Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D00880g6.12ON71713733e-48
Ecym_30156.12ON70712023e-22
SAKL0E00924g6.12ON97781966e-21
KLTH0C11484g6.12ON89721912e-20
Kwal_56.223596.12ON91721783e-18
YEL059C-A (SOM1)6.12ON74731763e-18
ACR014C6.12ON70701684e-17
Suva_5.96.12ON73731685e-17
Smik_5.286.12ON74731686e-17
Skud_5.306.12ON74731642e-16
ZYRO0F00528g6.12ON77771287e-11
TDEL0G045906.12ON74751243e-10
KAFR0L003506.12ON71671216e-10
TPHA0M002206.12ON78601094e-08
KNAG0E009306.12ON109571062e-07
Kpol_1032.36.12ON78801026e-07
NCAS0F002106.12ON7983931e-05
TBLA0G009906.12ON7879572.7
Smik_3.991.429ON58132583.5
YDR270W (CCC2)5.636ON100461576.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D00880g
         (71 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D00880g Chr4 (82211..82426) [216 bp, 71 aa] {ON} uniprot|P7...   148   3e-48
Ecym_3015 Chr3 (30115..30327) [213 bp, 70 aa] {ON} similar to As...    82   3e-22
SAKL0E00924g Chr5 (70494..70787) [294 bp, 97 aa] {ON} similar to...    80   6e-21
KLTH0C11484g Chr3 complement(944502..944771) [270 bp, 89 aa] {ON...    78   2e-20
Kwal_56.22359 s56 (64674..64949) [276 bp, 91 aa] {ON} YEL059C-A ...    73   3e-18
YEL059C-A Chr5 complement(42400..42624) [225 bp, 74 aa] {ON}  SO...    72   3e-18
ACR014C Chr3 complement(382776..382988) [213 bp, 70 aa] {ON} Syn...    69   4e-17
Suva_5.9 Chr5 complement(18353..18571) [219 bp, 73 aa] {ON} YEL0...    69   5e-17
Smik_5.28 Chr5 complement(44691..44912) [222 bp, 74 aa] {ON} YEL...    69   6e-17
Skud_5.30 Chr5 complement(41436..41657) [222 bp, 74 aa] {ON} YEL...    68   2e-16
ZYRO0F00528g Chr6 (51411..51644) [234 bp, 77 aa] {ON} similar to...    54   7e-11
TDEL0G04590 Chr7 complement(838052..838276) [225 bp, 74 aa] {ON}...    52   3e-10
KAFR0L00350 Chr12 (63897..64112) [216 bp, 71 aa] {ON} Anc_6.12 Y...    51   6e-10
TPHA0M00220 Chr13 (44225..44461) [237 bp, 78 aa] {ON} Anc_6.12 Y...    47   4e-08
KNAG0E00930 Chr5 complement(176364..176693) [330 bp, 109 aa] {ON...    45   2e-07
Kpol_1032.3 s1032 (3019..3255) [237 bp, 78 aa] {ON} (3019..3255)...    44   6e-07
NCAS0F00210 Chr6 (32317..32556) [240 bp, 79 aa] {ON} Anc_6.12 YE...    40   1e-05
TBLA0G00990 Chr7 (251428..251664) [237 bp, 78 aa] {ON} Anc_6.12 ...    27   2.7  
Smik_3.99 Chr3 complement(139083..140828) [1746 bp, 581 aa] {ON}...    27   3.5  
YDR270W Chr4 (1005675..1008689) [3015 bp, 1004 aa] {ON}  CCC2Cu(...    27   6.3  

>KLLA0D00880g Chr4 (82211..82426) [216 bp, 71 aa] {ON}
          uniprot|P78699 Kluyveromyces lactis KLLA0D00880g SOM1
          Protein SOM1 mitochondrial precursor
          Length = 71

 Score =  148 bits (373), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 71/71 (100%), Positives = 71/71 (100%)

Query: 1  MAPPTKILGLDTQQRMLQRGENCSLKSLVQNECAFNGNDYVCTPFKRLFEQCMVKDGRVL 60
          MAPPTKILGLDTQQRMLQRGENCSLKSLVQNECAFNGNDYVCTPFKRLFEQCMVKDGRVL
Sbjct: 1  MAPPTKILGLDTQQRMLQRGENCSLKSLVQNECAFNGNDYVCTPFKRLFEQCMVKDGRVL 60

