Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D00836g6.10ON64064027440.0
SAKL0E00880g6.10ON63659021040.0
TBLA0G011106.10ON63859020830.0
ACR016W6.10ON64059420570.0
TPHA0M002006.10ON63459020430.0
Kpol_1045.776.10ON65059920350.0
TDEL0G046106.10ON63360620140.0
Kwal_56.223506.10ON65860220060.0
ZYRO0F00484g6.10ON64359419390.0
NCAS0D021906.10ON64559418680.0
CAGL0A01067g6.10ON64159718570.0
KAFR0B065006.10ON63660917620.0
NDAI0I027506.10ON66361017090.0
KLTH0C11528g6.10ON64244916080.0
KNAG0E027806.10ON65060115220.0
Suva_16.426.10ON65460614380.0
Skud_16.146.10ON65260714360.0
YPL263C (KEL3)6.10ON65160614170.0
Smik_6.4716.10ON65160614110.0
Kpol_1050.695.88ON10842551592e-10
CAGL0I02090g5.88ON11362601493e-09
KAFR0B043205.88ON9862291441e-08
ZYRO0B08228g5.88ON12932581379e-08
Suva_15.3575.88ON11722571371e-07
NCAS0F005205.88ON10862561361e-07
SAKL0H02618g5.88ON10852581342e-07
YHR158C (KEL1)5.88ON11642571333e-07
Kpol_1010.625.88ON9732571333e-07
Skud_8.2225.88ON11692571333e-07
Smik_8.2425.88ON11682571324e-07
TDEL0G011205.88ON10092581315e-07
KNAG0K005605.88ON11042681306e-07
NDAI0D026005.88ON11672581298e-07
Skud_7.5725.88ON8832461298e-07
TPHA0H010805.88ON8282561262e-06
KLTH0C01474g5.88ON10562571262e-06
YGR238C (KEL2)5.88ON8822481243e-06
Smik_16.685.88ON8941671217e-06
TPHA0A051705.88ON10162251182e-05
KLLA0E15511g5.88ON9052511163e-05
Suva_7.5305.88ON8942641145e-05
TBLA0C065305.88ON11722701092e-04
Kwal_14.10195.88ON9782211073e-04
CAGL0F07997g5.88ON9362681056e-04
TBLA0A043207.9ON838100960.006
ADL149W5.88ON1211245950.009
ZYRO0C00550g7.9ON848169900.037
Ecym_20615.88ON1362189890.052
KAFR0C049107.9ON87876880.060
TPHA0H002908.157ON1479115870.085
KAFR0I002007.9ON75367840.16
TDEL0A003403.15ON677101810.36
Kpol_538.457.9ON848175810.36
NCAS0A076407.9ON91386800.56
Kwal_55.207568.157ON157587790.71
ADR414C7.9ON78472780.80
TPHA0N004407.56ON757122751.7
KNAG0E041807.9ON81962742.8
KLTH0E06380g8.157ON1577104742.8
YOR371C (GPB1)7.9ON89788742.9
NCAS0I003407.9ON85880707.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D00836g
         (640 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D00836g Chr4 complement(78202..80124) [1923 bp, 640 aa] {ON...  1061   0.0  
SAKL0E00880g Chr5 complement(66646..68556) [1911 bp, 636 aa] {ON...   815   0.0  
TBLA0G01110 Chr7 complement(283630..285546) [1917 bp, 638 aa] {O...   806   0.0  
ACR016W Chr3 (384967..386889) [1923 bp, 640 aa] {ON} Syntenic ho...   796   0.0  
TPHA0M00200 Chr13 complement(40103..42007) [1905 bp, 634 aa] {ON...   791   0.0  
Kpol_1045.77 s1045 (180708..182660) [1953 bp, 650 aa] {ON} (1807...   788   0.0  
TDEL0G04610 Chr7 (840098..841999) [1902 bp, 633 aa] {ON} Anc_6.1...   780   0.0  
Kwal_56.22350 s56 complement(60828..62804) [1977 bp, 658 aa] {ON...   777   0.0  
ZYRO0F00484g Chr6 complement(47424..49355) [1932 bp, 643 aa] {ON...   751   0.0  
NCAS0D02190 Chr4 complement(408069..410006) [1938 bp, 645 aa] {O...   724   0.0  
CAGL0A01067g Chr1 (106866..108791) [1926 bp, 641 aa] {ON} simila...   719   0.0  
KAFR0B06500 Chr2 (1347509..1349419) [1911 bp, 636 aa] {ON} Anc_6...   683   0.0  
NDAI0I02750 Chr9 complement(644137..646128) [1992 bp, 663 aa] {O...   662   0.0  
KLTH0C11528g Chr3 (946632..948560) [1929 bp, 642 aa] {ON} simila...   624   0.0  
KNAG0E02780 Chr5 complement(559180..561132) [1953 bp, 650 aa] {O...   590   0.0  
Suva_16.42 Chr16 complement(60142..62106) [1965 bp, 654 aa] {ON}...   558   0.0  
Skud_16.14 Chr16 complement(23637..25595) [1959 bp, 652 aa] {ON}...   557   0.0  
YPL263C Chr16 complement(44551..46506) [1956 bp, 651 aa] {ON}  K...   550   0.0  
Smik_6.471 Chr6 (774663..776618) [1956 bp, 651 aa] {ON} YPL263C ...   548   0.0  
Kpol_1050.69 s1050 complement(150301..153555) [3255 bp, 1084 aa]...    66   2e-10
CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa] ...    62   3e-09
KAFR0B04320 Chr2 complement(893930..896890) [2961 bp, 986 aa] {O...    60   1e-08
ZYRO0B08228g Chr2 (641988..645869) [3882 bp, 1293 aa] {ON} simil...    57   9e-08
Suva_15.357 Chr15 complement(617637..618952,619001..621203) [351...    57   1e-07
NCAS0F00520 Chr6 (100048..103308) [3261 bp, 1086 aa] {ON} Anc_5....    57   1e-07
SAKL0H02618g Chr8 (259684..262941) [3258 bp, 1085 aa] {ON} simil...    56   2e-07
YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON} ...    56   3e-07
Kpol_1010.62 s1010 complement(151895..154816) [2922 bp, 973 aa] ...    56   3e-07
Skud_8.222 Chr8 complement(385114..388623) [3510 bp, 1169 aa] {O...    56   3e-07
Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {O...    55   4e-07
TDEL0G01120 Chr7 (229805..232834) [3030 bp, 1009 aa] {ON} Anc_5....    55   5e-07
KNAG0K00560 Chr11 complement(96678..99992) [3315 bp, 1104 aa] {O...    55   6e-07
NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {...    54   8e-07
Skud_7.572 Chr7 complement(940820..943471) [2652 bp, 883 aa] {ON...    54   8e-07
TPHA0H01080 Chr8 complement(232804..235290) [2487 bp, 828 aa] {O...    53   2e-06
KLTH0C01474g Chr3 (131243..134413) [3171 bp, 1056 aa] {ON} simil...    53   2e-06
YGR238C Chr7 complement(966039..968687) [2649 bp, 882 aa] {ON}  ...    52   3e-06
Smik_16.68 Chr16 (128068..130752) [2685 bp, 894 aa] {ON} YGR238C...    51   7e-06
TPHA0A05170 Chr1 complement(1161610..1164660) [3051 bp, 1016 aa]...    50   2e-05
KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} simi...    49   3e-05
Suva_7.530 Chr7 complement(920446..923130) [2685 bp, 894 aa] {ON...    49   5e-05
TBLA0C06530 Chr3 complement(1577728..1581246) [3519 bp, 1172 aa]...    47   2e-04
Kwal_14.1019 s14 (159934..162870) [2937 bp, 978 aa] {ON} YHR158C...    46   3e-04
CAGL0F07997g Chr6 complement(785803..788613) [2811 bp, 936 aa] {...    45   6e-04
TBLA0A04320 Chr1 (1068199..1070715) [2517 bp, 838 aa] {ON} Anc_7...    42   0.006
ADL149W Chr4 (427096..430731) [3636 bp, 1211 aa] {ON} Syntenic h...    41   0.009
ZYRO0C00550g Chr3 (39312..41858) [2547 bp, 848 aa] {ON} similar ...    39   0.037
Ecym_2061 Chr2 (99788..103876) [4089 bp, 1362 aa] {ON} similar t...    39   0.052
KAFR0C04910 Chr3 (975629..978265) [2637 bp, 878 aa] {ON} Anc_7.9...    39   0.060
TPHA0H00290 Chr8 (48215..52654) [4440 bp, 1479 aa] {ON} Anc_8.15...    38   0.085
KAFR0I00200 Chr9 (39428..41689) [2262 bp, 753 aa] {ON} Anc_7.9 Y...    37   0.16 
TDEL0A00340 Chr1 (58839..60872) [2034 bp, 677 aa] {ON} Anc_3.15 ...    36   0.36 
Kpol_538.45 s538 complement(101351..103897) [2547 bp, 848 aa] {O...    36   0.36 
NCAS0A07640 Chr1 complement(1521774..1524515) [2742 bp, 913 aa] ...    35   0.56 
Kwal_55.20756 s55 (545793..550520) [4728 bp, 1575 aa] {ON} YGL19...    35   0.71 
ADR414C Chr4 complement(1450330..1452684) [2355 bp, 784 aa] {ON}...    35   0.80 
TPHA0N00440 Chr14 complement(82249..84522) [2274 bp, 757 aa] {ON...    33   1.7  
KNAG0E04180 Chr5 complement(833612..836071) [2460 bp, 819 aa] {O...    33   2.8  
KLTH0E06380g Chr5 (580587..585320) [4734 bp, 1577 aa] {ON} simil...    33   2.8  
YOR371C Chr15 complement(1031489..1034182) [2694 bp, 897 aa] {ON...    33   2.9  
NCAS0I00340 Chr9 complement(45659..48235) [2577 bp, 858 aa] {ON}...    32   7.9  

