Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D00858g6.11ON54154128040.0
SAKL0E00902g6.11ON54453716380.0
Kwal_56.223556.11ON54153815610.0
KLTH0C11506g6.11ON54453815330.0
Ecym_30146.11ON55153715180.0
Kpol_1032.26.11ON53954014970.0
ACR015W6.11ON55253414630.0
CAGL0B03597g6.11ON54053914530.0
KAFR0L003406.11ON54053414370.0
TPHA0M002106.11ON54554414290.0
TDEL0G046006.11ON52853613920.0
Suva_5.106.11ON55355013740.0
NCAS0F002006.11ON54955213730.0
Smik_5.296.11ON55554913680.0
NDAI0K028906.11ON56155213610.0
Skud_5.316.11ON55755313470.0
YEL058W (PCM1)6.11ON55755513450.0
ZYRO0F00506g6.11ON55054813430.0
TBLA0G009806.11ON55853413321e-179
KNAG0E009406.11ON53855112591e-168
NCAS0C004108.840ON62580930.010
CAGL0M02981g8.840ON617136860.071
KLLA0D01573g8.840ON60748860.077
TPHA0I002508.840ON62985860.079
TDEL0B005708.840ON63019830.18
KNAG0J002708.840ON62519820.22
KAFR0B039208.840ON62418820.22
Kpol_1068.88.840ON63219820.22
YMR278W (PGM3)8.840ON62219820.24
Suva_13.4668.840ON62219820.25
Skud_13.4508.840ON62219820.25
ZYRO0G14190g8.840ON61056810.28
NDAI0K004108.840ON62619810.29
TBLA0B032508.840ON64319810.30
Smik_13.4918.840ON62219800.35
Kwal_27.102588.840ON62037800.41
ABL126W8.840ON62418780.63
KLTH0C03872g8.840ON62118780.72
SAKL0D01474g8.840ON62418770.80
Ecym_25126.353ON489168770.82
Ecym_46118.840ON63018770.89
Kwal_27.107097.418ON2779137742.2
KAFR0B061008.381ON1488126732.7
ZYRO0F06072g8.621ON42442723.4
KAFR0F032104.103ON18544703.8
TPHA0H019806.279ON99388723.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D00858g
         (541 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON...  1084   0.0  
SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON...   635   0.0  
Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON...   605   0.0  
KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} simila...   595   0.0  
Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON} s...   589   0.0  
Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON} ...   581   0.0  
ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic ho...   568   0.0  
CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {...   564   0.0  
KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON...   558   0.0  
TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON...   555   0.0  
TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.1...   540   0.0  
Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)   533   0.0  
NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}...   533   0.0  
Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)   531   0.0  
NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6....   528   0.0  
Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)   523   0.0  
YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essentia...   522   0.0  
ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON...   521   0.0  
TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {O...   517   e-179
KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.1...   489   e-168
NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}...    40   0.010
CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} simil...    38   0.071
KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {...    38   0.077
TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840...    38   0.079
TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {O...    37   0.18 
KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON...    36   0.22 
KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.8...    36   0.22 
Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON...    36   0.22 
YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}  PGM3Phosp...    36   0.24 
Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278...    36   0.25 
Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278...    36   0.25 
ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} simi...    36   0.28 
NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON...    36   0.29 
TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.8...    36   0.30 
Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278...    35   0.35 
Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {...    35   0.41 
ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic ho...    35   0.63 
KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {...    35   0.72 
SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {...    34   0.80 
Ecym_2512 Chr2 (998772..1000241) [1470 bp, 489 aa] {ON} similar ...    34   0.82 
Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar...    34   0.89 
Kwal_27.10709 s27 complement(458902..467241) [8340 bp, 2779 aa] ...    33   2.2  
KAFR0B06100 Chr2 (1255558..1260024) [4467 bp, 1488 aa] {ON} Anc_...    33   2.7  
ZYRO0F06072g Chr6 (502106..503380) [1275 bp, 424 aa] {ON} simila...    32   3.4  
KAFR0F03210 Chr6 complement(634603..635160) [558 bp, 185 aa] {ON...    32   3.8  
TPHA0H01980 Chr8 (467688..470669) [2982 bp, 993 aa] {ON} Anc_6.2...    32   3.9  

>KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 541

 Score = 1084 bits (2804), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/541 (97%), Positives = 526/541 (97%)

Query: 1   MSFRDLYEQYCKQGHAYTYGTAGFRAHNSVLDTVMFTTGIVAVLRSIYLKSKFVGVMITA 60
           MSFRDLYEQYCKQGHAYTYGTAGFRAHNSVLDTVMFTTGIVAVLRSIYLKSKFVGVMITA
Sbjct: 1   MSFRDLYEQYCKQGHAYTYGTAGFRAHNSVLDTVMFTTGIVAVLRSIYLKSKFVGVMITA 60

Query: 61  SHNPPEDNGVKVVEPYGEMLVQNWEPIATKLANAASSSFTQLESTLQSIIAELNIDTTQL 120
           SHNPPEDNGVKVVEPYGEMLVQNWEPIATKLANAASSSFTQLESTLQSIIAELNIDTTQL
Sbjct: 61  SHNPPEDNGVKVVEPYGEMLVQNWEPIATKLANAASSSFTQLESTLQSIIAELNIDTTQL 120

Query: 121 ANITVARDSRESGPRLLAALKAGISVFPAVKIIDFELLTTPQLHFLVYSLNTSSQPSQVR 180
           ANITVARDSRESGPRLLAALKAGISVFPAVKIIDFELLTTPQLHFLVYSLNTSSQPSQVR
Sbjct: 121 ANITVARDSRESGPRLLAALKAGISVFPAVKIIDFELLTTPQLHFLVYSLNTSSQPSQVR 180

Query: 181 DSTYYDHFVSIWNQLTQLYEVTELPFHLTIDCANGIGADKVKQLISQAGHMLENSLTAVN 240
           DSTYYDHFVSIWNQLTQLYEVTELPFHLTIDCANGIGADKVKQLISQAGHMLENSLTAVN
Sbjct: 181 DSTYYDHFVSIWNQLTQLYEVTELPFHLTIDCANGIGADKVKQLISQAGHMLENSLTAVN 240

Query: 241 GETKTFQLLNESCGADFVKTNQTFPANCNPKPSQLYCSFDGDADRVVFYYVDGKENKFHL 300
           GETKTFQLLNESCGADFVKTNQTFPANCNPKPSQLYCSFDGDADRVVFYYVDGKENKFHL
Sbjct: 241 GETKTFQLLNESCGADFVKTNQTFPANCNPKPSQLYCSFDGDADRVVFYYVDGKENKFHL 300

Query: 301 LDGDKIATLLAKLIADLLRDCGLSDTLKLGVVQTAYANGSSTKYITDKLKIPVSCTKTGV 360
           LDGDKIATLLAKLIADLLRDCGLSDTLKLGVVQTAYANGSSTKYITDKLKIPVSCTKTGV
Sbjct: 301 LDGDKIATLLAKLIADLLRDCGLSDTLKLGVVQTAYANGSSTKYITDKLKIPVSCTKTGV 360

Query: 361 KHLHHEAVSRYDIGIYFEANGHGTVIFSREFLETVDSRLQETSGNEXXXXXXXXXXXXXX 420
           KHLHHEAVSRYDIGIYFEANGHGTVIFSREFLETVDSRLQETSGNE              
Sbjct: 361 KHLHHEAVSRYDIGIYFEANGHGTVIFSREFLETVDSRLQETSGNEQQYKSLLSLKLLSQ 420

Query: 421 XINQTVGDAISDMLAVIATLSIFNLKPEDWDGCYQDLPNRLTKVIVPDRSVFVSTNAERQ 480
            INQTVGDAISDMLAVIATLSIFNLKPEDWDGCYQDLPNRLTKVIVPDRSVFVSTNAERQ
Sbjct: 421 LINQTVGDAISDMLAVIATLSIFNLKPEDWDGCYQDLPNRLTKVIVPDRSVFVSTNAERQ 480

Query: 481 LLSPEGLQAKIDLLVTQFPNSRSFVRASGTEDAVRVYAEAETTESAIELATKVGELVKLF 540
           LLSPEGLQAKIDLLVTQFPNSRSFVRASGTEDAVRVYAEAETTESAIELATKVGELVKLF
Sbjct: 481 LLSPEGLQAKIDLLVTQFPNSRSFVRASGTEDAVRVYAEAETTESAIELATKVGELVKLF 540

Query: 541 G 541
           G
Sbjct: 541 G 541

>SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 544

 Score =  635 bits (1638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/537 (58%), Positives = 390/537 (72%), Gaps = 6/537 (1%)

Query: 3   FRDLYEQYCKQGHAYTYGTAGFRAHNSVLDTVMFTTGIVAVLRSIYLKSKFVGVMITASH 62
             +LY+++CK G  YTYGTAGFR    VLDTVMFTTGI+A +RSIYLK ++VGVMITASH
Sbjct: 7   LEELYDKHCKTGFTYTYGTAGFRYKADVLDTVMFTTGILAAIRSIYLKGQYVGVMITASH 66

Query: 63  NPPEDNGVKVVEPYGEMLVQNWEPIATKLANAASSSFTQLESTLQSIIAELNIDTTQLAN 122
           NPP+DNGVK+V+P GEML Q WEP AT+LAN+AS    +L   L  +I +L ID T+ A 
Sbjct: 67  NPPQDNGVKIVDPKGEMLDQAWEPFATELANSASKGKQELIKALDKLITKLGIDDTESAK 126

Query: 123 ITVARDSRESGPRLLAALKAGISVFPAVKIIDFELLTTPQLHFLVYSLNTSSQPSQVRDS 182
           IT++RDSRESGPRLL A+  G  V   V+++DF LLTTPQLHFL Y  N  S  S+V +S
Sbjct: 127 ITISRDSRESGPRLLQAVIDGTKVLKNVQVVDFNLLTTPQLHFLTYQYNQGSS-SKVEES 185

Query: 183 TYYDHFVSIWNQLTQLYEVTELPFHLTIDCANGIGADKVKQLISQAGHMLENSLTAVNGE 242
           TYY  F S W ++  L+++  LP+ + ID ANGIG  KV +++ +      ++++ +N +
Sbjct: 186 TYYSAFSSAWTKICGLHDINSLPYRVIIDAANGIGGPKVSEMLLK-NKFFSSTVSVINNQ 244

Query: 243 TKTFQLLNESCGADFVKTNQTFPANC--NPKPSQLYCSFDGDADRVVFYYVDGKENKFHL 300
            ++ +LLNESCGAD+VKTNQ FP     N +   +YCSFDGDADR+VFYY D K +KF+L
Sbjct: 245 WQSPELLNESCGADYVKTNQHFPKGVSGNSENECIYCSFDGDADRIVFYYHDEK-SKFNL 303

Query: 301 LDGDKIATLLAKLIADLLRDCGLSDTLKLGVVQTAYANGSSTKYITDKLKIPVSCTKTGV 360
           LDGDKI+TL AK   +LL   G  + LKLGVVQTAYANGSST+Y++  L++PVSCT TGV
Sbjct: 304 LDGDKISTLFAKFFKELLVAAGAENELKLGVVQTAYANGSSTEYLSSILEVPVSCTATGV 363

Query: 361 KHLHHEAVSRYDIGIYFEANGHGTVIFSREFLETVDSRLQETSGNEXXXXXXXXXXXXXX 420
           KHLHHEA+  YDIGIYFEANGHGTVIFS EF +T+D +L+E   +E              
Sbjct: 364 KHLHHEAIHNYDIGIYFEANGHGTVIFSDEFHKTIDKKLKEPQ-DEKTAKALKTLYLFTN 422

Query: 421 XINQTVGDAISDMLAVIATLSIFNLKPEDWDGCYQDLPNRLTKVIVPDRSVFVSTNAERQ 480
            INQTVGDAISDMLAV+A L I    P+ WD  Y DLPN+L KVIVPDRSVF ++NAERQ
Sbjct: 423 LINQTVGDAISDMLAVLAVLCILKWSPQKWDQEYTDLPNKLVKVIVPDRSVFKTSNAERQ 482

Query: 481 LLSPEGLQAKIDLLVTQFPNSRSFVRASGTEDAVRVYAEAETTESAIELATKVGELV 537
           L+SP+GLQ KID  V +F + RSFVRASGTEDAVRVYAEA T E A  LA  V +LV
Sbjct: 483 LVSPKGLQEKIDSTVQEFEHGRSFVRASGTEDAVRVYAEAATKEKADRLAASVSDLV 539

>Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON}
           YEL058W (PCM1) - Phosphoacetylglucosamine Mutase [contig
           186] FULL
          Length = 541

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/538 (56%), Positives = 376/538 (69%), Gaps = 5/538 (0%)

Query: 2   SFRDLYEQYCKQGHAYTYGTAGFRAHNSVLDTVMFTTGIVAVLRSIYLKSKFVGVMITAS 61
           + + LYE +C  G  Y YGTAGFR    VLDTVMFTTG+VA LRSI+L+ K VGVMITAS
Sbjct: 6   ALKSLYEAHCSTGFHYAYGTAGFRYKADVLDTVMFTTGVVAGLRSIFLEGKTVGVMITAS 65

Query: 62  HNPPEDNGVKVVEPYGEMLVQNWEPIATKLANAASSSFTQLESTLQSIIAELNIDTTQLA 121
           HNPPEDNGVK+V+P GEML Q+WE  AT LAN+AS  F++  ++++ ++ +L + +    
Sbjct: 66  HNPPEDNGVKIVDPKGEMLEQSWEVYATDLANSASQGFSEFVASVERLMTKLEVGSNDHG 125

Query: 122 NITVARDSRESGPRLLAALKAGISVFPAVKIIDFELLTTPQLHFLVYSLNTSSQPSQVRD 181
           +I VARDSRESGPRLL A  +G+ V   VK+ D  LLTTPQLHFL    N   + +++  
Sbjct: 126 SIVVARDSRESGPRLLGAFLSGVKVLANVKVTDHGLLTTPQLHFLTSKSNELPKGTEIGK 185

Query: 182 STYYDHFVSIWNQLTQLYEVTELPFHLTIDCANGIGADKVKQLISQAGHMLENSLTAVNG 241
           S YYD+F+S W ++ +L ++  LP+ L ID ANGIGA  V +++SQ     + +   VN 
Sbjct: 186 SLYYDNFLSAWVEIAELCKIDSLPYKLEIDAANGIGAPVVTEMLSQH-KFFKGAFAVVND 244

Query: 242 ETKTFQLLNESCGADFVKTNQTFPANCNP--KPSQLYCSFDGDADRVVFYYVDGKENKFH 299
           E +T   LN  CGADFVKTNQ  P    P  + +++ CSFDGDADR+VFYY  GK   FH
Sbjct: 245 EWETPDSLNHLCGADFVKTNQKLPHGIAPGGERNRICCSFDGDADRIVFYYC-GKNGDFH 303

Query: 300 LLDGDKIATLLAKLIADLLRDCGLSDTLKLGVVQTAYANGSSTKYITDKLKIPVSCTKTG 359
           LLDGDK+ATL AK   +LLRD GL D L+LGVVQTAYANGSST YI   L I V+CT TG
Sbjct: 304 LLDGDKMATLFAKFFQELLRDAGLQDELELGVVQTAYANGSSTAYIEQVLGISVTCTPTG 363

Query: 360 VKHLHHEAVSRYDIGIYFEANGHGTVIFSREFLETVDSRLQETSGNEXXXXXXXXXXXXX 419
           VKHLHHEAV +YDIG+YFEANGHGTV+FS +FL+ +D +L E   ++             
Sbjct: 364 VKHLHHEAV-KYDIGVYFEANGHGTVVFSSKFLDVIDRKLSEKLESDAAQKSLKVLHLFA 422

Query: 420 XXINQTVGDAISDMLAVIATLSIFNLKPEDWDGCYQDLPNRLTKVIVPDRSVFVSTNAER 479
             INQTVGDAISDMLAV+A LSI    PE WD  Y DLPN+L KV+VPDR+VF + NAER
Sbjct: 423 KLINQTVGDAISDMLAVLAVLSILKWSPEKWDEEYTDLPNKLIKVLVPDRTVFKTKNAER 482

Query: 480 QLLSPEGLQAKIDLLVTQFPNSRSFVRASGTEDAVRVYAEAETTESAIELATKVGELV 537
           QL+SP G+Q KID LV  F   RSFVRASGTEDAVRVYAEA T +    L+ +V +L+
Sbjct: 483 QLVSPAGVQEKIDALVATFSKGRSFVRASGTEDAVRVYAEAATPQETEALSQQVEKLL 540

>KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} similar
           to uniprot|P38628 Saccharomyces cerevisiae YEL058W PCM1
           Essential N-acetylglucosamine- phosphate mutase a
           hexosephosphate mutase involved in the biosynthesis of
           chitin
          Length = 544

 Score =  595 bits (1533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/538 (56%), Positives = 373/538 (69%), Gaps = 5/538 (0%)

Query: 6   LYEQYCKQGHAYTYGTAGFRAHNSVLDTVMFTTGIVAVLRSIYLKSKFVGVMITASHNPP 65
           LYE +CK G  Y YGTAGFR    VLDTVMFTTG++A LRSIYL+ + VGVMITASHNPP
Sbjct: 10  LYETHCKSGFTYAYGTAGFRYKADVLDTVMFTTGVLAGLRSIYLEGRTVGVMITASHNPP 69

Query: 66  EDNGVKVVEPYGEMLVQNWEPIATKLANAASSSFTQLESTLQSIIAELNIDTTQLANITV 125
           EDNGVK+V+P GEML Q+WE  AT LAN+A+ SFT   + LQ++++EL +DT  L ++ V
Sbjct: 70  EDNGVKIVDPKGEMLEQSWESYATDLANSATQSFTAFLAYLQNLVSELGLDTDALGSLAV 129

Query: 126 ARDSRESGPRLLAALKAGISVFPAVKIIDFELLTTPQLHFLVYSLNTSSQPSQVRDSTYY 185
           ARDSRESGPRLL AL  G  V P ++I D+ LLTTPQLHFL    N     + +    YY
Sbjct: 130 ARDSRESGPRLLHALLNGSRVLPNIRITDYGLLTTPQLHFLTSKRNELPNDTAIDRFFYY 189

Query: 186 DHFVSIWNQLTQLYEVTELPFHLTIDCANGIGADKVKQLISQAGHMLENSLTAVNGETKT 245
             F+S W+ +T L  +  LP+ L ID ANGIGA +VK+++S      +     VN + +T
Sbjct: 190 KEFLSAWDDITALCGIQSLPYKLEIDAANGIGAPRVKEMLS-THKFFDGVFRVVNDDWET 248

Query: 246 FQLLNESCGADFVKTNQTFP--ANCNPKPSQLYCSFDGDADRVVFYYVDGKENKFHLLDG 303
              LN  CGAD+VKTNQ  P     N    ++ CSFDGDADR+VFY+ D  E +F LLDG
Sbjct: 249 PASLNHLCGADYVKTNQRLPYGIQANNDCQRICCSFDGDADRIVFYFCD-SEGQFRLLDG 307

Query: 304 DKIATLLAKLIADLLRDCGLSDTLKLGVVQTAYANGSSTKYITDKLKIPVSCTKTGVKHL 363
           DK+ATL AK   D+L    L + L LGVVQTAYANGSST YI   L IPV+CT TGVKHL
Sbjct: 308 DKMATLFAKFFQDILSSANLQERLSLGVVQTAYANGSSTHYIERVLGIPVTCTPTGVKHL 367

Query: 364 HHEAVSRYDIGIYFEANGHGTVIFSREFLETVDSRLQETSGNEXXXXXXXXXXXXXXXIN 423
           HHEA++ YDIG+YFEANGHGTV+FS++F E V+S L     ++               IN
Sbjct: 368 HHEAIN-YDIGVYFEANGHGTVVFSKKFDEVVNSGLSNKHQSDSSLQSLEVLSKFANLIN 426

Query: 424 QTVGDAISDMLAVIATLSIFNLKPEDWDGCYQDLPNRLTKVIVPDRSVFVSTNAERQLLS 483
           QTVGDAISDM+ V+A LSI    P+ W+  Y DLPN+L KV+VPDR+VF +TNAERQLLS
Sbjct: 427 QTVGDAISDMMGVLAVLSILKWTPQKWNQEYTDLPNKLVKVLVPDRTVFKTTNAERQLLS 486

Query: 484 PEGLQAKIDLLVTQFPNSRSFVRASGTEDAVRVYAEAETTESAIELATKVGELVKLFG 541
           P GLQ KI+ LV ++  +RSFVRASGTEDAVRVYAEA T E A  LA++V ++V+  G
Sbjct: 487 PLGLQPKINALVAEYHQARSFVRASGTEDAVRVYAEASTREEADSLASRVSQVVEHNG 544

>Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON}
           similar to Ashbya gossypii ACR015W
          Length = 551

 Score =  589 bits (1518), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/537 (54%), Positives = 372/537 (69%), Gaps = 7/537 (1%)

Query: 6   LYEQYCKQGHAYTYGTAGFRAHNSVLDTVMFTTGIVAVLRSIYLKSKFVGVMITASHNPP 65
           LY+++C     Y YGTAGFR    +LDTV+FTTG++A LRS++LK ++VG MITASHNPP
Sbjct: 10  LYDKHCCSRFKYIYGTAGFRYKAEILDTVLFTTGVLACLRSMHLKGQYVGAMITASHNPP 69

Query: 66  EDNGVKVVEPYGEMLVQNWEPIATKLANAASSSFTQLESTLQSIIAELNIDTTQLANITV 125
           +DNGVK+V+P GEML Q WE  AT+LAN AS    Q    LQ ++ +  I     A I V
Sbjct: 70  QDNGVKLVDPKGEMLKQEWEVYATELANCASDGKHQFLHRLQELMNQFGIKADSEARIVV 129

Query: 126 ARDSRESGPRLLAALKAGISVFPAVKIIDFELLTTPQLHFLVYSLNT---SSQPSQVRDS 182
           ARDSRESG RLL AL  G SVF  V I+D+++LTTPQLHFL Y LN    S +  +V ++
Sbjct: 130 ARDSRESGSRLLKALVDGTSVFTNVDIVDYDMLTTPQLHFLTYHLNRQMESERVIEVNEA 189

Query: 183 TYYDHFVSIWNQLTQLYEVTELPFHLTIDCANGIGADKVKQLISQAGHMLENSLTAVNGE 242
            YY HF+S   +LT+L+ +  LP+ L ID ANG+G  K ++L  +     ++S T +NG 
Sbjct: 190 FYYSHFLSALKELTELFNIPGLPYPLVIDAANGVGGAKAEELFMK-NTFFKDSTTIINGN 248

Query: 243 TKTFQLLNESCGADFVKTNQTFPANCNPKP--SQLYCSFDGDADRVVFYYVDGKENKFHL 300
                LLN  CGAD+VKTNQ  P   +     + L+CSFDGDADRV+FYY D  +  FHL
Sbjct: 249 WSQHDLLNSFCGADYVKTNQCLPQGISAATDINSLHCSFDGDADRVIFYYRD-VDGMFHL 307

Query: 301 LDGDKIATLLAKLIADLLRDCGLSDTLKLGVVQTAYANGSSTKYITDKLKIPVSCTKTGV 360
           LDGDKI+TL AK    +L   G+ D +KLGVVQTAYANGSST+Y+++ L +PVSCT TGV
Sbjct: 308 LDGDKISTLFAKFFQSMLPVAGIQDNVKLGVVQTAYANGSSTRYLSEVLIVPVSCTPTGV 367

Query: 361 KHLHHEAVSRYDIGIYFEANGHGTVIFSREFLETVDSRLQETSGNEXXXXXXXXXXXXXX 420
           K+LH +AV  YD+GIYFEANGHGTVIFS  F  TV  RL+E S +               
Sbjct: 368 KYLHRKAVENYDVGIYFEANGHGTVIFSENFNNTVSKRLKEGSLSAESKMALKTLQSFSK 427

Query: 421 XINQTVGDAISDMLAVIATLSIFNLKPEDWDGCYQDLPNRLTKVIVPDRSVFVSTNAERQ 480
            INQTVGDA+SDM+AV+A L I    P+ WDG Y DLPN L KV+VPDRS+F +TNAERQ
Sbjct: 428 LINQTVGDAMSDMMAVLAVLCILKWTPQQWDGEYTDLPNTLMKVVVPDRSLFKTTNAERQ 487

Query: 481 LLSPEGLQAKIDLLVTQFPNSRSFVRASGTEDAVRVYAEAETTESAIELATKVGELV 537
           L+SP+GLQA+ID ++  + N+RSFVRASGTEDAVR+YAEA T E A +L+ K+ +LV
Sbjct: 488 LVSPKGLQAQIDKVIKSYDNARSFVRASGTEDAVRIYAEAATKEQADDLSIKISQLV 544

>Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON}
           complement(1049..2668) [1620 nt, 540 aa]
          Length = 539

 Score =  581 bits (1497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/540 (55%), Positives = 380/540 (70%), Gaps = 15/540 (2%)

Query: 6   LYEQYCK-QGHAYTYGTAGFRAHNSVLDTVMFTTGIVAVLRSIYLKSKFVGVMITASHNP 64
           L+E+YC  + H Y YGTAGFR + S+L+TVMFTTGIVA LRSI L  K VGVMITASHNP
Sbjct: 5   LFEKYCTTKDHKYVYGTAGFRDNASILNTVMFTTGIVACLRSISLGGKAVGVMITASHNP 64

Query: 65  PEDNGVKVVEPYGEMLVQNWEPIATKLAN-AASSSFTQLESTLQSIIAELNIDTTQLAN- 122
           PEDNGVK+VEP G ML Q+WEP+AT+LAN AA+S+F  L++ ++  + + + ++      
Sbjct: 65  PEDNGVKIVEPNGAMLDQSWEPMATELANIAANSTFDDLKAYVEEKVKKFSPESGSKVQP 124

Query: 123 -ITVARDSRESGPRLLAALKAGISVFPAVKIIDFELLTTPQLHFLVYSLNTSSQPSQVRD 181
            + V RDSRESG  LL  L A    +   KII++ LLTTPQLHFL   +N   +   V++
Sbjct: 125 VVVVGRDSRESGSYLLECLLASAENYMNAKIINYGLLTTPQLHFLTNEINVK-KSYAVQE 183

Query: 182 STYYDHFVSIWNQLTQLYEVTEL-PFHLTIDCANGIGADKVKQLISQAGHMLENSLTAVN 240
           S+YY++F+  WN++T L+ +T+L    LTID ANGIG  K+++L+        + +T VN
Sbjct: 184 SSYYNYFIESWNKITALHNITDLYCSSLTIDTANGIGGPKIQELLKS--WPFASKVTLVN 241

Query: 241 GETKTFQLLNESCGADFVKTNQTFP--ANCNPKPSQLYCSFDGDADRVVFYYVDGKENKF 298
            E +   LLN++CGADFVKTNQ  P   + N   + LYCS+DGDADR+VFY+ D ++ +F
Sbjct: 242 NEWEKPDLLNKNCGADFVKTNQKLPNGVSGNSTENDLYCSYDGDADRIVFYFQD-QDKQF 300

Query: 299 HLLDGDKIATLLAKLIADLLRDCGLSDTLKLGVVQTAYANGSSTKYITDKLKIPVSCTKT 358
           HLLDGDKI+TL AKLIA LL D  L+  + LGVVQTAYANGSST Y+   L +PVSC KT
Sbjct: 301 HLLDGDKISTLFAKLIAKLLNDANLNSKISLGVVQTAYANGSSTNYLQGTLNVPVSCAKT 360

Query: 359 GVKHLHHEAVSRYDIGIYFEANGHGTVIFSREFLETVDSRLQETSGNEXXXXXXXXXXXX 418
           GVKHLHHEAV+ YDIG+YFEANGHGT+IFS  F +  +  L+  S               
Sbjct: 361 GVKHLHHEAVTNYDIGVYFEANGHGTIIFSDHFYQVCEKELKANS----ESIAVNTLVAL 416

Query: 419 XXXINQTVGDAISDMLAVIATLSIFNLKPEDWDGCYQDLPNRLTKVIVPDRSVFVSTNAE 478
              INQTVGDAISDML V++ LSI  L  + WD  Y DLPN LTKVIVPDRSVF++T+ E
Sbjct: 417 SHLINQTVGDAISDMLGVLSVLSIMKLSSQQWDNEYTDLPNLLTKVIVPDRSVFITTDQE 476

Query: 479 RQLLSPEGLQAKIDLLVTQFPNSRSFVRASGTEDAVRVYAEAETTESAIELATKVGELVK 538
           R+LLSPEGLQ+KID  +++F N RSFVRASGTEDAVRVYAEA + E A EL   V +LVK
Sbjct: 477 RKLLSPEGLQSKIDKAISEFSNGRSFVRASGTEDAVRVYAEASSQEEAKELNALVTKLVK 536

>ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL058W (PCM1)
          Length = 552

 Score =  568 bits (1463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/534 (52%), Positives = 365/534 (68%), Gaps = 4/534 (0%)

Query: 6   LYEQYCKQGHAYTYGTAGFRAHNSVLDTVMFTTGIVAVLRSIYLKSKFVGVMITASHNPP 65
           LY+++   G  Y YGTAGFR+   VL  V+F TG++A LRS+YL   +VGVM+TASHNPP
Sbjct: 10  LYDRHRGCGRVYAYGTAGFRSRAEVLAPVVFATGLLACLRSLYLGGAYVGVMLTASHNPP 69

Query: 66  EDNGVKVVEPYGEMLVQNWEPIATKLANAASSSFTQLESTLQSIIAELNIDTTQLANITV 125
           EDNGVK+V+P+GEML   WE  AT LAN AS    +L   L  ++  L +D    A + V
Sbjct: 70  EDNGVKLVDPHGEMLAAEWEKHATALANCASQGQQELLDALHMLVDRLGLDLALRARVVV 129

Query: 126 ARDSRESGPRLLAALKAGISVFPAVKIIDFELLTTPQLHFLVYSLNTSSQPSQVRDSTYY 185
           ARDSR SGP+LL AL  G  +   V+++D  +LTTPQLHFL  + N     + VR+  YY
Sbjct: 130 ARDSRASGPQLLDALLDGTRMLEDVEVVDCGMLTTPQLHFLTCACNERGSAAGVREDLYY 189

Query: 186 DHFVSIWNQLTQLYEVTELPFHLTIDCANGIGADKVKQLISQAGHMLENSLTAVNGETKT 245
            HFV+   +L  L+ +  LPF L +D ANG+GA K ++L  ++  + +N ++ +N     
Sbjct: 190 AHFVAALEELAALHGLETLPFPLVVDTANGVGALKARELFRRS-PLFKNRVSIINDNWSQ 248

Query: 246 FQLLNESCGADFVKTNQTFPANCNPK--PSQLYCSFDGDADRVVFYYVDGKENKFHLLDG 303
            +LLN  CGAD+VKT Q  P   +       L+CS+DGDADRV+FYY+DG+E +FHLLDG
Sbjct: 249 HELLNSGCGADYVKTKQCLPQGISADLLRESLFCSYDGDADRVIFYYIDGQE-RFHLLDG 307

Query: 304 DKIATLLAKLIADLLRDCGLSDTLKLGVVQTAYANGSSTKYITDKLKIPVSCTKTGVKHL 363
           DKI+TL+AK +   L   G++D + LGVVQTAYANGSST+Y+++ L++PVSCT TGVKHL
Sbjct: 308 DKISTLIAKFLQSALLTAGINDDVCLGVVQTAYANGSSTRYLSEVLEVPVSCTPTGVKHL 367

Query: 364 HHEAVSRYDIGIYFEANGHGTVIFSREFLETVDSRLQETSGNEXXXXXXXXXXXXXXXIN 423
           H EAV +YD+GIYFEANGHGTVIFS  F  TV+  L+  + +                IN
Sbjct: 368 HREAVQKYDVGIYFEANGHGTVIFSEHFTLTVERALENPALSAKARLSLQTLKTFANLIN 427

Query: 424 QTVGDAISDMLAVIATLSIFNLKPEDWDGCYQDLPNRLTKVIVPDRSVFVSTNAERQLLS 483
           QT+GDAI+DMLAVIA LSI +  PEDWD  Y DLPN L KV+VPDRS+F +TNAE+QL S
Sbjct: 428 QTIGDAIADMLAVIAILSILHWSPEDWDKQYTDLPNNLVKVVVPDRSMFKTTNAEQQLTS 487

Query: 484 PEGLQAKIDLLVTQFPNSRSFVRASGTEDAVRVYAEAETTESAIELATKVGELV 537
           P GLQ  ID +V  + + RSFVRASGTEDAVR+YAEA + + A ELATKV  LV
Sbjct: 488 PAGLQELIDDIVMVYDSGRSFVRASGTEDAVRIYAEAASQQQADELATKVSTLV 541

>CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058w PCM1 phosphoacetylglucosamine mutase
          Length = 540

 Score =  564 bits (1453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/539 (54%), Positives = 368/539 (68%), Gaps = 24/539 (4%)

Query: 6   LYEQYC-KQGHAYTYGTAGFRAHNSVLDTVMFTTGIVAVLRSIYLKSKFVGVMITASHNP 64
           LY + C  +   YTYGTAGFRA   +LD+VMFTTG++A LRSI  +   VGVMITASHNP
Sbjct: 5   LYNKNCITRDQHYTYGTAGFRADARILDSVMFTTGVIAALRSISCQCAPVGVMITASHNP 64

Query: 65  PEDNGVKVVEPYGEMLVQNWEPIATKLANAASSSFTQLESTLQSIIAELNIDTTQLANIT 124
           P DNGVK+VE  G ML+Q+WEP+AT+LAN+ +   T  ESTL +I+ ELNI       I 
Sbjct: 65  PRDNGVKIVESDGSMLLQDWEPLATRLANSVADYHT-FESTLNAIMQELNISPGHAPQIV 123

Query: 125 VARDSRESGPRLLAALKAGI-SVFPAVKIIDFELLTTPQLHFLVYSLNTSSQPSQVRDST 183
           V  DSRES PRLLA L  GI +V P  +I +  LLTTPQLHFL      ++ P+   D  
Sbjct: 124 VGHDSRESSPRLLANLLDGIKAVSPDARITNHGLLTTPQLHFL------TANPAHFEDY- 176

Query: 184 YYDHFVSIWNQLTQLYEVTELPF--HLTIDCANGIGADKVKQLISQAG----HMLENSLT 237
           YY +F+  WNQL +LY +        L ID ANGIG  +  +++S +     H+ +  L 
Sbjct: 177 YYRYFLDAWNQLFELYGIEGFKSFDKLVIDTANGIGGPQFLKMLSYSQTDLPHLQKIRLH 236

Query: 238 AVNGETKTF---QLLNESCGADFVKTNQTFPANCNPKPSQLYCSFDGDADRVVFYYVDGK 294
            ++    ++    +LN  CGADFVKTNQ  P   N  P  LYCSFDGDADRVVFYYVD  
Sbjct: 237 QIDITNNSWLNPSMLNSGCGADFVKTNQRLPEGINADPRNLYCSFDGDADRVVFYYVDDS 296

Query: 295 ENKFHLLDGDKIATLLAKLIADLLRDCGLSDTLKLGVVQTAYANGSSTKYITDKLKIPVS 354
              FHLLDGDKI+TLLA  I  LL++ GL++ LKLGVVQTAYANGSST Y+T KL++PVS
Sbjct: 297 LT-FHLLDGDKISTLLAYFINALLKEAGLAEELKLGVVQTAYANGSSTTYVTKKLQVPVS 355

Query: 355 CTKTGVKHLHHEAVSRYDIGIYFEANGHGTVIFSREFLETVDSRLQETSGNEXXXXXXXX 414
             KTGVKHLHHEAV+ YDIG+YFEANGHGTVIFS+ F E ++ RL + + ++        
Sbjct: 356 IAKTGVKHLHHEAVTNYDIGVYFEANGHGTVIFSQHFYEVIEDRLAKNAHDK----STLT 411

Query: 415 XXXXXXXINQTVGDAISDMLAVIATLSIFNLKPEDWDGCYQDLPNRLTKVIVPDRSVFVS 474
                  INQT+GDAISDMLA+I  L I    P  WD  Y DLPN+LTKV+VPDRS+F++
Sbjct: 412 LRLLSRLINQTIGDAISDMLAIITVLGILGWSPATWDHEYTDLPNKLTKVVVPDRSIFIT 471

Query: 475 TNAERQLLSPEGLQAKIDLLVTQFPNSRSFVRASGTEDAVRVYAEAETTESAIELATKV 533
           T+ ER+L+SP GLQ KID+LV   P  RSF+RASGTEDAVRVYAEA+T E+  +L+T+V
Sbjct: 472 TDQERRLVSPAGLQDKIDMLVADAPCGRSFIRASGTEDAVRVYAEAQTVEATEKLSTEV 530

>KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON}
           Anc_6.11 YEL058W
          Length = 540

 Score =  558 bits (1437), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/534 (54%), Positives = 364/534 (68%), Gaps = 12/534 (2%)