Query: 61 NIEVTNLNTNR 71
          NIEVTNLNTNR
Sbjct: 61 NIEVTNLNTNR 71

>Ecym_3015 Chr3 (30115..30327) [213 bp, 70 aa] {ON} similar to
          Ashbya gossypii ACR014C
          Length = 70

 Score = 82.4 bits (202), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 38/71 (53%), Positives = 53/71 (74%), Gaps = 1/71 (1%)

Query: 1  MAPPTKILGLDTQQRMLQRGENCSLKSLVQNECAFNGNDYVCTPFKRLFEQCMVKDGRVL 60
          MAPPT I+  D  + +L R ++C L SL+QNEC F+G++YVC PFKRLFE+C +   RV 
Sbjct: 1  MAPPTPIITRDEVEPILSRTKDCILASLIQNECHFDGHNYVCIPFKRLFEECTLNKRRV- 59

Query: 61 NIEVTNLNTNR 71
           IEVT+++TN+
Sbjct: 60 RIEVTDISTNQ 70

>SAKL0E00924g Chr5 (70494..70787) [294 bp, 97 aa] {ON} similar to
          uniprot|Q05676 Saccharomyces cerevisiae YEL059C-A SOM1
          Protein whose overexpression suppresses the imp1
          mutation may be required for the function of the Imp1p
          mitochondrial inner membrane peptidase and/or the
          protein sorting machinery
          Length = 97

 Score = 80.1 bits (196), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 38/78 (48%), Positives = 56/78 (71%), Gaps = 8/78 (10%)

Query: 1  MAPPTKILGLDTQQRMLQRGEN-CSLKSLVQNECAFNGNDYVCTPFKRLFEQCMV----K 55
          MAPPT + G D  + +L++ +  C+LKSL+QNEC FNG +Y+C PFKRLF++C++    K
Sbjct: 1  MAPPTPVFGKDELESLLKKVKPPCTLKSLIQNECTFNGEEYICVPFKRLFKECLLDSKTK 60

Query: 56 DG---RVLNIEVTNLNTN 70
          DG   R + IE+T+ +TN
Sbjct: 61 DGRTSRTVRIEITDRHTN 78

>KLTH0C11484g Chr3 complement(944502..944771) [270 bp, 89 aa] {ON}
          similar to uniprot|Q05676 Saccharomyces cerevisiae
          YEL059C-A SOM1 Protein whose overexpression suppresses
          the imp1 mutation may be required for the function of
          the Imp1p mitochondrial inner membrane peptidase and/or
          the protein sorting machinery
          Length = 89

 Score = 78.2 bits (191), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 52/72 (72%), Gaps = 2/72 (2%)

Query: 1  MAPPTKILGLDTQQRMLQRG-ENCSLKSLVQNECAFNGNDYVCTPFKRLFEQCMVKDGRV 59
          MAPPT + G +  + + ++  E C LK+LVQNEC FNG++YVCTPFKRLF++C     R+
Sbjct: 1  MAPPTLVFGKEELKGIWEKAAEPCFLKALVQNECEFNGHEYVCTPFKRLFKECGAGK-RI 59

Query: 60 LNIEVTNLNTNR 71
          + IEVT+ +TN 
Sbjct: 60 VRIEVTDQDTNH 71

>Kwal_56.22359 s56 (64674..64949) [276 bp, 91 aa] {ON} YEL059C-A
          (SOM1) - involved in mitochondrial inner peptidase
          function [contig 186] FULL
          Length = 91

 Score = 73.2 bits (178), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 35/72 (48%), Positives = 50/72 (69%), Gaps = 2/72 (2%)

Query: 1  MAPPTKILGLDTQQRMLQR-GENCSLKSLVQNECAFNGNDYVCTPFKRLFEQCMVKDGRV 59
          MAPPT + G +  + +L+     C  KSL Q+EC F+G+ YVC PFKR+F++C V DG+ 
Sbjct: 1  MAPPTVVFGKEELEPLLRNVMATCIFKSLTQSECNFDGHQYVCVPFKRVFKECKV-DGKS 59

