    F+ A     +  F+  +  + +  I L G
Sbjct: 294 NPMRCE---RVC--SLARHLGSLFSDAVQTASVQWFERTLDDSAIRRISLPG 340

>TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa]
           {ON} Anc_4.197 YLR359W
          Length = 482

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 50/213 (23%), Positives = 94/213 (44%), Gaps = 33/213 (15%)

Query: 188 LLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSL 247
           ++P+L  +   L   + E++ +  +G TH Q A   TLG+  + ++Q++   +   +++ 
Sbjct: 128 VIPKLVNVINRLANFALEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 248 YHLKFLAQGGT--------AVGTGLNTKVGFAEDIAEQVSKETGIDF------KTAPNKF 293
             +      GT        A+  G + KV   E++ E+V +  G D       +T   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKV---EELDERVVELLGFDTVYPVTGQTYSRKI 244

Query: 294 EALAAHDAVVEASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 353
           +        ++    L + A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVVSPLVSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKR 293

Query: 354 NPTQNEAMTQVC--VQVMGNHAAITFAGASGQF 384
           NP + E   +VC   + +G+  + T   AS Q+
Sbjct: 294 NPMRCE---RVCSLARHLGSLLSDTVQTASVQW 323

>NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4.197
           YLR359W
          Length = 482

 Score = 35.8 bits (81), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 50/230 (21%), Positives = 97/230 (42%), Gaps = 33/230 (14%)

Query: 188 LLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSL 247
           ++P+L  +   L + + E++ +  +G TH Q A   TLG+  + ++Q++   +    ++ 
Sbjct: 128 IIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 248 YHLKFLAQGGT--------AVGTGLNTKVGFAEDIAEQVSKETGIDF------KTAPNKF 293
             +      GT        A+  G + KV   E + ++V++  G D       +T   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKV---EALDKRVTELLGFDTVYPVTGQTYSRKI 244

Query: 294 EALAAHDAVVEASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 353
           +        ++    L + A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVLAPLASFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKR 293

Query: 354 NPTQNEAMTQVCVQVMGNHAAITFAGASGQFELNVFKPVMISNLLSSIRL 403
           NP + E   +VC   +  H    F+ A     +  F+  +  + +  I L
Sbjct: 294 NPMRCE---RVC--SLARHLGSLFSDAVQTASVQWFERTLDDSAIRRISL 338

>KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 35.8 bits (81), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 50/230 (21%), Positives = 98/230 (42%), Gaps = 33/230 (14%)

Query: 188 LLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSL 247
           ++P+L  +   L + + +++ +  +G TH Q A   TLG+  + ++Q++   +    ++ 
Sbjct: 128 VIPKLVNVIDRLSKFALQYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDLRNFVRAR 187

Query: 248 YHLKFLAQGGT--------AVGTGLNTKVGFAEDIAEQVSKETGIDF------KTAPNKF 293
             +      GT        A+  G + KV   E + ++V++  G D       +T   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKV---EALDKRVTELLGFDTVYPVTGQTYSRKI 244

Query: 294 EALAAHDAVVEASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 353
           +        ++    L++ A S  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVLAPLSSFAASAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKR 293

Query: 354 NPTQNEAMTQVCVQVMGNHAAITFAGASGQFELNVFKPVMISNLLSSIRL 403
           NP + E   +VC   +  H    F+ A     +  F+  +  + +  I L
Sbjct: 294 NPMRCE---RVC--SLARHLGSLFSDAVQTASVQWFERTLDDSAIRRISL 338

>KLTH0A03344g Chr1 (289188..290636) [1449 bp, 482 aa] {ON} highly
           similar to uniprot|Q05911 Saccharomyces cerevisiae
           YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
           in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 35.0 bits (79), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 84/192 (43%), Gaps = 31/192 (16%)

Query: 188 LLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSL 247
           L+P+L  +   L Q + +++ +  +G TH Q A   TLG+  + ++Q++   +    ++ 
Sbjct: 128 LIPKLVNVINRLSQFALQWKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 248 YHLKFLAQGGT--------AVGTGLNTKVGFAEDIAEQVSKETGIDF------KTAPNKF 293
             +      GT        A+  G + KV   E + ++V++  G D       +T   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKV---EALDKRVTELLGFDTVYPVTGQTYSRKI 244

Query: 294 EALAAHDAVVEASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 353
           +        ++    L + A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVLAPLCSFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKR 293

Query: 354 NPTQNEAMTQVC 365
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa]
           {ON} Anc_4.197 YLR359W
          Length = 482

 Score = 35.0 bits (79), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 73/168 (43%), Gaps = 31/168 (18%)

Query: 212 IGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSLYHLKFLAQGGT--------AVGTG 263
           +G TH Q A   TLG+  + ++Q++   +   +++   +      GT        A+  G
Sbjct: 152 LGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERARNDIGLRGVKGTTGTQASFLALFHG 211

Query: 264 LNTKVGFAEDIAEQVSKETGIDF------KTAPNKFEALAAHDAVVEASGALNTLAVSLF 317
            + KV   E + E+V +  G D       +T   K +        ++A   L++ A +  
Sbjct: 212 DHNKV---EKLDERVVELLGFDTVYPVTGQTYSRKID--------IDAFAPLSSFAATAH 260

Query: 318 KIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVC 365
           K+A DIR L +       E    +++ GSS M  K NP + E   +VC
Sbjct: 261 KMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE---RVC 302