Query: 9   QYCK-QGHAYTYGTAGFRAHNSVLDTVMFTTGIVAVLRSIYLKSKFVGVMITASHNPPED 67
           +YC  + H+YTYGTAGFRA+ S LDTVMFTTGIVA+LRS+ L+ K++GVMITASHNPP+D
Sbjct: 13  KYCTTRNHSYTYGTAGFRANASTLDTVMFTTGIVAILRSLVLQGKYIGVMITASHNPPQD 72

Query: 68  NGVKVVEPYGEMLVQNWEPIATKLANAAS-SSFTQLESTLQSIIAELNIDTTQLANITVA 126
           NGVK+VEP G ML+++WE IAT LAN AS  +FT     L  +IA+LNID T    + V 
Sbjct: 73  NGVKIVEPSGAMLIESWEQIATDLANIASHGNFTAFVMHLSQVIAKLNIDETTTPRLIVG 132

Query: 127 RDSRESGPRLLAALKAGISVFPAVKIIDFELLTTPQLHFLVYSLNTSSQPSQVRDSTYYD 186
            DSRES P L+  L+A   VF  + +I+  L+TTPQLH+L     T  Q   V +  YY 
Sbjct: 133 HDSRESSPYLMECLQAAAPVFDTI-VINHTLITTPQLHYL-----TMLQNDVVTEVDYYK 186

Query: 187 HFVSIWNQLTQLYEVTELPFH-LTIDCANGIGADKVKQLISQAGHMLENSLTAVNGETKT 245
            F + WN L  LY    L F+ L +D ANG+G+ +  + +      L    T +N +   
Sbjct: 187 FFSTSWNNLFSLYPDLNLTFNNLIVDGANGVGSVQFSKFLPYLPQ-LATLTTIINDKHNV 245

Query: 246 FQLLNESCGADFVKTNQTFPAN-CNPKPSQLYCSFDGDADRVVFYYVDGKENKFHLLDGD 304
            Q+LN  CGADFVKTNQ  P    NP PS LY SFDGDADR+VFYYVD  + KFHLLDGD
Sbjct: 246 PQMLNVDCGADFVKTNQKLPNGIVNPNPSDLYASFDGDADRIVFYYVDNNK-KFHLLDGD 304

Query: 305 KIATLLAKLIADLLRDCGLSDTLKLGVVQTAYANGSSTKYITDKLKIPVSCTKTGVKHLH 364
           KI+T+L K +  +LR+  L + + LGVVQTAYANGSSTKYIT  LK+PV CTKTGVKHLH
Sbjct: 305 KISTILTKCLISMLRESELLNDINLGVVQTAYANGSSTKYITKSLKVPVECTKTGVKHLH 364

Query: 365 HEAVSRYDIGIYFEANGHGTVIFSREFLETVDSRLQETSGNEXXXXXXXXXXXXXXXINQ 424
           H A S++DIGIYFEANGHGTV+FS +F E +   +   S +E               INQ
Sbjct: 365 HIAESKFDIGIYFEANGHGTVLFSNKFYEVLQKAIDNGSSSEKIHKARLSLFYFSKLINQ 424

Query: 425 TVGDAISDMLAVIATLSIFNLKPEDWDGCYQDLPNRLTKVIVPDRSVFVSTNAERQLLSP 484
           TVGD+++D+LAVIATLSI  L P DWD  YQDLPN LTK  V +R VF +T+ ER+L SP
Sbjct: 425 TVGDSMADLLAVIATLSILQLSPSDWDTEYQDLPNLLTKCTVLNRFVFKTTDMERKLTSP 484

Query: 485 EGLQAKIDLLVTQFPNSRSFVRASGTEDAVRVYAEAETTESAIELATKVGELVK 538
            GLQ KID  V+++ + RSFVRASGTEDAVR+YAEA+T      L+ +V +LV+
Sbjct: 485 SGLQEKIDAAVSKYDSGRSFVRASGTEDAVRIYAEAKTKAEVEALSKEVTQLVE 538

>TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON}
           Anc_6.11 YEL058W
          Length = 545

 Score =  555 bits (1429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/544 (54%), Positives = 363/544 (66%), Gaps = 23/544 (4%)

Query: 6   LYEQYCK-QGHAYTYGTAGFRAHNSVLDTVMFTTGIVAVLRSIYLKSKFVGVMITASHNP 64
           ++E  C  + H Y YGTAGFR   +VLDTVM TTG++A LRSI L  K VGVMITASHN 
Sbjct: 9   VFESCCTTRNHRYVYGTAGFRDDATVLDTVMVTTGLLACLRSIALDGKAVGVMITASHNQ 68

Query: 65  PEDNGVKVVEPYGEMLVQNWEPIATKLANAAS--SSFTQLESTLQSIIAELNIDTTQLAN 122
           P DNGVK+VEP G ML Q+WEP AT+LAN AS   S  + +  LQ   A+  +D+     
Sbjct: 69  PCDNGVKIVEPDGSMLDQSWEPFATELANKASFCHSTQEFKLYLQEKFAQYKVDSGITPV 128

Query: 123 ITVARDSRESGPRLLAALKAGISVFPAVKIIDFELLTTPQLHFLVYSLNTSSQPSQVRDS 182
           + V RDSR+SGPRLL  L +        KIID+ LLTTPQLHFL  ++NT+   + V + 
Sbjct: 129 LVVGRDSRDSGPRLLQCLNSLAVPLMKPKIIDYGLLTTPQLHFLTNAINTTKSRAPVTED 188

Query: 183 TYYDHFVSIWNQLTQLY--EVTELPFHLTIDCANGIGADKVKQLIS---QAGHMLENSLT 237
            YY  F+  W  +T L+  +V + P  L ID ANGIG  KV +L     QAG       T
Sbjct: 189 DYYSFFMDAWVSITALHGIKVLQSP-RLYIDAANGIGGPKVSKLFEVWPQAGQ-----FT 242

Query: 238 AVNGETKTFQLLNESCGADFVKTNQTFPANCNP----KPSQLYCSFDGDADRVVFYYVDG 293
            VN   +T  LLN  CGAD+VKTNQ  P N +P     P+ LYCSFDGDADR+VFYY D 
Sbjct: 243 LVNNHWQTPTLLNNDCGADYVKTNQRLPKNIDPAADSDPATLYCSFDGDADRIVFYYQDA 302

Query: 294 KENKFHLLDGDKIATLLAKLIADLLRDCGLSDTLKLGVVQTAYANGSSTKYITDKLKIPV 353
            +N FHLLDGDKI+TL A  I+  L+  GL++ + +GVVQTAYANG+ST Y+ + L IPV
Sbjct: 303 -QNSFHLLDGDKISTLFALFISKQLKKAGLTEKISMGVVQTAYANGNSTNYLENVLNIPV 361

Query: 354 SCTKTGVKHLHHEAVSRYDIGIYFEANGHGTVIFSREFLETVDSRLQETSGNEXXXXXXX 413
           SC KTGVKHLHHEA++ YD+GIYFEANGHGT++FS +F ET +S L+E   NE       
Sbjct: 362 SCAKTGVKHLHHEAITNYDVGIYFEANGHGTIMFSNKFFETCESLLKE--NNE--SLEVK 417

Query: 414 XXXXXXXXINQTVGDAISDMLAVIATLSIFNLKPEDWDGCYQDLPNRLTKVIVPDRSVFV 473
                   INQTVGDAISDML V+A LSI  L P  WD  Y DLPN LTKV+VPDRS+F 
Sbjct: 418 TLLSFAHLINQTVGDAISDMLGVLAVLSIMKLTPSAWDKEYTDLPNLLTKVVVPDRSLFT 477

Query: 474 STNAERQLLSPEGLQAKIDLLVTQFPNSRSFVRASGTEDAVRVYAEAETTESAIELATKV 533
           +T+ ER+LL+PEG Q KID +V ++ N RSFVRASGTEDAVRVYAEA T + A  L  +V
Sbjct: 478 TTDQERKLLTPEGAQTKIDAIVAKYKNGRSFVRASGTEDAVRVYAEASTPQDAAALNEEV 537

Query: 534 GELV 537
            + V
Sbjct: 538 SKAV 541

>TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.11
           YEL058W
          Length = 528

 Score =  540 bits (1392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/536 (53%), Positives = 357/536 (66%), Gaps = 17/536 (3%)

Query: 6   LYEQYCK-QGHAYTYGTAGFRAHNSVLDTVMFTTGIVAVLRSIYLKSKFVGVMITASHNP 64
           L EQYC  +G+ Y YGTAGFR  +  LDTVMF TGIVA LRS  L  K VGVMITASHNP
Sbjct: 8   LIEQYCTTRGYRYVYGTAGFRDDSEKLDTVMFATGIVACLRSQVLNGKPVGVMITASHNP 67

Query: 65  PEDNGVKVVEPYGEMLVQNWEPIATKLANAASSSFTQLESTLQSIIAELNIDTTQLANIT 124
             DNGVKVVEP G ML+Q+WE  AT+LAN  ++    LE     +    + +++    + 
Sbjct: 68  SGDNGVKVVEPDGSMLIQSWESTATELANLLANR--PLEDIKAKVGQLTSGESSVRPQLI 125

Query: 125 VARDSRESGPRLLAALKAGISVFPAVKIIDFELLTTPQLHFLVYSLNTSSQPSQVRDSTY 184
           V RDSR SGP LL+ L A  +     KI D+ LLTTPQLHFL     T    + V +  Y
Sbjct: 126 VGRDSRVSGPHLLSCLVASATSLFDAKITDYGLLTTPQLHFLTN--ETMITGAHVDEQAY 183

Query: 185 YDHFVSIWNQLTQLYEVTELPFHLTIDCANGIGADKVKQLISQAGHMLENSLTAVNGETK 244
           + HF+  W+Q+  L  V +LP ++ +DCANGIG  K+  L++Q G   + S+  +N +  
Sbjct: 184 FAHFLGAWDQIAALQPV-KLP-NVVVDCANGIGGPKMSALLTQWGFAKQCSV--INDKCD 239

Query: 245 TFQLLNESCGADFVKTNQTFPANCNPKPSQLYCSFDGDADRVVFYYVDGKENKFHLLDGD 304
             +LLN  CGADFVKT+Q  P    P  + LYCSFDGDADRVVFYY+D +   FHLLDGD
Sbjct: 240 EPELLNHGCGADFVKTSQRLPNGVKPNANDLYCSFDGDADRVVFYYLD-QNLGFHLLDGD 298

Query: 305 KIATLLAKLIADLLRDCGLSDTLKLGVVQTAYANGSSTKYITDKLKIPVSCTKTGVKHLH 364
           KI+TL A  +A LL+ C L   L +GVVQTAYANGSSTKY+ D L++PVSCTKTGVKHLH
Sbjct: 299 KISTLFAYFVAKLLKQCKLDSILSMGVVQTAYANGSSTKYLQDNLQVPVSCTKTGVKHLH 358

Query: 365 HEAVSRYDIGIYFEANGHGTVIFSREFLETVDSRLQETSGNEXXXXXXXXXXXXXXXINQ 424
           HEAV+ YDIGIYFEANGHGTV+FS +F ETV +   +T                   INQ
Sbjct: 359 HEAVNNYDIGIYFEANGHGTVMFSNKFHETVTNHADQTP-------ELKILKYLAKLINQ 411

Query: 425 TVGDAISDMLAVIATLSIFNLKPEDWDGCYQDLPNRLTKVIVPDRSVFVSTNAERQLLSP 484
           TVGDAISDM+AV+A LSI    P  WD  + DLPN+LTKV+V DRS F +T+ ER+L+SP
Sbjct: 412 TVGDAISDMMAVLAVLSILQWSPSRWDREFTDLPNKLTKVVVSDRSAFTTTDQERRLVSP 471

Query: 485 EGLQAKIDLLVTQFPNSRSFVRASGTEDAVRVYAEAETTESAIELATKVGELVKLF 540
            GLQ KID  V +  + RSFVRASGTEDAVRVYAEA T     +L++ VG+LV+ +
Sbjct: 472 AGLQDKIDEAVARIKSGRSFVRASGTEDAVRVYAEAATQSEKDQLSSIVGDLVREY 527

>Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)
          Length = 553

 Score =  533 bits (1374), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/550 (52%), Positives = 373/550 (67%), Gaps = 21/550 (3%)

Query: 3   FRDLYEQ-YCKQGHAYTYGTAGFRAHNSVLDTVMFTTGIVAVLRSIYLKSKFVGVMITAS 61
            R LYE+  C +   Y+YGTAGFR     LDTVMFTTGI+AVLRS+ L+ ++VGVMITAS
Sbjct: 8   LRKLYEETCCTKNLQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGVMITAS 67