>KLLA0D00836g Chr4 complement(78202..80124) [1923 bp, 640 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 640

 Score = 1061 bits (2744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/640 (82%), Positives = 527/640 (82%)

Query: 1   MAXXXXXXXXXARTEXXXXXXXXXXXXXXXXXXXXLSQXXXXXXXXXXXXLANFKREQEN 60
           MA         ARTE                    LSQ            LANFKREQEN
Sbjct: 1   MAKKKDKESKKARTEAKNKKALEKAAVKDKKKAKKLSQDEEEDDMDIEEMLANFKREQEN 60

Query: 61  FEKINVENVDRPDQRINPCMFVNPAHGKRELMMFXXXXXXXXXXXXHFYNDLFVYSLDTD 120
           FEKINVENVDRPDQRINPCMFVNPAHGKRELMMF            HFYNDLFVYSLDTD
Sbjct: 61  FEKINVENVDRPDQRINPCMFVNPAHGKRELMMFGGESTTQETGTTHFYNDLFVYSLDTD 120

Query: 121 TWKRYTSQNSPMPRSSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWLFDCSSKEWTK 180
           TWKRYTSQNSPMPRSSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWLFDCSSKEWTK
Sbjct: 121 TWKRYTSQNSPMPRSSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWLFDCSSKEWTK 180

Query: 181 VEQKNGPSARSGHRMAIWKNFIILHGGFRDLGTSTTYLNDLWVFDITNYKWKQVELPANH 240
           VEQKNGPSARSGHRMAIWKNFIILHGGFRDLGTSTTYLNDLWVFDITNYKWKQVELPANH
Sbjct: 181 VEQKNGPSARSGHRMAIWKNFIILHGGFRDLGTSTTYLNDLWVFDITNYKWKQVELPANH 240

Query: 241 PIPDARSGHSLISTAEGAVLYGGYTKVKAGKGLQKGKILSDCWYLKMKSDLGSIRWERRK 300
           PIPDARSGHSLISTAEGAVLYGGYTKVKAGKGLQKGKILSDCWYLKMKSDLGSIRWERRK
Sbjct: 241 PIPDARSGHSLISTAEGAVLYGGYTKVKAGKGLQKGKILSDCWYLKMKSDLGSIRWERRK 300

Query: 301 KQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRSIFYNELYTYQIENNRWYAMSL 360
           KQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRSIFYNELYTYQIENNRWYAMSL
Sbjct: 301 KQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRSIFYNELYTYQIENNRWYAMSL 360

Query: 361 RPQRKKKNFVQSKSNRNKDKELEDILNQILDKANLRDAEDDDESKVIEEQLNQLXXXXXX 420
           RPQRKKKNFVQSKSNRNKDKELEDILNQILDKANLRDAEDDDESKVIEEQLNQL      
Sbjct: 361 RPQRKKKNFVQSKSNRNKDKELEDILNQILDKANLRDAEDDDESKVIEEQLNQLDLIDFD 420

Query: 421 XXXXXXXXXXXXYETMSTLPHARFNAATAVVDDTLFIFGGTVEIGEKDYPIDSFYSIDMN 480
                       YETMSTLPHARFNAATAVVDDTLFIFGGTVEIGEKDYPIDSFYSIDMN
Sbjct: 421 DDDESDKKSAKSYETMSTLPHARFNAATAVVDDTLFIFGGTVEIGEKDYPIDSFYSIDMN 480

Query: 481 KLDGVKVYWEELKEVERAEKLXXXXXXXXXXXXXXXXXXXXXXXIVDSKLXXXXXXXXXX 540
           KLDGVKVYWEELKEVERAEKL                       IVDSKL          
Sbjct: 481 KLDGVKVYWEELKEVERAEKLGEQDSDDEFGDEDDDDEDDGEEEIVDSKLEAEDEEEEEE 540

Query: 541 XXXXXXXXXIPDLRPWLPHPKAFETLRAFYVRTGPTFLELAISSNRDSKGKHLKTKSFEL 600
                    IPDLRPWLPHPKAFETLRAFYVRTGPTFLELAISSNRDSKGKHLKTKSFEL
Sbjct: 541 EEEVEEEYEIPDLRPWLPHPKAFETLRAFYVRTGPTFLELAISSNRDSKGKHLKTKSFEL 600

Query: 601 CQDRWWERREQVRIEEDKLEELGGVEDVIEKDTSKTQRRR 640
           CQDRWWERREQVRIEEDKLEELGGVEDVIEKDTSKTQRRR
Sbjct: 601 CQDRWWERREQVRIEEDKLEELGGVEDVIEKDTSKTQRRR 640

>SAKL0E00880g Chr5 complement(66646..68556) [1911 bp, 636 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 636

 Score =  815 bits (2104), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/590 (65%), Positives = 453/590 (76%), Gaps = 5/590 (0%)

Query: 51  LANFKREQENFEKINVENVDRPDQRINPCMFVNPAHGKRELMMFXXXXXXXXXXXXHFYN 110
           LANFKREQE FE++ V  VDRP +RIN  M  NP HGKREL++F             FYN
Sbjct: 52  LANFKREQEKFEEVVVSTVDRPTRRINSSMVANPLHGKRELLLFGGENTNSTNSTTAFYN 111

Query: 111 DLFVYSLDTDTWKRYTSQNSPMPRSSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWL 170
           DLF YSLD D W++ +SQNSPMPRSSAA+A+HP+GV LIHGGEFSSPKQNTFYHYSD+WL
Sbjct: 112 DLFTYSLDGDQWRKISSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWL 171

Query: 171 FDCSSKEWTKVEQKNGPSARSGHRMAIWKNFIILHGGFRDLGTSTTYLNDLWVFDITNYK 230
            DC++KEWTK+EQKNGP+ARSGHR+ +WKN+ ILHGGFRDLGT TTYL+D W+FDIT YK
Sbjct: 172 LDCNTKEWTKIEQKNGPTARSGHRLTVWKNYFILHGGFRDLGTMTTYLSDCWLFDITTYK 231

Query: 231 WKQVELPANHPIPDARSGHSLISTAEGAVLYGGYTKVKAGKGLQKGKILSDCWYLKMKSD 290
           WKQV+ P NHPIPDARSGHSL+ T +GAVL+GGY KVKAGKGLQKGKIL+DCWYLKMKSD
Sbjct: 232 WKQVDFPPNHPIPDARSGHSLVPTPDGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKSD 291

Query: 291 LGSIRWERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRSIFYNELYTYQI 350
           +G+IRWERRKKQG QPSPRVGCSMVHHKGRG+LFGGV+DFEETEESL S+FYN+L+T+QI
Sbjct: 292 IGAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLESMFYNDLFTFQI 351

Query: 351 ENNRWYAMSLRPQRKKKNFVQSKSNRNKDKELEDILNQILDKANLRDAEDDDESKVIEEQ 410
           E NRWY+ SLRPQRK      SK+NRNKDKELEDILNQIL+KANL D  D++E + I + 
Sbjct: 352 ETNRWYSASLRPQRKAAK-ATSKNNRNKDKELEDILNQILEKANLND--DENEKETIGDV 408

Query: 411 LNQLXXXXXXXXXXXXXXXXXXYETMSTLPHARFNAATAVVDDTLFIFGGTVEIGEKDYP 470
           L +L                  Y     LPH RFNA+TAVVDDTLFIFGG  EIGEKDY 
Sbjct: 409 LKEL-DEEDSDSAEELNSEKKEYPIRIQLPHPRFNASTAVVDDTLFIFGGVWEIGEKDYS 467

Query: 471 IDSFYSIDMNKLDGVKVYWEELKEVERAEKLXXXXXXXXXXXXXXXXXXXXXXXIVDSKL 530
           IDSFY+ID+N+LDG+K+YWE+L+++E A++L                       I D KL
Sbjct: 468 IDSFYAIDLNRLDGIKIYWEDLRDIEMAKELGDEEEDFEDNEEDDEEDDDDEEEITDQKL 527

Query: 531 XXXXXXXXXXXXXXXXXXXIPDLRPWLPHPKAFETLRAFYVRTGPTFLELAISSNRDSKG 590
                              IPD RPWLPHPK FETLR FYVRTG  FLE AISSNRD++G
Sbjct: 528 -VAEDDDEEEEEEDEYEPEIPDPRPWLPHPKPFETLRGFYVRTGADFLEWAISSNRDARG 586

Query: 591 KHLKTKSFELCQDRWWERREQVRIEEDKLEELGGVEDVIEKDTSKTQRRR 640
           KHLK KSF+LCQDRWWERR+QVRIEEDKLEELGG+ +V+EKDTSK+++RR
Sbjct: 587 KHLKKKSFDLCQDRWWERRDQVRIEEDKLEELGGIGEVVEKDTSKSKKRR 636