Query: 60 LNIEVTNLNTNR 71
          + IEVT+ NTN+
Sbjct: 60 IRIEVTDRNTNK 71

>YEL059C-A Chr5 complement(42400..42624) [225 bp, 74 aa] {ON}
          SOM1Subunit of the mitochondrial inner membrane
          peptidase, which is required for maturation of
          mitochondrial proteins of the intermembrane space;
          Som1p facilitates cleavage of a subset of substrates;
          contains twin cysteine-x9-cysteine motifs
          Length = 74

 Score = 72.4 bits (176), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 37/73 (50%), Positives = 41/73 (56%), Gaps = 3/73 (4%)

Query: 1  MAPPTKILGLD---TQQRMLQRGENCSLKSLVQNECAFNGNDYVCTPFKRLFEQCMVKDG 57
          MAPPT I   D        L    NC LK LVQ EC F G +YVC+PFKRLFE C+  D 
Sbjct: 1  MAPPTTIRTRDQALAPLATLDSQTNCRLKELVQWECQFKGAEYVCSPFKRLFEHCIAPDK 60

Query: 58 RVLNIEVTNLNTN 70
             N EVT+  TN
Sbjct: 61 SATNYEVTDTYTN 73

>ACR014C Chr3 complement(382776..382988) [213 bp, 70 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YEL059C-A
          (SOM1)
          Length = 70

 Score = 69.3 bits (168), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 1  MAPPTKILGLDTQQRMLQRGENCSLKSLVQNECAFNGNDYVCTPFKRLFEQCMVKDGRVL 60
          MAPPT +L  +     L    +C L SL QNEC F+G  YVC PF+RLF +C +   RV 
Sbjct: 1  MAPPTPVLTREEVAPALATSRDCVLASLTQNECHFDGRGYVCVPFQRLFRECTLNKRRV- 59

Query: 61 NIEVTNLNTN 70
           IE+T  NTN
Sbjct: 60 RIEITERNTN 69

>Suva_5.9 Chr5 complement(18353..18571) [219 bp, 73 aa] {ON}
          YEL059C-A (REAL)
          Length = 73

 Score = 69.3 bits (168), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 39/73 (53%), Gaps = 3/73 (4%)

Query: 1  MAPPTKILGLD---TQQRMLQRGENCSLKSLVQNECAFNGNDYVCTPFKRLFEQCMVKDG 57
          MAPPT I   D        L    +C LK LVQ EC F G DYVC+PF+RLFE C     
Sbjct: 1  MAPPTTIRARDQALAPLATLDSRTHCHLKELVQWECQFKGADYVCSPFRRLFEHCTAPGE 60

Query: 58 RVLNIEVTNLNTN 70
             N EVT+  TN
Sbjct: 61 AATNYEVTDTYTN 73

>Smik_5.28 Chr5 complement(44691..44912) [222 bp, 74 aa] {ON}
          YEL059C-A (REAL)
          Length = 74

 Score = 69.3 bits (168), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 40/73 (54%), Gaps = 3/73 (4%)

Query: 1  MAPPTKILGLD---TQQRMLQRGENCSLKSLVQNECAFNGNDYVCTPFKRLFEQCMVKDG 57
          MAPPT I   D        L    +C LK LVQ EC F G DYVC+PFKRLFE C+    
Sbjct: 1  MAPPTTIRSRDQALAPLMALDSQASCQLKELVQWECQFKGADYVCSPFKRLFEHCVEHGK 60

Query: 58 RVLNIEVTNLNTN 70
             N EVT+  TN
Sbjct: 61 PATNYEVTDTYTN 73

>Skud_5.30 Chr5 complement(41436..41657) [222 bp, 74 aa] {ON}
          YEL059C-A (REAL)
          Length = 74

 Score = 67.8 bits (164), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 39/73 (53%), Gaps = 3/73 (4%)

Query: 1  MAPPTKILGLD---TQQRMLQRGENCSLKSLVQNECAFNGNDYVCTPFKRLFEQCMVKDG 57
          MAPPT I   D        L     C LK LVQ EC F   DYVC PFKRLFE+C+  D 
Sbjct: 1  MAPPTTIRSRDQALAPLAALDSHTRCQLKELVQWECQFREADYVCFPFKRLFERCIAPDK 60