Query: 62  HNPPEDNGVKVVEPYGEMLVQNWEPIATKLANAAS--SSFTQLESTLQSIIAELNIDTTQ 119
           HNP +DNGVK+VEP G ML+  WEP A +LANAAS  ++F +  + L  +I    ID   
Sbjct: 68  HNPYQDNGVKIVEPDGSMLLAAWEPYAMQLANAASFAATFDEFYAELVKLIEHEKIDLDA 127

Query: 120 LANITVARDSRESGPRLLAALKAGI-SVFPAVKIIDFELLTTPQLHFLVYSLNTSSQ--- 175
             ++ V RDSRES P LL  L + + SVF A  ++D   +TTPQLH+ V +L+   Q   
Sbjct: 128 APHVVVGRDSRESSPFLLRCLTSTMASVFHA-HVVDLGCVTTPQLHY-VTNLSNKRQREG 185

Query: 176 -PSQV-RDSTYYDHFVSIWNQL---TQLYEVTELPFHLTIDCANGIGADKVKQLI-SQAG 229
             +QV  +  YY  F++ +N+L    Q+ +   +P  L +D ANGIG  ++K+L+ S+  
Sbjct: 186 GSAQVATEQDYYSFFINAFNELFTTCQIEKRLSVP-KLFVDTANGIGGPQLKKLLASKDW 244

Query: 230 HMLENSLTAVNGETKTFQLLNESCGADFVKTNQTFPANCNPK-PSQLYCSFDGDADRVVF 288
            +  + +  VN ++   +LLN  CGAD+VKTNQ  P   +P  P  LYCSFDGDADRVVF
Sbjct: 245 AVPSDEIEIVNDKSDVPKLLNFECGADYVKTNQRLPKGLSPSSPDSLYCSFDGDADRVVF 304

Query: 289 YYVDGKENKFHLLDGDKIATLLAKLIADLLRDCGLSDTLKLGVVQTAYANGSSTKYITDK 348
           YYVD  E+KFHLLDGDKI+TL AK ++  L    L+D+LK+GVVQTAYANGSST YI D 
Sbjct: 305 YYVD-PESKFHLLDGDKISTLFAKFLSKQLELANLTDSLKIGVVQTAYANGSSTSYIKDT 363

Query: 349 LKIPVSCTKTGVKHLHHEAVSRYDIGIYFEANGHGTVIFSREFLETVDSRLQETSGNEXX 408
           L  PVSCTKTGVKHLHHEA ++YDIGIYFEANGHGT+IFS++F +T++S L    G+   
Sbjct: 364 LHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSKKFHQTIESELSRAQGS--- 420

Query: 409 XXXXXXXXXXXXXINQTVGDAISDMLAVIATLSIFNLKPEDWDGCYQDLPNRLTKVIVPD 468
                        INQTVGDAISDMLAV+ATLSI ++ P DWD  Y DLPN+L K IVPD
Sbjct: 421 LLALNTLRCFANLINQTVGDAISDMLAVLATLSILHMAPTDWDKEYTDLPNKLVKCIVPD 480

Query: 469 RSVFVSTNAERQLLSPEGLQAKIDLLVTQFPNSRSFVRASGTEDAVRVYAEAETTESAIE 528
           RS+F +T+ ER+L +P GLQ KID ++ ++   RSFVRASGTEDAVRVYAE +      +
Sbjct: 481 RSIFQTTDQERKLQNPAGLQTKIDSVIGKYAMGRSFVRASGTEDAVRVYAECQDPTKLDQ 540

Query: 529 LATKVGELVK 538
              +V E VK
Sbjct: 541 FCNEVVEYVK 550

>NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}
           Anc_6.11 YEL058W
          Length = 549

 Score =  533 bits (1373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/552 (51%), Positives = 359/552 (65%), Gaps = 33/552 (5%)

Query: 3   FRDLYEQYCK-QGHAYTYGTAGFRAHNSVLDTVMFTTGIVAVLRSIYLKSKFVGVMITAS 61
            + +Y   C  + + YTYGTAGFR   S LDTVMF TGI+A  RS+ L    VGVM+TAS
Sbjct: 8   LQQVYNSTCTTRDYKYTYGTAGFRDKASKLDTVMFATGIIACWRSMVLCGTPVGVMVTAS 67

Query: 62  HNPPEDNGVKVVEPYGEMLVQNWEPIATKLAN-AASSSFTQLESTLQSIIAELNIDTT-- 118
           HNPP DNGVKVVEP G ML+Q WEP+ TKLAN AA+ SF ++       I E++ D    
Sbjct: 68  HNPPLDNGVKVVEPTGAMLIQEWEPLTTKLANIAANESFEKV----YDFILEVSKDPKFP 123

Query: 119 ---QLANITVARDSRESGPRLLAAL-KAGISVFPAVKIIDFELLTTPQLHFLV------Y 168
                 ++ +  DSRES PRL   L    + ++ A  I ++ L+TTPQLHF+       Y
Sbjct: 124 FQENKPSLIIGHDSRESSPRLTKLLVNTAVEIYNA-DIHNYGLVTTPQLHFITSLWNAKY 182

Query: 169 SLNTSSQPSQVRDSTYYDHFVSIWNQLTQLYEVTELPF--HLTIDCANGIGADKVKQLIS 226
           + NT+     +    YY++F + W++  +LY+        +L ID ANGIG  KV  LIS
Sbjct: 183 NKNTNDV---ISVDNYYNYFNASWSKFQELYDFNSFKSFENLIIDSANGIGGPKVTDLIS 239

Query: 227 QAGHMLENSLTAVNGETKTFQLLNESCGADFVKTNQTFPANC-NPKPSQLYCSFDGDADR 285
                L  +++ +N   +   LLN  CGAD+VKTNQ  P    NP    L+CSFDGDADR
Sbjct: 240 TWPSTLRGNVSIINNSWENPNLLNNDCGADYVKTNQKLPKGIQNPSNLNLHCSFDGDADR 299

Query: 286 VVFYYVDGKENKFHLLDGDKIATLLAKLIADLLRDCGLSDTLKLGVVQTAYANGSSTKYI 345
           +VFYY+   + KFHLLDGDKIATL AK +++LL++  L+D LKLGVVQTAYANGSST Y+
Sbjct: 300 IVFYYISEVDQKFHLLDGDKIATLFAKFLSNLLKETNLTDKLKLGVVQTAYANGSSTNYL 359

Query: 346 TDKLKIPVSCTKTGVKHLHHEAVSRYDIGIYFEANGHGTVIFSREFLETVDSRLQETSGN 405
           T+ LK+PVSCTKTGVKHLHHEA ++YDIGIYFEANGHGTV+FS         R Q+   N
Sbjct: 360 TNVLKVPVSCTKTGVKHLHHEASTKYDIGIYFEANGHGTVLFSE--------RFQQVLQN 411

Query: 406 EXXXXXXXXXXXXXXXINQTVGDAISDMLAVIATLSIFNLKPEDWDGCYQDLPNRLTKVI 465
           E               INQTVGDA++DML VI  LS+  + P  WD  Y+DLPN+L KVI
Sbjct: 412 EPKTTATQTLLLFQKIINQTVGDAMADMLGVITVLSVSKITPSQWDQGYKDLPNKLAKVI 471

Query: 466 VPDRSVFVSTNAERQLLSPEGLQAKIDLLVTQFPNSRSFVRASGTEDAVRVYAEAETTES 525
           VPDRSVF++TN ERQL SP GLQ KID+ V++  N RSFVRASGTEDAVRVYAEA T E 
Sbjct: 472 VPDRSVFITTNQERQLTSPVGLQEKIDVAVSKVTNGRSFVRASGTEDAVRVYAEAATQEE 531

Query: 526 AIELATKVGELV 537
             +L+ +V + V
Sbjct: 532 TEKLSQEVCKFV 543

>Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)
          Length = 555

 Score =  531 bits (1368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/549 (50%), Positives = 373/549 (67%), Gaps = 21/549 (3%)

Query: 5   DLYEQYCKQGHA-YTYGTAGFRAHNSVLDTVMFTTGIVAVLRSIYLKSKFVGVMITASHN 63
           +LY++ C+  +  Y+YGTAGFR     LDTVMFTTGI+A+LRS+ L+ ++VGVMITASHN
Sbjct: 10  ELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGVMITASHN 69

Query: 64  PPEDNGVKVVEPYGEMLVQNWEPIATKLANAAS--SSFTQLESTLQSIIA--ELNIDTTQ 119
           P +DNGVK+VEP G ML+  WEP A +LAN AS  S+F +  + L  +I   ++ +DT+ 
Sbjct: 70  PYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEHEKIGLDTSI 129

Query: 120 LANITVARDSRESGPRLLAALKAG-ISVFPAVKIIDFELLTTPQLHFLVYSLNTSSQPSQ 178
           + +I V RDSRES P LL  L +  +SVF A +++D   +TTPQLH++    N   +   
Sbjct: 130 VPHIVVGRDSRESSPYLLRCLTSTMVSVFHA-QVLDLGCVTTPQLHYITDLSNKREREGG 188

Query: 179 ----VRDSTYYDHFVSIWNQLTQLYEVTE---LPFHLTIDCANGIGADKVKQLISQAGHM 231
                 +  YY  F+  +N+L   YE+ +   +P  L ID ANGIG  ++K+L++    +
Sbjct: 189 SAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVP-RLFIDAANGIGGPQLKKLLTSKDWV 247

Query: 232 LE-NSLTAVNGETKTFQLLNESCGADFVKTNQTFPANCNPKP-SQLYCSFDGDADRVVFY 289
           +  + +  +N ++   +LLN  CGAD+VKTNQ  P   +P     LYCSFDGDADRVVFY
Sbjct: 248 VPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSSHDSLYCSFDGDADRVVFY 307

Query: 290 YVDGKENKFHLLDGDKIATLLAKLIADLLRDCGLSDTLKLGVVQTAYANGSSTKYITDKL 349
           YVD  E++FHLLDGDKI+TL AK ++  L    L ++L++GVVQTAYANGSST YI + L
Sbjct: 308 YVDS-ESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSSTNYIENTL 366

Query: 350 KIPVSCTKTGVKHLHHEAVSRYDIGIYFEANGHGTVIFSREFLETVDSRLQETSGNEXXX 409
           + PVSCTKTGVKHLHHEA ++YDIGIYFEANGHGT+IFS +F + + S L    G+    
Sbjct: 367 RCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELSRARGD---M 423

Query: 410 XXXXXXXXXXXXINQTVGDAISDMLAVIATLSIFNLKPEDWDGCYQDLPNRLTKVIVPDR 469
                       INQTVGDA+SDMLAV+ATL+I  + P DWD  Y DLPN+L K IVPDR
Sbjct: 424 LALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVKCIVPDR 483

Query: 470 SVFVSTNAERQLLSPEGLQAKIDLLVTQFPNSRSFVRASGTEDAVRVYAEAETTESAIEL 529
           S+F + + ER+L +P GLQAKIDL++ ++P  RSFVRASGTEDAVR+YAE + +    + 
Sbjct: 484 SIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDSSQLDQF 543

Query: 530 ATKVGELVK 538
             ++ ELVK
Sbjct: 544 CNEIVELVK 552

>NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6.11
           YEL058W
          Length = 561

 Score =  528 bits (1361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/552 (52%), Positives = 369/552 (66%), Gaps = 26/552 (4%)

Query: 3   FRDLYEQYCK-QGHAYTYGTAGFRAHNSVLDTVMFTTGIVAVLRSIYL----KSKFVGVM 57
            +  + + C+ + + YTYGTAGFR +   LDTVMFTTGIVA LRS+ L    K   +GVM
Sbjct: 12  LKSCFNEICQTKNYHYTYGTAGFRDNAKRLDTVMFTTGIVACLRSLTLQTSNKHSAIGVM 71

Query: 58  ITASHNPPEDNGVKVVEPYGEMLVQNWEPIATKLAN-AASSSFTQLESTL-QSIIA-ELN 114
           +TASHNPPEDNGVK++EP G ML+Q WEP AT+ AN AA+ SF +    L  SI+  E +
Sbjct: 72  VTASHNPPEDNGVKIIEPNGSMLLQEWEPKATQFANIAANESFDEFYQLLIDSIVTLEND 131