>TBLA0G01110 Chr7 complement(283630..285546) [1917 bp, 638 aa] {ON}
           Anc_6.10 YPL263C
          Length = 638

 Score =  806 bits (2083), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/590 (64%), Positives = 449/590 (76%), Gaps = 4/590 (0%)

Query: 51  LANFKREQENFEKINVENVDRPDQRINPCMFVNPAHGKRELMMFXXXXXXXXXXXXHFYN 110
           L NFK++QE FEKIN+E V +P +RIN CM  NP HGK EL++F             FYN
Sbjct: 53  LENFKKQQEQFEKINIETVSKPTKRINSCMISNPIHGKNELILFGGENTSTTTT---FYN 109

Query: 111 DLFVYSLDTDTWKRYTSQNSPMPRSSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWL 170
           DLF Y+ + D WK+YTSQNSPMPRSS+A+ SHPTG+AL+HGGEFSSPKQNTFYHYSD+WL
Sbjct: 110 DLFTYNPENDQWKKYTSQNSPMPRSSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWL 169

Query: 171 FDCSSKEWTKVEQKNGPSARSGHRMAIWKNFIILHGGFRDLGTSTTYLNDLWVFDITNYK 230
            DC++KEW+KVE KNGPSARSGHRM +WKNFIILHGGFRDLGTSTTYL DLW+FD+T YK
Sbjct: 170 LDCATKEWSKVENKNGPSARSGHRMTVWKNFIILHGGFRDLGTSTTYLKDLWLFDVTKYK 229

Query: 231 WKQVELPANHPIPDARSGHSLISTAEGAVLYGGYTKVKAGKGLQKGKILSDCWYLKMKSD 290
           W QVE P NH IPDARSGHSLI T +GA+L+GGY KVKAGKGLQKGKILSDCWYLKMKSD
Sbjct: 230 WTQVEFPPNHAIPDARSGHSLIPTQDGALLWGGYCKVKAGKGLQKGKILSDCWYLKMKSD 289

Query: 291 LGSIRWERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRSIFYNELYTYQI 350
           +  IRWERRKKQG QPSPRVGCSMVHHKGRG+LFGGV+DFEETEESL S+FYN+L+TYQI
Sbjct: 290 VSGIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLDSLFYNDLFTYQI 349

Query: 351 ENNRWYAMSLRPQRKKKNFVQSKSNRNKDKELEDILNQILDKANLRDAEDDDESKVIEEQ 410
           E NRW+++S+R QRKK   +  K+ ++K+KEL+DILN IL K NL D +D ++   IEE+
Sbjct: 350 EINRWFSLSMRSQRKKTIKIGPKTTKDKEKELQDILNSILKKNNLTD-DDSEDPNAIEEE 408

Query: 411 LNQLXXXXXXXXXXXXXXXXXXYETMSTLPHARFNAATAVVDDTLFIFGGTVEIGEKDYP 470
           L                     YE M+ LPH RFNA TAVV+DTL+IFGG+ E+GEKDY 
Sbjct: 409 LKINDDESNSEDESKDGQVTKQYEVMNQLPHVRFNATTAVVNDTLYIFGGSWELGEKDYS 468

Query: 471 IDSFYSIDMNKLDGVKVYWEELKEVERAEKLXXXXXXXXXXXXXXXXXXXXXXXIVDSKL 530
           IDSFYSID+NKLDGV VYWE+++E+E A++L                       IVD KL
Sbjct: 469 IDSFYSIDLNKLDGVTVYWEDMEEIEAAKELGEQFSDEEDEDDEEEDEDDGEEEIVDQKL 528

Query: 531 XXXXXXXXXXXXXXXXXXXIPDLRPWLPHPKAFETLRAFYVRTGPTFLELAISSNRDSKG 590
                              IPD RPWLPHPK FETLRAFYVRTG TFLE AIS+NRDSKG
Sbjct: 529 VAEEDEEEEEIEADEDEMEIPDPRPWLPHPKPFETLRAFYVRTGATFLEWAISNNRDSKG 588

Query: 591 KHLKTKSFELCQDRWWERREQVRIEEDKLEELGGVEDVIEKDTSKTQRRR 640
           KHLK KSFEL +DRWWERR+QVRIEEDK+EELGG+E+++E+DT++  +RR
Sbjct: 589 KHLKKKSFELTEDRWWERRDQVRIEEDKMEELGGIENIVERDTTQVNKRR 638

>ACR016W Chr3 (384967..386889) [1923 bp, 640 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL263C (KEL3)
          Length = 640

 Score =  796 bits (2057), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/594 (65%), Positives = 448/594 (75%), Gaps = 9/594 (1%)

Query: 51  LANFKREQENFEKINVENVDRPDQRINPCMFVNPAHGKRELMMFXXXXXXXXXXXXHFYN 110
           LANFKR+Q  FE +NVE V+RP QR +  +  NP H KREL++F            HFYN
Sbjct: 52  LANFKRQQAEFEAVNVETVERPHQRSSSSLVANPLHNKRELILFGGEYTNQSTGMTHFYN 111

Query: 111 DLFVYSLDTDTWKRYTSQNSPMPRSSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWL 170
           DLF+YSLDTD WK+YTSQNSPMPRSSAA+A+HP+GV LIHGGEFSSPKQNTFYHYSD+WL
Sbjct: 112 DLFIYSLDTDQWKKYTSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWL 171

Query: 171 FDCSSKEWTKVEQKNGPSARSGHRMAIWKNFIILHGGFRDLGTSTTYLNDLWVFDITNYK 230
           FDC++ EWTK+EQKNGPS+RSGHRM +WKN+IILHGGFRDLGTSTTYLND W+FDIT YK
Sbjct: 172 FDCATHEWTKIEQKNGPSSRSGHRMTVWKNYIILHGGFRDLGTSTTYLNDCWLFDITTYK 231

Query: 231 WKQVELPANHPIPDARSGHSLISTAEGAVLYGGYTKVKAGKGLQKGKILSDCWYLKMKSD 290
           W+Q++ PANHPIPDARSGHSL+ T EGA+L+GGY KVKAGKGLQKGKIL+DCWYLKMKSD
Sbjct: 232 WQQLQFPANHPIPDARSGHSLLPTPEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMKSD 291

Query: 291 LGSIRWERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRSIFYNELYTYQI 350
           + +IRWERRKKQG QPS R GCSMVHHKGRG+LFGGVYD+EETEE L S+FYN+L+TY I
Sbjct: 292 VTAIRWERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGLDSLFYNDLFTYHI 351

Query: 351 ENNRWYAMSLRPQRKKKNFVQSKSNRNKDKELEDILNQILDKANLRDAEDDDESKVIEEQ 410
           E NRWY++SLR QR  K     KSNR+KDKELED+LN IL KANL D + D++ K IEE+
Sbjct: 352 ETNRWYSVSLRAQRHSKVKSAPKSNRDKDKELEDMLNAILKKANLDDDDGDEDGKTIEEE 411

Query: 411 LNQLXXXXXXXXXXXXXXXXXXYETMSTLPHARFNAATAVVDDTLFIFGGTVEIGEKDYP 470
           LN+L                  Y  +  LPH RFNA+TA+VDDTLFIFGG  E GEKDY 
Sbjct: 412 LNKL----ENDGITETEETKKSYPIVMKLPHPRFNASTAIVDDTLFIFGGVWEQGEKDYM 467

Query: 471 IDSFYSIDMNKLDGVKVYWEELKEVERAEKLXXXXXXXXXXXXXXXXXXXXXXXIVDSKL 530
           IDSFYSIDMNK+DGVKVYWE++  VERA++L                         D KL
Sbjct: 468 IDSFYSIDMNKVDGVKVYWEDMAAVERAKELGEEDEDDAEDDEDDDSEDDDEEEHSDRKL 527

Query: 531 XXXXXXXXXXXXXXXXXXXIPDLRPWLPHPKAFETLRAFYVRTGPTFLELAIS----SNR 586
                              IPD RPWLPHPKAFE+LRAFYVRTG +FLE AI+    +  
Sbjct: 528 -VAEEEEEEEEEDNEILPEIPDPRPWLPHPKAFESLRAFYVRTGASFLEWAITNKHNTRS 586

Query: 587 DSKGKHLKTKSFELCQDRWWERREQVRIEEDKLEELGGVEDVIEKDTSKTQRRR 640
           D+KGKHLK  SF+LCQ+RWWERREQVRIEEDKLEELGGV +VIEKD +K  +RR
Sbjct: 587 DAKGKHLKKHSFDLCQERWWERREQVRIEEDKLEELGGVGEVIEKDFTKPTKRR 640

>TPHA0M00200 Chr13 complement(40103..42007) [1905 bp, 634 aa] {ON}
           Anc_6.10 YPL263C
          Length = 634

 Score =  791 bits (2043), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/590 (63%), Positives = 452/590 (76%), Gaps = 8/590 (1%)

Query: 51  LANFKREQENFEKINVENVDRPDQRINPCMFVNPAHGKRELMMFXXXXXXXXXXXXHFYN 110
           LANFK+EQE FE+INVE+VD+P +RIN CM  NP HGK+EL++F            HFYN
Sbjct: 53  LANFKKEQEQFEQINVESVDKPTRRINSCMIANPNHGKKELLLFGGENTSQEQGVTHFYN 112