Query: 58 RVLNIEVTNLNTN 70
             + EVT+  TN
Sbjct: 61 SATDYEVTDTYTN 73

>ZYRO0F00528g Chr6 (51411..51644) [234 bp, 77 aa] {ON} similar to
          uniprot|Q05676 Saccharomyces cerevisiae YEL059C-A
          Length = 77

 Score = 53.9 bits (128), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 44/77 (57%), Gaps = 12/77 (15%)

Query: 1  MAPPTKILGLDTQQR------MLQRGENCSLKSLVQNEC-AFNGNDYVCTPFKRLFEQCM 53
          MAPPT IL  +   R      +L+    C LKSL Q+ C A    +Y+C PFKR+FE+C+
Sbjct: 1  MAPPTPILTSEQVSRERERVQILKEKNKCELKSLTQHLCHAEAPGEYICVPFKRVFEKCL 60

Query: 54 VKDGRVLNIEVTNLNTN 70
             G  L  EVT+ +TN
Sbjct: 61 ---GHAL--EVTDADTN 72

>TDEL0G04590 Chr7 complement(838052..838276) [225 bp, 74 aa] {ON}
          Anc_6.12 YEL059C-A
          Length = 74

 Score = 52.4 bits (124), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 41/75 (54%), Gaps = 5/75 (6%)

Query: 1  MAPPTKILGLDTQQRMLQRGENCSLKSLVQNECAFNGND---YVCTPFKRLFEQCMVKDG 57
          MAPPT +L  +    + Q  +NC LKSL Q +C         Y C PFKRLF++C    G
Sbjct: 1  MAPPTPVLAREELPEIPQ-SKNCVLKSLTQFQCQLRPAGSGLYECVPFKRLFQECRDPSG 59

Query: 58 RVLN-IEVTNLNTNR 71
          R  + IEVT+  TN 
Sbjct: 60 RFKSRIEVTSPLTNH 74

>KAFR0L00350 Chr12 (63897..64112) [216 bp, 71 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 71

 Score = 51.2 bits (121), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 38/67 (56%), Gaps = 1/67 (1%)

Query: 1  MAPPTKILGLDTQQRMLQRGENCSLKSLVQNECAFN-GNDYVCTPFKRLFEQCMVKDGRV 59
          MAP  +++  D  +R ++  E C L SLVQ  C +  G    C PFKR+F +C+ K G++
Sbjct: 1  MAPMIRVMDGDAAEREVKGAEGCQLYSLVQYNCEYRVGGTLECFPFKRMFLECLDKSGKL 60

Query: 60 LNIEVTN 66
            +E  +
Sbjct: 61 KRVETRS 67

>TPHA0M00220 Chr13 (44225..44461) [237 bp, 78 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 78

 Score = 46.6 bits (109), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 31/60 (51%), Gaps = 8/60 (13%)

Query: 1  MAPPTKILGLDTQQRMLQRG-----ENCSLKSLVQNECAF---NGNDYVCTPFKRLFEQC 52
          MAP T ++  +     LQ       + C LK+L Q EC F     N Y+C PFKRLFE C
Sbjct: 1  MAPATPVVDREAVAATLQASKQRNRQECELKALTQYECQFVDLESNRYICRPFKRLFEVC 60

>KNAG0E00930 Chr5 complement(176364..176693) [330 bp, 109 aa] {ON}
          Anc_6.12 YEL059C-A
          Length = 109

 Score = 45.4 bits (106), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 1  MAPPTKILGLDTQQRMLQRGENCSLKSLVQNECAFNGNDYVCTPFKRLFEQCMVKDG 57
          MAP  ++L  +    + Q  + C LK LVQ  C  +G  + C PF+RLFEQC  ++G
Sbjct: 1  MAPNVRVLTRNDVP-LPQPQDGCVLKELVQFRCENDGTQWQCAPFRRLFEQCPSQEG 56

>Kpol_1032.3 s1032 (3019..3255) [237 bp, 78 aa] {ON} (3019..3255)
          [237 nt, 79 aa]
          Length = 78

 Score = 43.9 bits (102), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 41/80 (51%), Gaps = 15/80 (18%)