Query: 115 IDTTQLANITVARDSRESGPRLLAALKAGISVFPAVKIIDFELLTTPQLHFLVYSLNTSS 174
           ++  Q   + +  DSR+S P L+  +    ++    KII++  +TTPQLHFL    NT+ 
Sbjct: 132 LNIKQPPTLILGHDSRDSSPTLMNHIIKSATLIFNAKIINYNYVTTPQLHFLTNLTNTTG 191

Query: 175 QPSQVRDSTYYDHFVSIWNQLTQLYEVTELPF-HLTIDCANGIGADKVKQLISQAGHM-- 231
              ++    YYDHF    +QL  LY    LPF +L ID ANGIGA +V++L+        
Sbjct: 192 TAEEIN---YYDHFNKYLSQLQSLYPPFNLPFDNLIIDAANGIGAPQVEKLLFTKNKFPP 248

Query: 232 --LENSLTAVNGETKTFQLLNESCGADFVKTNQTFPANCNPKP----SQLYCSFDGDADR 285
             ++N +  +N ++K   LLN +CGAD+VKTNQ  P    PK     S L+CS+DGDADR
Sbjct: 249 LNIKNPIKIINNDSKNPNLLNMNCGADYVKTNQKLPQGI-PKDIDANSTLFCSYDGDADR 307

Query: 286 VVFYYVDGKENKFHLLDGDKIATLLAKLIADLLRDCGLSDTLKLGVVQTAYANGSSTKYI 345
           +VFYY+D   N F+LLDGDKIATL AK  ++LL    L+  LKLGVVQTAYANGSST YI
Sbjct: 308 IVFYYIDPMTNNFNLLDGDKIATLFAKFFSNLLTIAKLNHILKLGVVQTAYANGSSTNYI 367

Query: 346 TDKLKIPVSCTKTGVKHLHHEAVSRYDIGIYFEANGHGTVIFSREFLETVDSRLQETSGN 405
           + KLK+PVSCTKTGVKHLHHEA+++YDIGIYFEANGHGTVIFS +F   + ++L+E+  +
Sbjct: 368 SSKLKVPVSCTKTGVKHLHHEAITKYDIGIYFEANGHGTVIFSDKFHSEL-TKLKESGSS 426

Query: 406 EXXXXXXXXXXXXXXXINQTVGDAISDMLAVIATLSIFNLKPEDWDGCYQDLPNRLTKVI 465
                           INQTVGDA+SDMLAVIA LSI  L P  WD  Y+DLPN+L KVI
Sbjct: 427 R----EIKTLLLFSELINQTVGDAMSDMLAVIAVLSILQLSPNSWDKEYKDLPNKLAKVI 482

Query: 466 VPDRSVFVSTNAERQLLSPEGLQAKIDLLVTQFPNSRSFVRASGTEDAVRVYAEAETTES 525
           VPDRS F++T+ ER+L+ P+GLQ  ++  V      RSFVRASGTEDAVRVYAEA+T E 
Sbjct: 483 VPDRSKFITTDQERKLVEPKGLQPLLEEAVASVSLGRSFVRASGTEDAVRVYAEAKTQEE 542

Query: 526 AIELATKVGELV 537
              L+ KV +LV
Sbjct: 543 TEWLSKKVCQLV 554

>Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)
          Length = 557

 Score =  523 bits (1347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/553 (50%), Positives = 371/553 (67%), Gaps = 23/553 (4%)

Query: 3   FRDLYEQYCKQGHA-YTYGTAGFRAHNSVLDTVMFTTGIVAVLRSIYLKSKFVGVMITAS 61
            R LY++ C+  +  Y+YGTAGFR     LDTVMFTTGI+AVLRS+ L+ ++VGVMITAS
Sbjct: 8   LRKLYDETCRTKNVQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGVMITAS 67

Query: 62  HNPPEDNGVKVVEPYGEMLVQNWEPIATKLANAAS--SSFTQLESTLQSIIAELNID--- 116
           HNP +DNGVK+VEP G ML+ +WEP A +LANAAS  + F +  + L  +I    ID   
Sbjct: 68  HNPYQDNGVKIVEPDGSMLLASWEPYAMQLANAASFATHFEEFYAELVKLIELEKIDLGA 127

Query: 117 TTQLANITVARDSRESGPRLLAALKAGI-SVFPAVKIIDFELLTTPQLHFLVYSLNT--- 172
           +    +I V RDSRES P LL  L + + SVF A +++D   +TTPQLH++    N    
Sbjct: 128 SNVAPHIVVGRDSRESSPYLLRCLTSTMASVFHA-RVLDLGCVTTPQLHYITDLSNRRER 186

Query: 173 --SSQPSQVRDSTYYDHFVSIWNQLTQLYEVTE---LPFHLTIDCANGIGADKVKQLISQ 227
              S  +   +  YY  F+  +N+L   Y++ +   +P  L ID ANGIG  ++K+L++ 
Sbjct: 187 EGDSALAAATEQDYYSFFIGAFNELFTTYDMEKRLSVP-KLFIDTANGIGGPQLKKLLAS 245

Query: 228 AGHML-ENSLTAVNGETKTFQLLNESCGADFVKTNQTFPANCNPKPSQ-LYCSFDGDADR 285
              ++  + +  +N ++   +LLN  CGAD+VKTNQ  P   +P   + LYCSFDGDADR
Sbjct: 246 KDWVVPSDQIEIINDKSDVPKLLNSECGADYVKTNQRLPKGLSPSSFESLYCSFDGDADR 305

Query: 286 VVFYYVDGKENKFHLLDGDKIATLLAKLIADLLRDCGLSDTLKLGVVQTAYANGSSTKYI 345
           VVFYYVD  E KFHLLDGDKI+TL AK ++  L    L  +LK+GVVQTAYANGSST YI
Sbjct: 306 VVFYYVDS-ELKFHLLDGDKISTLFAKFLSKQLEMANLERSLKIGVVQTAYANGSSTAYI 364

Query: 346 TDKLKIPVSCTKTGVKHLHHEAVSRYDIGIYFEANGHGTVIFSREFLETVDSRLQETSGN 405
            D L  PVSCTKTGVKHLHHEA ++YDIGIYFEANGHGT+IFS +F +T++S L + +G+
Sbjct: 365 KDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQTIESELSKPNGH 424

Query: 406 EXXXXXXXXXXXXXXXINQTVGDAISDMLAVIATLSIFNLKPEDWDGCYQDLPNRLTKVI 465
                           INQTVGDA+SDMLAV+ATL+I  + P +WD  Y+DLPN+L K I
Sbjct: 425 ---TLALKTLSCFAKLINQTVGDAMSDMLAVLATLAILKMAPMNWDEEYKDLPNKLVKCI 481

Query: 466 VPDRSVFVSTNAERQLLSPEGLQAKIDLLVTQFPNSRSFVRASGTEDAVRVYAEAETTES 525
           VPDRS+F +T+ ER+L +P GLQ+KID ++ ++P  RSFVRASGTEDAVRVYAE +    
Sbjct: 482 VPDRSIFQTTDQERKLQNPVGLQSKIDSVIAKYPMGRSFVRASGTEDAVRVYAECQDMSK 541

Query: 526 AIELATKVGELVK 538
             +   ++   VK
Sbjct: 542 LDQFCNEIVGYVK 554

>YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essential
           N-acetylglucosamine-phosphate mutase; converts
           GlcNAc-6-P to GlcNAc-1-P, which is a precursor for the
           biosynthesis of chitin and for the formation of
           N-glycosylated mannoproteins and
           glycosylphosphatidylinositol anchors
          Length = 557

 Score =  522 bits (1345), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/555 (51%), Positives = 366/555 (65%), Gaps = 28/555 (5%)

Query: 7   YEQYCK--------QGHAYTYGTAGFRAHNSVLDTVMFTTGIVAVLRSIYLKSKFVGVMI 58
           YEQ CK        +   ++YGTAGFR     LDTVMF+TGI+AVLRS+ L+ ++VGVMI
Sbjct: 5   YEQLCKLYDDTCRTKNVQFSYGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYVGVMI 64

Query: 59  TASHNPPEDNGVKVVEPYGEMLVQNWEPIATKLANAAS--SSFTQLESTLQSIIAELNID 116
           TASHNP +DNGVK+VEP G ML+  WEP A +LANAAS  ++F +    L  +I    ID
Sbjct: 65  TASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANAASFATNFEEFRVELAKLIEHEKID 124

Query: 117 --TTQLANITVARDSRESGPRLLAALKAGI-SVFPAVKIIDFELLTTPQLHFLV-----Y 168
             TT + +I V RDSRES P LL  L + + SVF A +++D   +TTPQLH++       
Sbjct: 125 LNTTVVPHIVVGRDSRESSPYLLRCLTSSMASVFHA-QVLDLGCVTTPQLHYITDLSNRR 183

Query: 169 SLNTSSQPSQVRDSTYYDHFVSIWNQLTQLYEVTE---LPFHLTIDCANGIGADKVKQLI 225
            L   + P    +  YY  F+  +N+L   Y++ +   +P  L ID ANGIG  ++K+L+
Sbjct: 184 KLEGDTAPVAT-EQDYYSFFIGAFNELFATYQLEKRLSVP-KLFIDTANGIGGPQLKKLL 241

Query: 226 -SQAGHMLENSLTAVNGETKTFQLLNESCGADFVKTNQTFPANCNPKP-SQLYCSFDGDA 283
            S+   +    +  +N  +   +LLN  CGAD+VKTNQ  P   +P     LYCSFDGDA
Sbjct: 242 ASEDWDVPAEQVEVINDRSDVPELLNFECGADYVKTNQRLPKGLSPSSFDSLYCSFDGDA 301

Query: 284 DRVVFYYVDGKENKFHLLDGDKIATLLAKLIADLLRDCGLSDTLKLGVVQTAYANGSSTK 343
           DRVVFYYVD   +KFHLLDGDKI+TL AK ++  L    L  +LK+GVVQTAYANGSST 
Sbjct: 302 DRVVFYYVDSG-SKFHLLDGDKISTLFAKFLSKQLELAHLEHSLKIGVVQTAYANGSSTA 360

Query: 344 YITDKLKIPVSCTKTGVKHLHHEAVSRYDIGIYFEANGHGTVIFSREFLETVDSRLQETS 403
           YI + L  PVSCTKTGVKHLHHEA ++YDIGIYFEANGHGT+IFS +F  T+ S L ++ 
Sbjct: 361 YIKNTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHRTIKSELSKSK 420

Query: 404 GNEXXXXXXXXXXXXXXXINQTVGDAISDMLAVIATLSIFNLKPEDWDGCYQDLPNRLTK 463
            N                INQTVGDAISDMLAV+ATL+I  + P DWD  Y DLPN+L K
Sbjct: 421 LN-GDTLALRTLKCFSELINQTVGDAISDMLAVLATLAILKMSPMDWDEEYTDLPNKLVK 479

Query: 464 VIVPDRSVFVSTNAERQLLSPEGLQAKIDLLVTQFPNSRSFVRASGTEDAVRVYAEAETT 523
            IVPDRS+F +T+ ER+LL+P GLQ KIDL+V ++P  RSFVRASGTEDAVRVYAE + +
Sbjct: 480 CIVPDRSIFQTTDQERKLLNPVGLQDKIDLVVAKYPMGRSFVRASGTEDAVRVYAECKDS 539

Query: 524 ESAIELATKVGELVK 538
               +   +V E VK
Sbjct: 540 SKLGQFCDEVVEHVK 554

>ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 550

 Score =  521 bits (1343), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/548 (51%), Positives = 356/548 (64%), Gaps = 29/548 (5%)

Query: 6   LYEQYCKQG-HAYTYGTAGFRAHNSVLDTVMFTTGIVAVLRSIYLKSKFVGVMITASHNP 64
           L +QYC      Y YGTAGFR   + LDTV+F TGI+A LRS+ LK   +GVM+TASHNP
Sbjct: 10  LIDQYCSNSDRHYVYGTAGFRGPAATLDTVLFATGILACLRSLALKGDVIGVMVTASHNP 69

Query: 65  PEDNGVKVVEPYGEMLVQNWEPIATKLANA------------ASSSFTQLESTLQSIIAE 112
           P DNGVKVVEP G M+ ++WEP+AT+LAN             A+ S+ Q E   Q   A 
Sbjct: 70  PVDNGVKVVEPDGSMMPESWEPLATELANTLAIKGSSHERAQATHSWLQRELKGQLQSAN 129

Query: 113 LNIDTTQLANITVARDSRESGPRLLAALKAGISVFPAVKIIDFELLTTPQLHFLVYSLNT 172
            + +   +  + V RDSRESGP+LL+ L A        KI D  LLTTPQLHFL  +  T
Sbjct: 130 NSYNEGIVPTLVVGRDSRESGPKLLSCLVASAKELFHAKIHDQGLLTTPQLHFL--TSET 187