Query: 111 DLFVYSLDTDTWKRYTSQNSPMPRSSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWL 170
           DL+ ++ D D WK+ TSQNSPMPRSSAA+A+HP+G+AL+HGGEFSSPKQNTFYHYSD+WL
Sbjct: 113 DLYTFTPDNDLWKKITSQNSPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSDTWL 172

Query: 171 FDCSSKEWTKVEQKNGPSARSGHRMAIWKNFIILHGGFRDLGTSTTYLNDLWVFDITNYK 230
            DC+++EWTKVEQKNGPSARSGHR+ +WKN+ ILHGGFRDLG++T+YLND W+FDIT+YK
Sbjct: 173 LDCTTREWTKVEQKNGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLNDSWLFDITSYK 232

Query: 231 WKQVELPANHPIPDARSGHSLISTAEGAVLYGGYTKVKAGKGLQKGKILSDCWYLKMKSD 290
           W+Q+E P NHP+PDARSGHSLI T EGAVL+GGY KVKAGKGLQKGKIL DCWYLKMK+D
Sbjct: 233 WRQIEFPPNHPVPDARSGHSLIPTQEGAVLWGGYCKVKAGKGLQKGKILGDCWYLKMKAD 292

Query: 291 LGSIRWERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRSIFYNELYTYQI 350
             ++RWERRKKQG QPSPRVGCSMVHHKGRG+LFGGVYDFEETEESL SIFYN+L++YQI
Sbjct: 293 PSAVRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSIFYNDLFSYQI 352

Query: 351 ENNRWYAMSLRPQRKKKNFVQSKSNRNKDKELEDILNQILDKANLRDAEDDDESKVIEEQ 410
           E+NRWYA+ LR QRKK   + +KS++ K+ EL++ILN+IL+KANL+D ++D        +
Sbjct: 353 ESNRWYALQLRSQRKKVVRLNNKSSKEKELELQNILNEILEKANLKDDDED------ANE 406

Query: 411 LNQLXXXXXXXXXXXXXXXXXXYETMSTLPHARFNAATAVVDDTLFIFGGTVEIGEKDYP 470
           L+                    Y   + LPH RFNA+T VVDDTLFI+GG  E+GEKDY 
Sbjct: 407 LSNGLGSDSDSDDESEKVSKKEYIVRNQLPHHRFNASTTVVDDTLFIYGGVWELGEKDYS 466

Query: 471 IDSFYSIDMNKLDGVKVYWEELKEVERAEKLXXXXXXXXXXXXXXXXXXXXXXXIVDSKL 530
           IDS YSID+NKLDGV VYWE L ++E+A++L                        VD KL
Sbjct: 467 IDSMYSIDLNKLDGVTVYWENLHDIEKAKEL-GAINSDEEDEEDEDDEDDDEEETVDQKL 525

Query: 531 XXXXXXXXXXXXXXXXXXXIPDLRPWLPHPKAFETLRAFYVRTGPTFLELAISSNRDSKG 590
                              IPD RPWLPHPKAFE+LR FYVRTG +FLE AIS+N+ ++G
Sbjct: 526 -VAEEEEEEEEIEDADDMEIPDPRPWLPHPKAFESLRNFYVRTGASFLEWAISNNKHTRG 584

Query: 591 KHLKTKSFELCQDRWWERREQVRIEEDKLEELGGVEDVIEKDTSKTQRRR 640
           KHLKTKSFELCQDRWWERR+QVRIEEDKLEELGGV +VIEKDT+K+ +RR
Sbjct: 585 KHLKTKSFELCQDRWWERRDQVRIEEDKLEELGGVGEVIEKDTTKSTKRR 634

>Kpol_1045.77 s1045 (180708..182660) [1953 bp, 650 aa] {ON}
           (180710..182662) [1953 nt, 651 aa]
          Length = 650

 Score =  788 bits (2035), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/599 (63%), Positives = 456/599 (76%), Gaps = 9/599 (1%)

Query: 51  LANFKREQENFEKINVENVDRPDQRINPCMFVNPAHGKRELMMFXXXXXXXXXXXXHFYN 110
           LANFK+EQE FE+IN+E+V+RP +RINPCM  NP HGK EL++F             F+N
Sbjct: 52  LANFKKEQELFEQINIESVERPSRRINPCMIENPNHGKSELILFGGESTNKDTSTTQFFN 111

Query: 111 DLFVYSLDTDTWKRYTSQNSPMPRSSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWL 170
           DL+ Y+ + D W+RYTS+NSPMPRSSAA+A+HP+GVALIHGGEFSSPKQNTFYHYSD+WL
Sbjct: 112 DLYSYTPENDQWRRYTSKNSPMPRSSAAMAAHPSGVALIHGGEFSSPKQNTFYHYSDTWL 171

Query: 171 FDCSSKEWTKVEQKNGPSARSGHRMAIWKNFIILHGGFRDLGTSTTYLNDLWVFDITNYK 230
            DCS+KEWTKVEQKNGPSARSGHR++IWKN+ +LHGGFRDLGTSTTYLND W+FDITNYK
Sbjct: 172 LDCSTKEWTKVEQKNGPSARSGHRISIWKNYFMLHGGFRDLGTSTTYLNDCWLFDITNYK 231

Query: 231 WKQVELPANHPIPDARSGHSLISTAEGAVLYGGYTKVKAGKGLQKGKILSDCWYLKMKSD 290
           WKQ+E P NHPIPDARSGHS I T EGAVL+GGY KVKAGKGLQKGKIL+DCWYLKMK+D
Sbjct: 232 WKQIEFPPNHPIPDARSGHSFIPTQEGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKAD 291

Query: 291 LGSIRWERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRSIFYNELYTYQI 350
             +IRWERRKKQG QPSPRVGCSMVHHKGRG+LFGGVYDFEETEESL S+FYN+L++YQI
Sbjct: 292 PTAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSMFYNDLFSYQI 351

Query: 351 ENNRWYAMSLRPQRKKKNFVQSKSNRNKDKELEDILNQILDKANLR----DAEDDDESKV 406
           E NRW+A+ LRPQRKK   + +KS+++K+KEL+D+LNQIL+KANL       ++D+++K 
Sbjct: 352 EINRWFALQLRPQRKKVVRLNNKSSKDKEKELQDLLNQILEKANLNDKDDKDQEDEDAKA 411

Query: 407 IEEQLNQLXXXXXXXXX--XXXXXXXXXYETMSTLPHARFNAATAVVDDTLFIFGGTVEI 464
           IE +L++                     Y+ ++ LPH RFNA   VV+DTLFI+GG  E+
Sbjct: 412 IETELDRADHDTSDSDADDVEDAKEKKEYKVLTQLPHPRFNATMTVVNDTLFIYGGVWEL 471

Query: 465 GEKDYPIDSFYSIDMNKLDGVKVYWEELKEVERA-EKLXXXXXXXXXXXXXXXXXXXXXX 523
           GEKDY IDSFYSID+N+ DGV V WE+L E+E A E                        
Sbjct: 472 GEKDYTIDSFYSIDLNRTDGVTVLWEDLSEIEAAKEAGIVDSDEEDDEFGDSDDEDDGEE 531

Query: 524 XIVDSKLXXXXXXXXXXXXXXXX--XXXIPDLRPWLPHPKAFETLRAFYVRTGPTFLELA 581
            I+D KL                     IPD  PWLPHPK FE+LR FYVRTG TFLE A
Sbjct: 532 EIMDQKLVAEEEEEEEEEEEEEQVDEMEIPDPCPWLPHPKPFESLRVFYVRTGATFLEWA 591

Query: 582 ISSNRDSKGKHLKTKSFELCQDRWWERREQVRIEEDKLEELGGVEDVIEKDTSKTQRRR 640
           IS+NRD++GKHLK KSF+LCQDRWW+RR+QVRIEEDK+EELGG+ +VIEKDTSK+ +RR
Sbjct: 592 ISNNRDARGKHLKKKSFDLCQDRWWQRRDQVRIEEDKMEELGGIGEVIEKDTSKSTKRR 650

>TDEL0G04610 Chr7 (840098..841999) [1902 bp, 633 aa] {ON} Anc_6.10
           YPL263C
          Length = 633

 Score =  780 bits (2014), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/606 (62%), Positives = 446/606 (73%), Gaps = 41/606 (6%)

Query: 51  LANFKREQENFEKINVENVDRPDQRINPCMFVNPAHGKRELMMFXXXXXXXXXXXXHFYN 110
           LANFK+EQE FEK+ VEN++RP +RINP M  NP HGK EL+MF            HF+N
Sbjct: 53  LANFKKEQEQFEKVVVENIERPSRRINPSMIANPIHGKSELIMFGGEHTIQSTSTTHFFN 112

Query: 111 DLFVYSLDTDTWKRYTSQNSPMPRSSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWL 170
           DL V+S D + WKR +SQNSPMPRSSAA+  HP+GVAL+HGGEFSSPKQNTFYHYSD+WL
Sbjct: 113 DLVVFSPDNEQWKRISSQNSPMPRSSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTWL 172

Query: 171 FDCSSKEWTKVEQKNGPSARSGHRMAIWKNFIILHGGFRDLGTSTTYLNDLWVFDITNYK 230
            DC++KEWTK+EQKNGPSARSGHRMA+WKNFIILHGGFRDLGTSTTYLND W+FDIT YK
Sbjct: 173 LDCATKEWTKIEQKNGPSARSGHRMAVWKNFIILHGGFRDLGTSTTYLNDCWLFDITTYK 232