>TDEL0E01760 Chr5 complement(337315..338763) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 33.9 bits (76), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 49/230 (21%), Positives = 97/230 (42%), Gaps = 33/230 (14%)

Query: 188 LLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSL 247
           ++P+L  +   L   + +++ +  +G TH Q A   TLG+  + ++Q++   +    ++ 
Sbjct: 128 IIPKLVNVINRLSDFALKYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 248 YHLKFLAQGGT--------AVGTGLNTKVGFAEDIAEQVSKETGIDF------KTAPNKF 293
             +      GT        A+  G + KV   E + ++V++  G D       +T   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKV---EALDKRVTELLGFDTVYPVTGQTYSRKI 244

Query: 294 EALAAHDAVVEASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 353
           +        ++    L++ A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVLSPLSSFAATAHKMATDIRLLANLKEM---EEPFEKSQIGSSAMAYKR 293

Query: 354 NPTQNEAMTQVCVQVMGNHAAITFAGASGQFELNVFKPVMISNLLSSIRL 403
           NP + E   +VC   +  H    F+ A     +  F+  +  + +  I L
Sbjct: 294 NPMRCE---RVC--SLARHLGSLFSDAVQTASVQWFERTLDDSAIRRISL 338

>ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359W ADE13 Adenylosuccinate lyase
           catalyzes two steps in the 'de novo' purine nucleotide
           biosynthetic pathway
          Length = 482

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 42/186 (22%), Positives = 81/186 (43%), Gaps = 19/186 (10%)

Query: 188 LLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSL 247
           ++P+L  +   L + +  ++ +  +G TH Q A   TLG+  + ++Q +   +    ++ 
Sbjct: 128 IIPKLINVIDRLSKFALNYKDVPVLGWTHFQPAQLTTLGKRVTLWIQDLLWDLRNFDRAR 187

Query: 248 YHLKFLAQGGT--------AVGTGLNTKVGFAEDIAEQVSKETGIDFKTAPNKFEALAAH 299
             +      GT        A+  G + KV   E++ ++V++  G  F+T         + 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKV---EELDQRVTELLG--FETVYPVTGQTYSR 242

Query: 300 DAVVEASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 359
              ++    L + A +  K+A DIR L +       E    + + GSS M  K NP + E
Sbjct: 243 KIDIDVLAPLASFAATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKRNPMRCE 299

Query: 360 AMTQVC 365
              +VC
Sbjct: 300 ---RVC 302

>Kpol_543.28 s543 complement(57467..58354) [888 bp, 295 aa] {ON}
           complement(57467..58354) [888 nt, 296 aa]
          Length = 295

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 25/50 (50%)

Query: 46  DKYWGAQTQRSLQNFKIGGPRERMPEPIVKAFGVLKKSAAVVNERLGTLD 95
           D  WG  +  S+    I  P    P+  +++ GVL+K   +VN RL  +D
Sbjct: 176 DLTWGTNSNISIDEHDILEPEMITPDKFLESSGVLRKYNELVNLRLNLID 225

>Kwal_23.4002 s23 complement(521323..524961) [3639 bp, 1212 aa] {ON}
           YGR090W - Protein required for cell viability [contig
           255] FULL
          Length = 1212

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 42/94 (44%), Gaps = 5/94 (5%)

Query: 126 GSGTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEIT 185
           GS ++ N        N  +    G   +KK+ PN +C + Q   DT   + + + ++  T
Sbjct: 271 GSSSEYNFFKTNFSINILVGFPYGFFDAKKLLPNKNCIRVQEDKDTSTPLYNFSVLSSST 330

Query: 186 H-HLLPELEGLKVALKQKSDEFQHIVKIGRTHLQ 218
           H H L  L       K++++ F+    +G+  L+
Sbjct: 331 HEHYLKFL----YKTKKQTEAFKDACMLGKLWLK 360

>KLLA0D15081g Chr4 (1271696..1274728) [3033 bp, 1010 aa] {ON} some
           similarities with Saccharomyces cerevisiae YPR115W
           Hypothetical ORF and to YGR097W uniprot|P48361
           Saccharomyces cerevisiae YGR097W ASK10 Component of the
           RNA polymerase II holoenzyme phosphorylated in response
           to oxidative stress has a role in destruction of Ssn8p
           which relieves repression of stress-response genes
          Length = 1010

 Score = 30.8 bits (68), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 52/115 (45%), Gaps = 21/115 (18%)

Query: 138 VISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAV---------------- 181
            ++N +I+L G EL   ++ PN+ C+ A   N    S+  I  +                
Sbjct: 218 TLNNSSIDL-GQEL---QLEPNDSCSGAGFMNFGSGSIQDIQVILKKYHLSLASQQVKSS 273

Query: 182 TEITHHLLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQV 236
            EIT  ++P+LE L+  L  K  E + +    +T++Q+   LT GQ    Y+  V
Sbjct: 274 KEITLQIIPKLEDLRKDLSHKIKEIKELNADFKTNIQEHVALT-GQLLHKYIAAV 327

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,067,046
Number of extensions: 1919565
Number of successful extensions: 5393
Number of sequences better than 10.0: 68
Number of HSP's gapped: 5515
Number of HSP's successfully gapped: 68
Length of query: 492
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 378
Effective length of database: 40,409,475
Effective search space: 15274781550
Effective search space used: 15274781550
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)