Query: 173 SSQPSQVRDSTYYDHFVSIWNQLTQLYEVTE-LPF--HLTIDCANGIGADKVKQLISQAG 229
           +   + V +S YY+HF+  W+ + QL+ + E LP    LTID ANGIGA KV++L+SQ  
Sbjct: 188 AKGVANVTESRYYEHFLQAWDYVAQLHGIGESLPTISSLTIDAANGIGAPKVQELLSQWA 247

Query: 230 HMLENSLTAVNGETKTFQLLNESCGADFVKTNQTFPANCNPKPSQLYCSFDGDADRVVFY 289
                 +  +N +    +LLN  CGADFVK+NQ  P   N   + L CS+DGDADRVVFY
Sbjct: 248 --CRGQVHFINDKWTNPELLNHECGADFVKSNQRCPLGFN-DSTGLGCSYDGDADRVVFY 304

Query: 290 YVDGKENKFHLLDGDKIATLLAKLIADLLRDCGLSDTLKLGVVQTAYANGSSTKYITDKL 349
           Y++ + N+F LLDGD+I+ L A   A +L+  GL   L LGVVQTAYANG+ST+Y+   L
Sbjct: 305 YIN-EANEFCLLDGDRISGLFAHFFAGILKQAGLQSELSLGVVQTAYANGNSTEYLQKTL 363

Query: 350 KIPVSCTKTGVKHLHHEAVSRYDIGIYFEANGHGTVIFSREFLETVDSRLQETSGNEXXX 409
           ++PVSC KTGVKHLHHEAV++YDIGIYFEANGHGT+IFS +F + +  + + +   E   
Sbjct: 364 QVPVSCAKTGVKHLHHEAVTKYDIGIYFEANGHGTIIFSPKFYKVIKEQKERSVAVE--- 420

Query: 410 XXXXXXXXXXXXINQTVGDAISDMLAVIATLSIFNLKPEDWDGCYQDLPNRLTKVIVPDR 469
                       INQTVGDAISDML V+A LSI    PE W   + DLPNRL KV+VPDR
Sbjct: 421 ----TLEAFSRLINQTVGDAISDMLGVLAALSISKWTPEHWGQEFTDLPNRLAKVVVPDR 476

Query: 470 SVFVSTNAERQLLSPEGLQAKIDLLVTQFPNSRSFVRASGTEDAVRVYAEAETTESAIEL 529
           SVF++T+ ER+L  PEGLQ KID  V  F   RSFVRASGTEDAVRVYAEA + E   +L
Sbjct: 477 SVFITTDQERRLTKPEGLQQKIDEAVKCFQQGRSFVRASGTEDAVRVYAEAASLEDVEKL 536

Query: 530 ATKVGELV 537
           +  V ELV
Sbjct: 537 SNTVKELV 544

>TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {ON}
           Anc_6.11 YEL058W
          Length = 558

 Score =  517 bits (1332), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 275/534 (51%), Positives = 354/534 (66%), Gaps = 25/534 (4%)

Query: 5   DLYEQYCK-QGHAYTYGTAGFRAHNSVLDTVMFTTGIVAVLRSIYLKSKFVGVMITASHN 63
           DL+ + CK + H YTYGTAGFR   ++LDTVMFTTG VA LRS+    K VGVM+TASHN
Sbjct: 12  DLFHKICKTKNHVYTYGTAGFRDKAAILDTVMFTTGFVACLRSLSHDGKAVGVMVTASHN 71

Query: 64  PPEDNGVKVVEPYGEMLVQNWEPIATKLANAASSSFTQLESTLQSIIAEL-NIDTTQLAN 122
           PP DNGVK+VEP G ML Q+WEPIAT LAN AS    +++  +Q + A+L  +++ ++  
Sbjct: 72  PPVDNGVKIVEPNGSMLSQDWEPIATDLANLASQG--KIDELVQFVNAKLIELNSNKVPT 129

Query: 123 ITVARDSRESGPRLLAALKAG-ISVFPAVKIIDFELLTTPQLHFLVYSLNTSSQPSQVRD 181
           + V RDSRES   LL  LK G + +F A KI+D+ELLTTPQLHFL  + N   +    ++
Sbjct: 130 LIVGRDSRESSTSLLECLKEGSLKLFDA-KIVDYELLTTPQLHFLTNAYNL--EKDLPKE 186

Query: 182 STYYDHFVSIWNQLTQLYE-----VTELPFHLTIDCANGIGADKVKQLISQAGHMLENSL 236
           + YY HF + W+QL  +        +     L ID ANGIG  K++ L+       +  L
Sbjct: 187 TDYYHHFNNAWDQLISINNDASSSTSNKIESLIIDSANGIGGPKMENLLKYWKTNYKVRL 246

Query: 237 TAVNGETKTFQLLNESCGADFVKTNQTFPANC------NPKPSQLYCSFDGDADRVVFYY 290
             +N   K  + LN +CGAD+VKTNQ  P             + ++CSFDGDADRVVFYY
Sbjct: 247 --INNNWKRPESLNNNCGADYVKTNQKLPNGITTDIINESSKNVIHCSFDGDADRVVFYY 304

Query: 291 VDGKENKFHLLDGDKIATLLAKLIADLLRDCGL--SDTLKLGVVQTAYANGSSTKYITDK 348
            D + N F+LLDGDKI+TL A  I+  L+  G+   + +KLGVVQTAYANGSST Y+   
Sbjct: 305 QDPQSNTFNLLDGDKISTLFANFISMQLKLAGIDYENEIKLGVVQTAYANGSSTNYLQQN 364

Query: 349 LKIPVSCTKTGVKHLHHEAVSRYDIGIYFEANGHGTVIFSREFLETVDSRLQETSG--NE 406
           LKIPV+C KTGVKHLHHEA +RYDIG+YFEANGHGT+IFS  F + ++ ++   S   N 
Sbjct: 365 LKIPVACAKTGVKHLHHEACTRYDIGVYFEANGHGTIIFSENFYKIINQKINAESQIENT 424

Query: 407 XXXXXXXXXXXXXXXINQTVGDAISDMLAVIATLSIFNLKPEDWDGCYQDLPNRLTKVIV 466
                          INQTVGDAISDM+ V+A L+I N  P+ W+  Y DLPN+L K++V
Sbjct: 425 PKLRALKTLKVLSALINQTVGDAISDMMGVMAVLAILNWTPQIWNKEYTDLPNKLAKLVV 484

Query: 467 PDRSVFVSTNAERQLLSPEGLQAKIDLLVTQFPNSRSFVRASGTEDAVRVYAEA 520
           PDRSVF +T+ ER+L SP GLQ+KI+ +V ++ N RSFVRASGTEDAVRVYAEA
Sbjct: 485 PDRSVFETTDQERKLTSPAGLQSKINKIVAKYENGRSFVRASGTEDAVRVYAEA 538

>KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.11
           YEL058W
          Length = 538

 Score =  489 bits (1259), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 281/551 (50%), Positives = 345/551 (62%), Gaps = 36/551 (6%)

Query: 2   SFRDLYEQYCK-QGHAYTYGTAGFRAHNSVLDTVMFTTGIVAVLRSIYLKSKFVGVMITA 60
           + R +++  C  +G+ YTYGTAGFR   +VLDTVMF TG VAVLRS  L    VGVM+TA
Sbjct: 5   AVRAVFDAVCTTKGYTYTYGTAGFRDKAAVLDTVMFATGCVAVLRSWRLNGAQVGVMVTA 64

Query: 61  SHNPPEDNGVKVVEPYGEMLVQNWEPIATKLAN-AASSSFTQLESTLQSIIAELNIDTTQ 119
           SHNPPEDNGVKVV+P G ML + WEP+AT+LAN AA+ +F Q      S++ E N   T 
Sbjct: 65  SHNPPEDNGVKVVDPEGGMLPEQWEPLATRLANLAANGTFDQWWEYWTSLVEEGNY--TG 122

Query: 120 LANITVARDSRESGPRLLAAL-KAGISVFPAVKIIDFELLTT-PQLHFLVYSLNTSSQPS 177
            A + V  D+RES PRLL  L  A ++V      I    +T  PQLH+L     TS Q  
Sbjct: 123 GARLCVGHDTRESSPRLLKNLMDAALAVSGGSITISKPWITNHPQLHYL-----TSLQRD 177

Query: 178 QVRDSTYY-DHFVSIWNQLTQLYEVTELPF-HLTIDCANGIGADKVKQLISQAGHMLENS 235
            V D+  Y DHF   W +L     V   PF  L ID ANG+GA +++Q   +   + +N 
Sbjct: 178 GVTDAAAYNDHFQGCWQKLFP-DGVVAWPFDRLFIDTANGVGAVQLQQFF-KGWAVDQNK 235

Query: 236 LTAVNGETKTFQLLNESCGADFVKTNQTFPANCNPKPSQ---------LYCSFDGDADRV 286
              +N +  T + LN  CGADFVKTN   P+     P Q         LYCSFDGDADR+
Sbjct: 236 FRLLNTDYGTPENLNVKCGADFVKTNHRLPSEV---PDQRGTSGALPDLYCSFDGDADRI 292

Query: 287 VFYYVDGKENKFHLLDGDKIATLLAKLIADLLRDCGLSDTLKLGVVQTAYANGSSTKYIT 346
           VFY+V  K  +FHLLDGDKI+TL AK I  L    G  D L +GVVQTAYANG+ST+YI 
Sbjct: 293 VFYFV--KNKQFHLLDGDKISTLFAKFIGQLTARAGADDKLTVGVVQTAYANGNSTRYIA 350

Query: 347 DKLKIPVSCTKTGVKHLHHEAVSRYDIGIYFEANGHGTVIFSREFLETVDSRLQETSGNE 406
            +L IP +CTKTGVKHLHH A ++YDIGIYFEANGHGTV+FS +F E V       +G  
Sbjct: 351 SELGIPSACTKTGVKHLHHVAKTQYDIGIYFEANGHGTVVFSDKFNEVV-------AGVA 403

Query: 407 XXXXXXXXXXXXXXXINQTVGDAISDMLAVIATLSIFNLKPEDWDGCYQDLPNRLTKVIV 466
                          INQTVGDAI+DML V+A L      PE W   Y DLPN LTKV+V
Sbjct: 404 STNDAASTLYHFSKLINQTVGDAIADMLGVLAVLIKLQWTPEVWGAEYTDLPNLLTKVVV 463

Query: 467 PDRSVFVSTNAERQLLSPEGLQAKIDLLVTQFPNSRSFVRASGTEDAVRVYAEAETTESA 526
           PDRS+F +T+ ER+L+SPEGLQ KID  V +F  +RSFVRASGTE+AVR+Y EAE  +  
Sbjct: 464 PDRSIFETTDQERRLVSPEGLQEKIDACVGRFKRARSFVRASGTENAVRIYCEAEDPQEV 523

Query: 527 IELATKVGELV 537
            EL+ +V E V
Sbjct: 524 QELSKQVTEAV 534

>NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 40/80 (50%), Gaps = 14/80 (17%)

Query: 22  AGFRAHNSVLDTVMFTTGIVAVLRSIYLKSKFVGVMITASHNPPEDNGVKV--------V 73
           AGF+      D     T +V     + LK+  VGVMITASHNP  DNG KV        +
Sbjct: 123 AGFKVFYLTPDDQFVHTPLVP-FSVLNLKAS-VGVMITASHNPKMDNGYKVYYDNACQII 180

Query: 74  EPY----GEMLVQNWEPIAT 89
            P+     EM+ +N EP +T
Sbjct: 181 PPHDKNIAEMIQKNLEPWST 200

>CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278w
          Length = 617

 Score = 37.7 bits (86), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 59/136 (43%), Gaps = 36/136 (26%)

Query: 7   YEQYCKQGHAYTYGTAGFRA-----HNSVLDTVMFTTGIVAVLRSIYLKSKFVGVMITAS 61
           + Q   Q  A T+  AGF+      H+  + T M       V  S+   +  VGVMITAS
Sbjct: 103 HSQEFAQVTAATFIRAGFKVYYLNPHDEFVHTPM-------VPYSVDHLNASVGVMITAS 155

Query: 62  HNPPEDNGVKV--------VEPY----GEMLVQNWEPIATK------LANAASSSFTQ-- 101
           HNP  DNG KV        + P+     E +  N EP +T       L+NA +    +  
Sbjct: 156 HNPKMDNGYKVYYTNGCQIIPPHDHGIAETINNNLEPWSTDWNFTKILSNAETDGKIEYV 215