Query: 231 WKQVELPANHPIPDARSGHSLISTAEGAVLYGGYTKVKAGKGLQKGKILSDCWYLKMKSD 290
           WKQVE P NHP+PDARSGHSLI+  EGA+L+GGY KVKAGKGLQKGKIL+DCWYLKM S+
Sbjct: 233 WKQVEFPQNHPVPDARSGHSLIADQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMSSN 292

Query: 291 LGSIRWERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRSIFYNELYTYQI 350
             +IRW+R+K+QG QPSPRVGCSMV HKGRGVLFGGVYDFEETEESL S FYN+++TYQI
Sbjct: 293 TSAIRWDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLESNFYNDVFTYQI 352

Query: 351 ENNRWYAMSLRPQRKKKNFVQSKSNRNKDKELEDILNQILDKANLRDA------------ 398
             NRWY++SLRPQRKK+  + ++S ++++KELED+LN+IL  A L D             
Sbjct: 353 NMNRWYSLSLRPQRKKQVKLNNRSTKDQEKELEDLLNKILRNAQLDDQGEEEEIDAAEES 412

Query: 399 ----EDDDESKVIEEQLNQLXXXXXXXXXXXXXXXXXXYETMSTLPHARFNAATAVVDDT 454
               ED DES+ ++++                      +  M+ LPH RFNAATAVVDDT
Sbjct: 413 TAVEEDSDESESLDKE----------------------HVIMNELPHPRFNAATAVVDDT 450

Query: 455 LFIFGGTVEIGEKDYPIDSFYSIDMNKLDGVKVYWEELKEVERAEKLXXXXXXXXXXXXX 514
           LFIFGG  E GEKDY IDSFY ID+NK DGV VYWE+L  +E A+               
Sbjct: 451 LFIFGGVWEFGEKDYSIDSFYGIDLNKADGVTVYWEDLTALENAKDEDDSDEDEGEEDDD 510

Query: 515 XXXXXXXXXXIVDSKLXXXXXXXXXXXXXXXXXXXIPDLRPWLPHPKAFETLRAFYVRTG 574
                      VD KL                   IPD RPWLPHPKAFE+LR+FYVRTG
Sbjct: 511 DEEDSEEEQ--VDQKL-VAEDEDEEEEEFEEEEMEIPDPRPWLPHPKAFESLRSFYVRTG 567

Query: 575 PTFLELAISSNRDSKGKHLKTKSFELCQDRWWERREQVRIEEDKLEELGGVEDVIEKDTS 634
            TFLE AIS+NR  KGKHLKTKSFE+C+ RWWERR+QVR+EEDKLEELGGV ++IE+DT+
Sbjct: 568 ATFLEWAISNNRHVKGKHLKTKSFEICESRWWERRDQVRLEEDKLEELGGVGEIIERDTT 627

Query: 635 KTQRRR 640
           KT++RR
Sbjct: 628 KTKKRR 633

>Kwal_56.22350 s56 complement(60828..62804) [1977 bp, 658 aa] {ON}
           YPL263C (KEL3) - Kelch-repeat protein, similar to Kel1
           and Kel2 [contig 186] FULL
          Length = 658

 Score =  777 bits (2006), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/602 (63%), Positives = 446/602 (74%), Gaps = 33/602 (5%)

Query: 51  LANFKREQENFEKINVENVDRPDQRINPCMFVNPAHGKRELMMFXXXXXXXXXXXXHFYN 110
           LANFK+EQE F+++ V  V+RP QRIN CM  NP HGKREL++F             FYN
Sbjct: 78  LANFKKEQELFQEVLVTPVERPSQRINSCMVANPIHGKRELLIFGGEHTNSTNSLTAFYN 137

Query: 111 DLFVYSLDTDTWKRYTSQNSPMPRSSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWL 170
           +LF YSLD+D W++ TS+NSPMPRSSAA A+H +GVALIHGGEFSSPKQNTFYHYSD+WL
Sbjct: 138 ELFTYSLDSDQWRKITSRNSPMPRSSAAAAAHSSGVALIHGGEFSSPKQNTFYHYSDTWL 197

Query: 171 FDCSSKEWTKVEQKNGPSARSGHRMAIWKNFIILHGGFRDLGTSTTYLNDLWVFDITNYK 230
            DC++KEWTK+EQKNGPSARSGHRM IWKNF ILHGGFRDLGTSTTYLNDLW+FDIT YK
Sbjct: 198 LDCTTKEWTKMEQKNGPSARSGHRMTIWKNFFILHGGFRDLGTSTTYLNDLWIFDITTYK 257

Query: 231 WKQVELPANHPIPDARSGHSLISTAEGAVLYGGYTKVKAGKGLQKGKILSDCWYLKMKSD 290
           WKQVE P NHPIPDARSGHS+I T +GAVL+GGY KVKAGKGLQKGK L+DCWYLKMKSD
Sbjct: 258 WKQVEFPPNHPIPDARSGHSIIPTQDGAVLWGGYCKVKAGKGLQKGKTLTDCWYLKMKSD 317

Query: 291 LGSIRWERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRSIFYNELYTYQI 350
           + +IRWERRKKQG QPSPRVGCSMVHHKGRG+LFGGVYDFEETEE L S F+N+L++YQ+
Sbjct: 318 VSAIRWERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEETEEGLASEFFNDLFSYQV 377

Query: 351 ENNRWYAMSLRPQRKKKNFVQSKSNRNKDKELEDILNQILDKANL------------RDA 398
           E NRWY++ +RPQ KKK    S++NRNKD+ELE+ILN IL +ANL            R+ 
Sbjct: 378 EANRWYSVKMRPQ-KKKTVAISRNNRNKDEELENILNDILQQANLADDTDDDDNEIKREL 436

Query: 399 EDDDESKVIEEQLNQLXXXXXXXXXXXXXXXXXXYETMSTLPHARFNAATAVVDDTLFIF 458
           +  DE + +E    Q                   YE +  LPH RFNA TAVVDD LFIF
Sbjct: 437 QRIDEEEALENSRKQ-------------------YEVVGQLPHPRFNATTAVVDDFLFIF 477

Query: 459 GGTVEIGEKDYPIDSFYSIDMNKLDGVKVYWEELKEVERAEKLXXXXXXXXXXXXXXXXX 518
           GG  E GE+D+ IDSFYSID+NKLDGVKVYWE L E+E+A+ L                 
Sbjct: 478 GGVWEFGERDFSIDSFYSIDLNKLDGVKVYWENLSELEKAKALGEDDEEEFDDDEDDDDD 537

Query: 519 XXXXXXIVDSKLXXXXXXXXXXXXXXXXXXXIPDLRPWLPHPKAFETLRAFYVRTGPTFL 578
                   D KL                   IPDLRPWLPHPK FETLRAFY+RTG  FL
Sbjct: 538 DEEEE-TADQKLVAEDEEEEEEEEEEEDEPEIPDLRPWLPHPKPFETLRAFYIRTGAEFL 596

Query: 579 ELAISSNRDSKGKHLKTKSFELCQDRWWERREQVRIEEDKLEELGGVEDVIEKDTSKTQR 638
           + AIS+NRD+KGKHLK +SF+LCQDRWWERREQ+RIEEDKLEELGGVE+V+E+D ++T +
Sbjct: 597 KWAISNNRDAKGKHLKKQSFDLCQDRWWERREQIRIEEDKLEELGGVENVVERDPAQTMK 656

Query: 639 RR 640
           RR
Sbjct: 657 RR 658

>ZYRO0F00484g Chr6 complement(47424..49355) [1932 bp, 643 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 643

 Score =  751 bits (1939), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/594 (60%), Positives = 440/594 (74%), Gaps = 8/594 (1%)

Query: 51  LANFKREQENFEKINVENVDRPDQRINPCMFVNPAHGKRELMMFXXXXXXXXXXXXHFYN 110
           LA+FK+EQE FEK+ VE+VD+P  RINPC+  NPAHGK+EL++F            HFYN
Sbjct: 54  LASFKKEQEQFEKVVVESVDKPSARINPCLVSNPAHGKKELILFGGEYTNQSNSTTHFYN 113

Query: 111 DLFVYSLDTDTWKRYTSQNSPMPRSSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWL 170
           +LF ++ D D W++ +SQN+PMPRSSAA+A+HP+G+AL+HGGEFSSPKQNTFYHYSD+WL
Sbjct: 114 ELFTFTPDNDQWRKISSQNAPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSDTWL 173

Query: 171 FDCSSKEWTKVEQKNGPSARSGHRMAIWKNFIILHGGFRDLGTSTTYLNDLWVFDITNYK 230
            DC++KEWTK++QKNGP++RSGHRM +WKNF I++GGFRDLGTSTTYLND W+FDIT +K
Sbjct: 174 LDCTTKEWTKLDQKNGPASRSGHRMTVWKNFFIMYGGFRDLGTSTTYLNDCWLFDITTHK 233

Query: 231 WKQVELPANHPIPDARSGHSLISTAEGAVLYGGYTKVKAGKGLQKGKILSDCWYLKMKSD 290
           W QVE P NH IPDARSGHS I   EGA+L+GGY KVKAGKGLQKGKIL+DCWYLKM S 
Sbjct: 234 WTQVEFPRNHLIPDARSGHSFIPDQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMNST 293