Query: 1  MAPPTKILGLDTQQR-------MLQRGENCSLKSLVQNECAFNGN---DYVCTPFKRLFE 50
          MAPPT I   +   R       +  +   C+L S+ Q +C F  +   +Y+C PFKRLFE
Sbjct: 1  MAPPTPIQSREEVLRGKKCLTMVDNKKGKCTLTSITQFQCRFENSYEGEYICLPFKRLFE 60

Query: 51 QCMVKDGRVLNIEVTNLNTN 70
          +C       + IEVT+  TN
Sbjct: 61 EC-----SGIRIEVTDRFTN 75

>NCAS0F00210 Chr6 (32317..32556) [240 bp, 79 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 79

 Score = 40.4 bits (93), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 39/83 (46%), Gaps = 18/83 (21%)

Query: 1  MAPPTKILGLD------------TQQRMLQRGENCSLKSLVQNECAF-NGNDYVCTPFKR 47
          MAPP  + G D            T +   + G+ C    L Q +C       Y+C PFKR
Sbjct: 1  MAPPVVVFGKDDIRVKTALSNNRTGETDAETGDGCRQFQLTQFQCQLLEDGQYICFPFKR 60

Query: 48 LFEQCMVKDGRVLNIEVTNLNTN 70
          +F++C     + +  EVTN+++N
Sbjct: 61 VFQEC-----QGVRTEVTNVDSN 78

>TBLA0G00990 Chr7 (251428..251664) [237 bp, 78 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 78

 Score = 26.6 bits (57), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 37/79 (46%), Gaps = 13/79 (16%)

Query: 1  MAPPTKILG---LDTQQRMLQRGENCSLK--------SLVQNECAFNGNDYV-CTPFKRL 48
          MAPP  I     LD  +++ ++      K        S+ Q EC  N    + C PFKR+
Sbjct: 1  MAPPVTIQTKEELDILEKVNRKNRKDDTKKSAKPKKYSITQYECFDNDKGQIECFPFKRI 60

Query: 49 FEQCMVKDGRVLNIEVTNL 67
          F+Q + +  R +  E TN+
Sbjct: 61 FQQ-VGEYRREITDETTNM 78

>Smik_3.99 Chr3 complement(139083..140828) [1746 bp, 581 aa] {ON}
           YCR014C (REAL)
          Length = 581

 Score = 26.9 bits (58), Expect = 3.5,   Method: Composition-based stats.
 Identities = 11/32 (34%), Positives = 19/32 (59%)

Query: 27  SLVQNECAFNGNDYVCTPFKRLFEQCMVKDGR 58
           SLV N+  +  N+ + T  K+L ++C +K  R
Sbjct: 177 SLVTNKTMYKNNELIITALKKLTKKCEIKGER 208

>YDR270W Chr4 (1005675..1008689) [3015 bp, 1004 aa] {ON}
          CCC2Cu(+2)-transporting P-type ATPase, required for
          export of copper from the cytosol into an
          extracytosolic compartment; has similarity to human
          proteins involved in Menkes and Wilsons diseases
          Length = 1004

 Score = 26.6 bits (57), Expect = 6.3,   Method: Composition-based stats.
 Identities = 18/61 (29%), Positives = 29/61 (47%), Gaps = 2/61 (3%)

Query: 10 LDTQQRMLQRGENCSLKSLVQNECAFN-GNDYVCTPFKRLFEQCMVKDGRVLNIEVTNLN 68
          ++TQ R L+    C + SLV NEC     N+      K + E C      + + E+T ++
Sbjct: 20 INTQLRALKGVTKCDI-SLVTNECQVTYDNEVTADSIKEIIEDCGFDCEILRDSEITAIS 78

Query: 69 T 69
          T
Sbjct: 79 T 79

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,804,175
Number of extensions: 266769
Number of successful extensions: 536
Number of sequences better than 10.0: 20
Number of HSP's gapped: 530
Number of HSP's successfully gapped: 20
Length of query: 71
Length of database: 53,481,399
Length adjustment: 44
Effective length of query: 27
Effective length of database: 48,436,095
Effective search space: 1307774565
Effective search space used: 1307774565
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 59 (27.3 bits)