Query: 102 ----LESTLQSIIAEL 113
               L S L S++ +L
Sbjct: 216 RKRMLTSYLNSVVNQL 231

>KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 607

 Score = 37.7 bits (86), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 27/48 (56%), Gaps = 12/48 (25%)

Query: 54  VGVMITASHNPPEDNGVKV--------VEPY----GEMLVQNWEPIAT 89
           VG+MITASHNP  DNG KV        + P+     E ++ N EP ++
Sbjct: 154 VGIMITASHNPKMDNGYKVYYTNGCQIIPPHDKLIAESIIHNLEPFSS 201

>TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840
           YMR278W
          Length = 629

 Score = 37.7 bits (86), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 41/85 (48%), Gaps = 14/85 (16%)

Query: 16  AYTYGTAGFRAHNSVLDTVMFTTGIVAVLRSIYLKSKFVGVMITASHNPPEDNGVKV--- 72
           A  +  AGF+ +    +     T +V     I L S  +GVMITASHNP  DNG KV   
Sbjct: 121 AAVFLNAGFKVYYLNPNDEFVHTPMVPF--GINLYSASIGVMITASHNPEMDNGYKVYYN 178

Query: 73  -----VEPY----GEMLVQNWEPIA 88
                + P+     E + +N EP++
Sbjct: 179 NGCQIIPPHDKNIAECIEKNLEPLS 203

>TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {ON}
           Anc_8.840 YMR278W
          Length = 630

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/19 (84%), Positives = 16/19 (84%)

Query: 54  VGVMITASHNPPEDNGVKV 72
           VGVMITASHNP  DNG KV
Sbjct: 159 VGVMITASHNPKMDNGYKV 177

>KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 16/19 (84%), Positives = 16/19 (84%)

Query: 54  VGVMITASHNPPEDNGVKV 72
           VGVMITASHNP  DNG KV
Sbjct: 154 VGVMITASHNPKMDNGYKV 172

>KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.840
           YMR278W
          Length = 624

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 15/18 (83%), Positives = 16/18 (88%)

Query: 55  GVMITASHNPPEDNGVKV 72
           GVMITASHNP +DNG KV
Sbjct: 158 GVMITASHNPKDDNGYKV 175

>Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON}
           complement(13542..15440) [1899 nt, 633 aa]
          Length = 632

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 16/19 (84%), Positives = 16/19 (84%)

Query: 54  VGVMITASHNPPEDNGVKV 72
           VGVMITASHNP  DNG KV
Sbjct: 157 VGVMITASHNPKMDNGYKV 175

>YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}
           PGM3Phosphoglucomutase, catalyzes interconversion of
           glucose-1-phosphate and glucose-6-phospate;
           transcription induced in response to stress; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; non-essential
          Length = 622

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 16/19 (84%), Positives = 16/19 (84%)

Query: 54  VGVMITASHNPPEDNGVKV 72
           VGVMITASHNP  DNG KV
Sbjct: 151 VGVMITASHNPKMDNGYKV 169

>Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 16/19 (84%), Positives = 16/19 (84%)

Query: 54  VGVMITASHNPPEDNGVKV 72
           VGVMITASHNP  DNG KV
Sbjct: 151 VGVMITASHNPKMDNGYKV 169

>Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 16/19 (84%), Positives = 16/19 (84%)

Query: 54  VGVMITASHNPPEDNGVKV 72
           VGVMITASHNP  DNG KV
Sbjct: 151 VGVMITASHNPKMDNGYKV 169

>ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278W
           Hypothetical ORF
          Length = 610

 Score = 35.8 bits (81), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 28/56 (50%), Gaps = 12/56 (21%)

Query: 22  AGFRAH-----NSVLDTVMFTTGIVAVLRSIYLKSKFVGVMITASHNPPEDNGVKV 72
           AGF  H     +S + T M    +  V  S       VGVMITASHNP  DNG KV
Sbjct: 117 AGFEVHYLNQGDSYVHTPMVPFTVDRVKAS-------VGVMITASHNPKLDNGYKV 165

>NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON}
           Anc_8.840 YMR278W
          Length = 626

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 15/19 (78%), Positives = 16/19 (84%)

Query: 54  VGVMITASHNPPEDNGVKV 72
           +GVMITASHNP  DNG KV
Sbjct: 154 IGVMITASHNPKMDNGYKV 172

>TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.840
           YMR278W
          Length = 643

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 15/19 (78%), Positives = 16/19 (84%)

Query: 54  VGVMITASHNPPEDNGVKV 72
           VGVM+TASHNP  DNG KV
Sbjct: 166 VGVMVTASHNPKMDNGYKV 184

>Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 35.4 bits (80), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 15/19 (78%), Positives = 16/19 (84%)

Query: 54  VGVMITASHNPPEDNGVKV 72
           VGVM+TASHNP  DNG KV
Sbjct: 151 VGVMVTASHNPKMDNGYKV 169

>Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {ON}
           YMR278W - Hypothetical ORF [contig 37] FULL
          Length = 620

 Score = 35.4 bits (80), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 8/37 (21%)

Query: 55  GVMITASHNPPEDNGVKV--------VEPYGEMLVQN 83
           GVMITASHNP  DNG KV        + P+  ++ Q+
Sbjct: 156 GVMITASHNPKMDNGYKVYYSNGCQIIPPHDRLIAQS 192

>ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR278W
          Length = 624

 Score = 34.7 bits (78), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 15/18 (83%), Positives = 15/18 (83%)

Query: 55  GVMITASHNPPEDNGVKV 72
           GVMITASHNP  DNG KV
Sbjct: 160 GVMITASHNPKMDNGYKV 177

>KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 621

 Score = 34.7 bits (78), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 14/18 (77%), Positives = 15/18 (83%)

Query: 55  GVMITASHNPPEDNGVKV 72
           G+MITASHNP  DNG KV
Sbjct: 157 GIMITASHNPKMDNGYKV 174

>SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 624

 Score = 34.3 bits (77), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 14/18 (77%), Positives = 15/18 (83%)

Query: 55  GVMITASHNPPEDNGVKV 72
           G+MITASHNP  DNG KV
Sbjct: 156 GIMITASHNPKMDNGYKV 173

>Ecym_2512 Chr2 (998772..1000241) [1470 bp, 489 aa] {ON} similar to
           Ashbya gossypii AGL223C
          Length = 489

 Score = 34.3 bits (77), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 67/168 (39%), Gaps = 37/168 (22%)

Query: 264 FPANCNPKPSQLYCSFDG-DADRVVFYYVDGKENKFHLLDG-DKIATLLAKLIADLLRDC 321
           F   CN K  Q+    D     R++F       +K  LLD  +++   LA L  DL + C
Sbjct: 180 FIQTCNTKQEQVLQRGDQTSGSRIIFDKWGNVIDKTSLLDEYERLRIYLAFLKHDLEQVC 239

Query: 322 GLSDTLKLG-VVQTAYANGSSTK----------YITDK---------LKIPVS------- 354
           G + TLK G  V+  ++ GS+            Y  D+         LK+ V+       
Sbjct: 240 GFNSTLKDGEEVEKLFSGGSTASSIFLTSYDEAYSYDESFFVNPESLLKLIVTQVGDTKV 299

Query: 355 --CTKTGVKH----LHHEAVSR--YDIGIYFEANGHGTVIFSREFLET 394
             C K G+ H    +HH   SR    +G  F+ +  G V F   F  T
Sbjct: 300 ILCDKNGIAHRLVRVHHPNSSRESRRLGANFQTDSFGEVRFLNNFANT 347

>Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar to
           Ashbya gossypii ABL126W
          Length = 630

 Score = 34.3 bits (77), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 14/18 (77%), Positives = 15/18 (83%)

Query: 55  GVMITASHNPPEDNGVKV 72
           G+MITASHNP  DNG KV
Sbjct: 164 GIMITASHNPKMDNGYKV 181

>Kwal_27.10709 s27 complement(458902..467241) [8340 bp, 2779 aa] {ON}
            YBL088C (TEL1) - putative phosphatidylinositol kinase
            [contig 33] FULL
          Length = 2779

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 53/137 (38%), Gaps = 22/137 (16%)

Query: 225  ISQAGHM-LENSLTAVNGETKTFQLLNESCGADFVK----TNQTFPANCNPKPSQLYCSF 279
            I Q  HM +E     ++  +++ QL N   G+ ++K     N   P N    P  + CS 
Sbjct: 2360 IEQFCHMCVELCCMKISKGSRSIQLENLRVGSYWLKEIKKQNVALPTN----PVSITCSA 2415

Query: 280  DGDADRVVFYYVDG------------KENKFHLLDGDKIATLLAKLIADLLRDCGLSDTL 327
            DG   R    ++D             K   FHL DG K   LL     DL +D  +    
Sbjct: 2416 DGRKPRATITHLDSSLDVSTSGLSLPKIATFHLSDGTKHKVLLKGSNDDLRQDAIMEQVF 2475

Query: 328  KLGVVQTAYANGSSTKY 344
            K  V Q    N  + ++
Sbjct: 2476 K-QVNQILLKNKQTRRF 2491

>KAFR0B06100 Chr2 (1255558..1260024) [4467 bp, 1488 aa] {ON}
           Anc_8.381 YDR180W
          Length = 1488

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 55/126 (43%), Gaps = 6/126 (4%)

Query: 147 FPAVKIID--FELLTTPQLHFLVYSLNTSSQPSQVRDSTYYDHFVSIWNQLTQ-LYEVTE 203
           F  V +ID  F ++T  Q     + LNT    +    + ++ +F+   + L   + ++  
Sbjct: 461 FKQVDMIDSNFSIITEKQKEIETFLLNTIDHVNNTLLNQFFGNFIKYRHSLENYIQDLIN 520

Query: 204 LPFHLTIDCANGIGADKVKQLISQAGHMLENSLTAVNGETKTFQLLNESCGADFVKTNQT 263
           L  HL    A  + +  +K+L+   G    N+  A N ET   QL+ +   A F    +T
Sbjct: 521 LFPHLEWPVAELLLSSMMKKLLMMFG---PNNSKAANAETVCLQLIGQIGCAIFDVRCRT 577

Query: 264 FPANCN 269
            P  CN
Sbjct: 578 RPNECN 583

>ZYRO0F06072g Chr6 (502106..503380) [1275 bp, 424 aa] {ON} similar
           to uniprot|Q02933 Saccharomyces cerevisiae YPL123C RNY1
           RNAse member of the T(2) family of endoribonucleases
          Length = 424

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 24/42 (57%)

Query: 223 QLISQAGHMLENSLTAVNGETKTFQLLNESCGADFVKTNQTF 264
           +L  Q+GH+++N    V G   TFQLL+   G  ++K+   +
Sbjct: 312 KLSGQSGHLIKNGHWMVRGTPATFQLLDHPFGDYYLKSRGGY 353

>KAFR0F03210 Chr6 complement(634603..635160) [558 bp, 185 aa] {ON}
           Anc_4.103 YGL018C
          Length = 185

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 25/44 (56%)

Query: 194 QLTQLYEVTELPFHLTIDCANGIGADKVKQLISQAGHMLENSLT 237
           QL + Y V +  FH  +   NG GAD    ++++A H+L+  L+
Sbjct: 44  QLRKEYRVLQSQFHPDMVAGNGDGADMDSSVVNKAYHVLKEPLS 87

>TPHA0H01980 Chr8 (467688..470669) [2982 bp, 993 aa] {ON} Anc_6.279
           YPL248C
          Length = 993

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 42/88 (47%), Gaps = 4/88 (4%)

Query: 85  EPIATKLANAASSSF---TQLESTLQSIIAELNIDTTQLANITVARDSRESGPRLLAALK 141
           +PIA  LA+  +  F   +   S L+SII   NI+  +L N+ V +  + +GP+ L    
Sbjct: 267 DPIAFLLADVNNCGFFGTSSQYSLLRSIIESKNININKLFNVNVCQTKKYTGPKPLTTKN 326

Query: 142 AGISVFPAVKIIDFELLTTPQLHFLVYS 169
           A  S     + +D    +   +HF + S
Sbjct: 327 ALTSRNVTAEYLD-SYFSNFHVHFPIVS 353

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.133    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 51,733,920
Number of extensions: 2102620
Number of successful extensions: 6033
Number of sequences better than 10.0: 54
Number of HSP's gapped: 6093
Number of HSP's successfully gapped: 55
Length of query: 541
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 427
Effective length of database: 40,409,475
Effective search space: 17254845825
Effective search space used: 17254845825
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)