Query: 291 LGSIRWERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRSIFYNELYTYQI 350
             +IRWERRKKQG QPSPRVGCSMV HKGRGVLFGGVYDFEETEESL S FYN+L+T+QI
Sbjct: 294 PSAIRWERRKKQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLDSNFYNDLFTFQI 353

Query: 351 ENNRWYAMSLRPQRKKKNFVQSKSNRNKDKELEDILNQILDKANL-RDAEDDDESKVIEE 409
           + NRWY++SLRPQRKK+  +   S ++++KEL+D LN+IL +A L    ED ++ K I E
Sbjct: 354 KTNRWYSLSLRPQRKKQVKISKSSTKDQEKELQDHLNRILQQAQLYDQDEDKEDDKAIRE 413

Query: 410 QLNQLXXXXXXXXXXXXXXXXXXYETMST-LPHARFNAATAVVDDTLFIFGGTVEIGEKD 468
           Q                        T+ST LPH RFN + AVV+DTLFI+GG  E+G+KD
Sbjct: 414 QFED----ENQSGDEDEEESTKKQHTISTQLPHPRFNTSLAVVNDTLFIYGGLWELGDKD 469

Query: 469 YPIDSFYSIDMNKLDGVKVYWEELKEVERAEKLXXXXX--XXXXXXXXXXXXXXXXXXIV 526
           Y IDSFY ID+NK+DGV VYWE L E+E+A+KL                         + 
Sbjct: 470 YNIDSFYGIDLNKVDGVTVYWENLAEIEKAKKLAEQGSDEDEDDEDEEDEDEDDDEEEVR 529

Query: 527 DSKLXXXXXXXXXXXXXXXXXXXIPDLRPWLPHPKAFETLRAFYVRTGPTFLELAISSNR 586
           D  L                   IPD RPWLPHPKAFE+LRAFYVR GP FLE AIS+NR
Sbjct: 530 DQVLVAEEEDAEEDEEVEEEEMEIPDPRPWLPHPKAFESLRAFYVRAGPQFLEWAISNNR 589

Query: 587 DSKGKHLKTKSFELCQDRWWERREQVRIEEDKLEELGGVEDVIEKDTSKTQRRR 640
           D++GKHLK KSF+LCQDRWWERR+QVRIEEDK+EELGGV D++E++ ++  +RR
Sbjct: 590 DARGKHLKQKSFDLCQDRWWERRDQVRIEEDKMEELGGVGDIVERNPAQKTKRR 643

>NCAS0D02190 Chr4 complement(408069..410006) [1938 bp, 645 aa] {ON}
           Anc_6.10
          Length = 645

 Score =  724 bits (1868), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/594 (58%), Positives = 422/594 (71%), Gaps = 5/594 (0%)

Query: 51  LANFKREQENFEKINVENVDRPDQRINPCMFVNPAHGKRELMMFXXXXXXXXXXXXHFYN 110
           LANFK +QE FE +NVE++ +P QR+N CM   P H K+EL++F            HFYN
Sbjct: 53  LANFKLQQEQFEHVNVESISKPAQRLNSCMITTPNHSKKELLIFGGEFTNPETSMTHFYN 112

Query: 111 DLFVYSLDTDTWKRYTSQNSPMPRSSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWL 170
           +L  YS D   W++ TSQNSPMPRSSAA+ +HP+G+AL+HGGEFSSPKQNTFYHYSD+WL
Sbjct: 113 ELITYSPDNGQWRKITSQNSPMPRSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTWL 172

Query: 171 FDCSSKEWTKVEQKNGPSARSGHRMAIWKNFIILHGGFRDLGTSTTYLNDLWVFDITNYK 230
            D  +KEWTK++   GP  RSGHR+ IWKN+ IL GGF+DLG ST+Y ND W FDIT YK
Sbjct: 173 LDTHTKEWTKMDSAKGPPGRSGHRITIWKNYFILSGGFKDLGHSTSYFNDCWCFDITTYK 232

Query: 231 WKQVELPANHPIPDARSGHSLISTAEGAVLYGGYTKVKAGKGLQKGKILSDCWYLKMKSD 290
           WKQ+E P NHPIPDARSGHS I T EG +L+GGY KVKAGKGLQKGKIL+DCWYLKMKSD
Sbjct: 233 WKQIEFPPNHPIPDARSGHSWIPTEEGCILWGGYCKVKAGKGLQKGKILNDCWYLKMKSD 292

Query: 291 LGSIRWERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRSIFYNELYTYQI 350
           L  +RWERRKKQG QPSPRVGCSM +HKGRG+LFGGVYDFEETEESL SIFYN+L++Y +
Sbjct: 293 LSQVRWERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESIFYNDLFSYNV 352

Query: 351 ENNRWYAMSLRPQRKKKNFVQS---KSNRNKDKELEDILNQILDKANLRDAEDDDESKVI 407
           E+NRW+++SLR  +K K   +S   KS++ K+KEL+D+LNQIL+K NL+D +DDDE    
Sbjct: 353 ESNRWFSLSLRKAQKFKKVAKSSNNKSSKEKEKELQDLLNQILEKNNLKDDDDDDEIST- 411

Query: 408 EEQLNQLXXXXXXXXXXXXXXXXXXYETMSTLPHARFNAATAVVDDTLFIFGGTVEIGEK 467
             +                         MS LPH RFNAAT VVDD+LFI+GG  E+GEK
Sbjct: 412 GTETETETAANSDDEDNKEHSKSAQVTVMSQLPHPRFNAATTVVDDSLFIYGGIWEMGEK 471

Query: 468 DYPIDSFYSIDMNKLDGVKVYWEELKEVERAEKLXXXXXXXXXXXXXXXXXXXXXXXIVD 527
           DY IDS YSID+NKLDGV  YWE+L+E+E+A+++                          
Sbjct: 472 DYAIDSLYSIDLNKLDGVSCYWEDLQEIEKAKEIGEQDSDEDEEEEDDEEDDDEEEIEDK 531

Query: 528 SKLXXXXXXXXXXXXXXXXXXXIPDLRPWLPHPKAFETLRAFYVRTGPTFLELAISSNRD 587
             +                   IPDLRPWLPHPK FE+LRAFY+R G  FLE AIS+N+ 
Sbjct: 532 KLVAEEDDEEEEEEEEEFEEMEIPDLRPWLPHPKPFESLRAFYIREGAAFLEWAISNNKH 591

Query: 588 SKGKHLKTKSFELCQDRWWERREQVRIEEDKLEELGGVEDVIEKDTS-KTQRRR 640
            +GKHLK KSF+LC+DRWWERR+QVRIEEDKLEELG V +VIEKDTS  T +RR
Sbjct: 592 VRGKHLKKKSFDLCEDRWWERRDQVRIEEDKLEELGVVGNVIEKDTSVPTSKRR 645

>CAGL0A01067g Chr1 (106866..108791) [1926 bp, 641 aa] {ON} similar
           to uniprot|Q08979 Saccharomyces cerevisiae YPL263c KEL3
          Length = 641

 Score =  719 bits (1857), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/597 (57%), Positives = 438/597 (73%), Gaps = 12/597 (2%)

Query: 51  LANFKREQENFEKINVENVDRPDQRINPCMFVNPA--HGKRELMMFXXXXXXXXXXXXHF 108
           LANFK+EQE FEK+ V++VD+ ++R+NPCM  NP+    K+EL++F             F
Sbjct: 50  LANFKKEQEQFEKVAVDSVDKVNKRLNPCMVGNPSASSSKKELIVFGGEFTNPQTSTTTF 109

Query: 109 YNDLFVYSLDTDTWKRYTSQNSPMPRSSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDS 168
           YNDL  ++ + + WKRYTSQN+PMPRSSAA+A+HP+G+AL+HGGEFSSPKQNTFYHYSD+
Sbjct: 110 YNDLHTFTPENNQWKRYTSQNAPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSDT 169

Query: 169 WLFDCSSKEWTKVEQKNGPSARSGHRMAIWKNFIILHGGFRDLGTSTTYLNDLWVFDITN 228
           W+ DC++KEW KV+ K GPSARSGHR+ +WKNF ILHGGFRDLGTSTTYL+D W+FDIT 
Sbjct: 170 WILDCNTKEWAKVDAKVGPSARSGHRITVWKNFFILHGGFRDLGTSTTYLSDCWLFDITT 229

Query: 229 YKWKQVELPANHPIPDARSGHSLISTAEGAVLYGGYTKVKAG-KGLQKGKILSDCWYLKM 287
           YKWKQVE P+NH +PDARSGHS I TAEGA+L+GGY KVKA  KG QKGKILSDCWYLKM
Sbjct: 230 YKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQKGKILSDCWYLKM 289

Query: 288 KSDLGSIRWERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRSIFYNELYT 347
           KSD+  IRWERR+KQG QPSPRVGCSM +HKGRG+LFGGVYDFEETEESL S F+N+L++
Sbjct: 290 KSDISGIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESNFFNDLFS 349

Query: 348 YQIENNRWYAMSLRPQRKKKNFVQSKSNRN---KDKELEDILNQILDKANLRD-AEDDDE 403
           Y IE+NRWY++S+R ++   N V  KS +N   ++KEL+ +L+ IL+KANL+D ++DD++
Sbjct: 350 YHIESNRWYSLSIRSRKSNNNAVAKKSGKNSKEQEKELKMLLDSILEKANLQDKSDDDED 409

Query: 404 SKVIEEQLNQLXXXXXXXXXXXXXXXXXXYETMSTLPHARFNAATAVVDDTLFIFGGTVE 463
            + I   L ++                  +  ++ LPH RFNA T V+DDTLFIFGG  E
Sbjct: 410 DEEINTALAKV-----DLEDEEEEQLAVQHTILTQLPHPRFNATTTVIDDTLFIFGGIWE 464

Query: 464 IGEKDYPIDSFYSIDMNKLDGVKVYWEELKEVERAEKLXXXXXXXXXXXXXXXXXXXXXX 523
           +G+K++ IDS YSID+NKLDGV +YWE+LKE+ERA++L                      
Sbjct: 465 LGDKEFMIDSLYSIDLNKLDGVTMYWEDLKEIERAKELGVEDSDFEDDDEDDDDEDDDEE 524

Query: 524 XIVDSKLXXXXXXXXXXXXXXXXXXXIPDLRPWLPHPKAFETLRAFYVRTGPTFLELAIS 583
              +                       PD RPWLPHPK FETLRAFY+R G  FLE AIS
Sbjct: 525 DDNEKDEGDDEESEEEEEEEIEEELEYPDPRPWLPHPKPFETLRAFYIREGAAFLEWAIS 584

Query: 584 SNRDSKGKHLKTKSFELCQDRWWERREQVRIEEDKLEELGGVEDVIEKDTSKTQRRR 640
           +N+++KGKHLK  SF+LCQ+RWWERR+Q+RIEEDKLEE+GGV D+IE+D S + +RR
Sbjct: 585 NNKNAKGKHLKKHSFDLCQERWWERRDQLRIEEDKLEEIGGVGDIIERDKSASSKRR 641

>KAFR0B06500 Chr2 (1347509..1349419) [1911 bp, 636 aa] {ON} Anc_6.10
           YPL263C
          Length = 636

 Score =  683 bits (1762), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/609 (55%), Positives = 425/609 (69%), Gaps = 44/609 (7%)

Query: 51  LANFKREQENFEKINVENVDRPDQRINPCMFVNPAHGKRELMMFXXXXXXXXXXXXHFYN 110
           L NFK+EQEN+EKIN+E+V++P  R N  +  +    K+EL++F             FYN
Sbjct: 52  LENFKKEQENYEKINIESVEKPSIRNNGSIISSTT--KKELLLFGGEHTSKELQTTKFYN 109

Query: 111 DLFVYSLDTDTWKRYTSQNSPMPRSSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWL 170
           DL+ +S D + WKR TSQNSPMPRSSAA+A+HP+G+AL++GGEFSSPKQ+TFYHYSD+W+
Sbjct: 110 DLYTFSPDNNQWKRITSQNSPMPRSSAAMAAHPSGIALLNGGEFSSPKQSTFYHYSDTWI 169

Query: 171 FDCSSKEWTKVEQKNGPSARSGHRMAIWKNFIILHGGFRDLGTSTTYLNDLWVFDITNYK 230
            D ++KEWTK+E K  P  RSGHR+  WKN+ IL GGF+DLG STTY ND+W+FDIT YK
Sbjct: 170 LDLTTKEWTKIEGKVKPVGRSGHRITTWKNYFILFGGFKDLGHSTTYYNDVWLFDITTYK 229

Query: 231 WKQVELPANHPIPDARSGHSLISTAEGAVLYGGYTKVKAGKGLQKGKILSDCWYLKMKSD 290
           WKQVE P NH +PDARSGHSLI T+EG ++YGGY K+KA KGLQKGK+LS CW LKMK+D
Sbjct: 230 WKQVEFPKNHTLPDARSGHSLIPTSEGCIVYGGYCKIKAKKGLQKGKLLSGCWNLKMKAD 289

Query: 291 LGSIRWERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRSIFYNELYTYQI 350
           + +IRWERR+KQG QPSPRVGCSM +HKGRG+LFGGVYDF+ETEESL SIFYN+L+TY I
Sbjct: 290 VEAIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESIFYNDLFTYNI 349

Query: 351 ENNRWYAMSLRPQRKKKNFVQS---KSNRNKDKELEDILNQILDKANLR----------- 396
           E+NRW+ ++L+ +      + S   KS++ K++EL+D+LNQIL+K NL+           
Sbjct: 350 ESNRWFNVTLKKRSNATKTISSTKNKSSKEKERELQDLLNQILEKNNLKPDDEEEEESSD 409

Query: 397 ----DAEDDDESKVIEEQLNQLXXXXXXXXXXXXXXXXXXYETMSTLPHARFNAATAVVD 452
               D EDD      EEQ N++                   +T++ LPH RFNA T V+D
Sbjct: 410 IFGSDDEDD------EEQKNKI-----------------DIKTVTQLPHPRFNATTTVID 446

Query: 453 DTLFIFGGTVEIGEKDYPIDSFYSIDMNKLDGVKVYWEELKEVERAEKLXXXXXXXXXXX 512
           D L+I+GG  E GE DY IDSFYSID+NKLDGV VYWE+L E+E A++L           
Sbjct: 447 DMLYIYGGAWEFGEIDYSIDSFYSIDLNKLDGVNVYWEDLNEIETAKELGEQGSEDEDED 506

Query: 513 XXXXXXXXXXXXIVDSKL-XXXXXXXXXXXXXXXXXXXIPDLRPWLPHPKAFETLRAFYV 571
                       + D+KL                    IPD RPWLPHPKAFE+LRAFY+
Sbjct: 507 DFEEDEEDGEEEVEDTKLIAEDVEDEKEEEEEEYPEMEIPDPRPWLPHPKAFESLRAFYL 566

Query: 572 RTGPTFLELAISSNRDSKGKHLKTKSFELCQDRWWERREQVRIEEDKLEELGGVEDVIEK 631
           R GP FLE AIS+NR ++GK LK KSFELCQDRWWERR+Q+ IEEDKLEE+G V DV+E+
Sbjct: 567 REGPAFLEWAISNNRHTRGKLLKQKSFELCQDRWWERRDQISIEEDKLEEIGVVGDVVER 626

Query: 632 DTSKTQRRR 640
           DTSK   +R
Sbjct: 627 DTSKAVSKR 635

>NDAI0I02750 Chr9 complement(644137..646128) [1992 bp, 663 aa] {ON}
           Anc_6.10 YPL263C
          Length = 663

 Score =  662 bits (1709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/610 (55%), Positives = 417/610 (68%), Gaps = 21/610 (3%)

Query: 51  LANFKREQENFEKINVENVDRPDQ-----RINPCMFVNP-AHGKR--ELMMFXXXXXXXX 102
           LANFK EQE FEKINVE + +        R N  M     AH K+  EL+MF        
Sbjct: 54  LANFKMEQEKFEKINVELLPQGQHNHISPRSNSSMITAASAHNKKGKELLMFGGEYTSPE 113

Query: 103 XXXXHFYNDLFVYSLDTDTWKRYTSQNSPMPRSSAAVASHPTGVALIHGGEFSSPKQNTF 162
               HFYNDL  Y+ DT  W++ TSQNSPMPRSSAA+  HP+G+A++HGGEFSSPKQNTF
Sbjct: 114 TGMTHFYNDLLSYTPDTQQWRKITSQNSPMPRSSAAMCYHPSGIAILHGGEFSSPKQNTF 173

Query: 163 YHYSDSWLFDCSSKEWTKVEQKNGPSARSGHRMAIWKNFIILHGGFRDLGTS-TTYLNDL 221
           YHYSD+W+ D S+KEWTKV+ K  P ARSGHR+  WKN+ +L GGF+D+G + T Y ND+
Sbjct: 174 YHYSDTWILDTSTKEWTKVDIKKSPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFNDV 233

Query: 222 WVFDITNYKWKQVELPANHPIPDARSGHSLISTAEGAVLYGGYTKVKAG--KGLQKGKIL 279
           W FDI NYKW QVE P NHP+PD RSGHS I   EG +L+GGYTKVK+    G QKGKIL
Sbjct: 234 WCFDILNYKWTQVEFPKNHPLPDPRSGHSWIPVEEGCILWGGYTKVKSKLKSGQQKGKIL 293

Query: 280 SDCWYLKMKSDLGSIRWERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRS 339
           +DCWYLKMKSDL SIRWERRKK G QPSPRVGCSM +HKGRG+LFGGVYDF+ETEESL S
Sbjct: 294 NDCWYLKMKSDLSSIRWERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLES 353

Query: 340 IFYNELYTYQIENNRWYAMSLRPQRKKKNFVQSKSNRN---KDKELEDILNQILDKANLR 396
           +FYN+L++Y +E NRW+A++LR  +K    ++  +N+N   K+KEL+D+LNQIL+K NL+
Sbjct: 354 LFYNDLFSYNVETNRWFALNLRKNQKGNKSLKRSNNKNSKEKEKELQDLLNQILEKNNLK 413

Query: 397 DAEDDDESKVIEEQLNQLXXXXXXXX----XXXXXXXXXXYETMSTLPHARFNAATAVVD 452
           D +D+D+ +V E +                             M+ LPH R+N A  VVD
Sbjct: 414 DEDDEDDEEVNENEDGSTTASTAATSDDEDTERTTQEAEGVTIMNQLPHPRYNVAMTVVD 473

Query: 453 DTLFIFGGTVEIGEKDYPIDSFYSIDMNKLDGVKVYWEELKEVERAEKL--XXXXXXXXX 510
           D LFI+GG+ E+GEKDY I+SFYSID+N++DGV  YWE+LKE+E+A++L           
Sbjct: 474 DLLFIYGGSWELGEKDYFINSFYSIDLNRIDGVTCYWEDLKEIEKAKELGEQDSDEEDDE 533

Query: 511 XXXXXXXXXXXXXXIVDSKLXXXXXXXXXXXXXXXXXXXIPDLRPWLPHPKAFETLRAFY 570
                         I D KL                   IPDLRPWLPHPK FE+LRAFY
Sbjct: 534 DDEEDDDEDDDEEEIKDQKL-VADDEDEEEEEEDVQEMEIPDLRPWLPHPKPFESLRAFY 592

Query: 571 VRTGPTFLELAISSNRDSKGKHLKTKSFELCQDRWWERREQVRIEEDKLEELGGVEDVIE 630
           +R GP FLE AIS+N+  +GKHLK KSFELC+DRWWERR+Q+RIEEDKLEELG V DVIE
Sbjct: 593 IREGPAFLEWAISNNKHVRGKHLKKKSFELCEDRWWERRDQIRIEEDKLEELGVVGDVIE 652

Query: 631 KDTSKTQRRR 640
           KDTSK   +R
Sbjct: 653 KDTSKGASKR 662

>KLTH0C11528g Chr3 (946632..948560) [1929 bp, 642 aa] {ON} similar
           to uniprot|Q08979 Saccharomyces cerevisiae YPL263C KEL3
           Cytoplasmic protein of unknown function
          Length = 642

 Score =  624 bits (1608), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/449 (65%), Positives = 353/449 (78%), Gaps = 9/449 (2%)

Query: 53  NFKREQENFEKINVENVDRPDQRINPCMFVNPAHGKRELMMFXXXXXXXXXXXXHFYNDL 112
           NF++EQE F+++ V  V RP  R N CM  NP+HGKREL++F             FYN+L
Sbjct: 54  NFRKEQELFQEVVVTPVKRPSPRSNVCMVPNPSHGKRELLIFGGEYTNQTSSTTTFYNEL 113

Query: 113 FVYSLDTDTWKRYTSQNSPMPRSSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWLFD 172
           F YSLDTD WK+ TS+N+PMPRSSAA A HP+GV LIHGGEFSSPKQNTFYHYSDSWL D
Sbjct: 114 FTYSLDTDQWKKITSRNAPMPRSSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLD 173

Query: 173 CSSKEWTKVEQKNGPSARSGHRMAIWKNFIILHGGFRDLGTSTTYLNDLWVFDITNYKWK 232
           CSSKEWTK++QKNGPSARSGHRM +WKNF ++HGGFRDLGTSTTYLND W+FDIT YKWK
Sbjct: 174 CSSKEWTKIDQKNGPSARSGHRMTVWKNFFVMHGGFRDLGTSTTYLNDCWLFDITTYKWK 233

Query: 233 QVELPANHPIPDARSGHSLISTAEGAVLYGGYTKVKAGKGLQKGKILSDCWYLKMKSDLG 292
           QVE P NHP+PDARSGHSLI T EGA+++GGY K+KA KGLQKGKIL+DCWYL+MKSD+ 
Sbjct: 234 QVEFPPNHPVPDARSGHSLIPTQEGAIVWGGYCKIKAKKGLQKGKILTDCWYLRMKSDIT 293

Query: 293 SIRWERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRSIFYNELYTYQIEN 352
            IRWERRKKQG QPSPRVGCSM HHKGRG+LFGGVYD+EETEE L S F+N+L +YQ+E 
Sbjct: 294 GIRWERRKKQGFQPSPRVGCSMAHHKGRGILFGGVYDYEETEEGLSSEFFNDLLSYQVEA 353

Query: 353 NRWYAMSLRPQRKKKNFVQSKSNRNKDKELEDILNQILDKANL--RDAEDDDESKVIEEQ 410
           NRWY++ +RPQ KKK    SKS ++KD EL  ILN IL KANL   + E+++    IE++
Sbjct: 354 NRWYSIKMRPQ-KKKIVAASKSAKSKDDELVGILNDILQKANLADEENEENESDSEIEKE 412

Query: 411 LNQLXXXXXXXXXXXXXXXXXXYETMSTLPHARFNAATAVVDDTLFIFGGTVEIGEKDYP 470
           L++L                  Y  ++ LPH+RFNAAT VVDDTLFIFGG+ E GE+D+ 
Sbjct: 413 LHRL------DEEELLGHQQKQYPVVAQLPHSRFNAATTVVDDTLFIFGGSWEYGERDFS 466

Query: 471 IDSFYSIDMNKLDGVKVYWEELKEVERAE 499
           IDSFYSID+N+ DGV+V+WE+L+E+E+A+
Sbjct: 467 IDSFYSIDLNRTDGVRVFWEDLEEIEKAK 495

 Score =  154 bits (389), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 69/91 (75%), Positives = 82/91 (90%)

Query: 550 IPDLRPWLPHPKAFETLRAFYVRTGPTFLELAISSNRDSKGKHLKTKSFELCQDRWWERR 609
           IPD RPWLPHPKAFETLRAFY+RTG  FL+ AIS+NR +KGKHLK +SF+L QDRWWERR
Sbjct: 552 IPDPRPWLPHPKAFETLRAFYIRTGAEFLQWAISNNRSAKGKHLKKQSFDLSQDRWWERR 611

Query: 610 EQVRIEEDKLEELGGVEDVIEKDTSKTQRRR 640
           EQVRIEEDKLEE+GGVE++IE+D+S + +RR
Sbjct: 612 EQVRIEEDKLEEMGGVENIIERDSSHSTKRR 642

>KNAG0E02780 Chr5 complement(559180..561132) [1953 bp, 650 aa] {ON}
           Anc_6.10 YPL263C
          Length = 650

 Score =  590 bits (1522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/601 (49%), Positives = 386/601 (64%), Gaps = 15/601 (2%)

Query: 51  LANFKREQENFEKINVENVDRPDQRINPCMFVNPAHGKRELMMFXXXXXXXXXXXXHFYN 110
           L NFK EQE FEK+ VE V  P  R N C+  N +  K EL++F             FYN
Sbjct: 54  LQNFKLEQEQFEKVVVELVPHPTPRNNACLVTNAS--KPELLLFGGERTNNETNMTKFYN 111

Query: 111 DLFVYSLDTDTWKRYTSQNSPMPRSSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWL 170
           DL VY+   + WK++TSQNSPMPRSSAA+ SH +GV ++ GGEFSSPKQNTFYHY+D+WL
Sbjct: 112 DLHVYNPQNNQWKKFTSQNSPMPRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWL 171

Query: 171 FDCSSKEWTKVEQKNGPSARSGHRMAIWKNFIILHGGFRDLGTSTTYLNDLWVFDITNYK 230
            D +++EW+K++ KNGPSARSGHR+  WKN+ IL GGF+DL   T+Y ND+W+F++ ++K
Sbjct: 172 LDNTTREWSKLDFKNGPSARSGHRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFK 231

Query: 231 WKQVELPANHPIPDARSGHSLISTAEGAVLYGGYTKVKA--GKGLQKGKILSDCWYLKMK 288
           W + E   N   PD RSGHS I + EG ++YGGY KVKA   K L KGK L+DCW LKM 
Sbjct: 232 WTKWET-TNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKMS 290

Query: 289 SDLGSIRWERRKKQGSQPSPRVGCSM-VHHKGRGVLFGGVYDFEETEESLRSIFYNELYT 347
            ++  I+WERR K+G QPSPRVGCSM +H   RG+LFGGVYD EETEE L SI+YN+LY+
Sbjct: 291 QNVNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLYS 350

Query: 348 YQIENNRWYAMSLRPQRKKKNFVQSKSNRN-----KDKELEDILNQILDKANLRDAEDDD 402
           Y IE+NRWY + LR   +  N  ++KS+ N     ++KEL+D+LN+IL++ +L+D E + 
Sbjct: 351 YNIESNRWYPLKLRKVTQNSNANRNKSSNNTVSKEQEKELQDLLNKILEQNDLKDEETNS 410

Query: 403 ESKVIEEQLNQLXXXXXXXXXXXXXXXXXXYETMSTLPHARFNAATAVVDDTLFIFGGTV 462
            S        +                      ++ LPH RFNA T V++DT +I+GG  
Sbjct: 411 YSGSNTPH-EETTTDREQDDNEEEEKMRTNLPKLNQLPHERFNACTTVLNDTFYIYGGMW 469

Query: 463 EIGEKDYPIDSFYSIDMNKLDGVKVYWEELKEVERAEKLXXXXXXXXXXXXXXXXXXXXX 522
           E  + DY IDSFYSID+NKLDG+  Y+E L+E+E  ++L                     
Sbjct: 470 EFKDNDYTIDSFYSIDLNKLDGITQYYENLQEIEEVKRLGDVQSEDDFEYEDDDDEDDGE 529

Query: 523 XXIVD-SKLXXXXXXXXXXXXXXXXXXXIPDLRPWLPHPKAFETLRAFYVRTGPTFLELA 581
               +                       IPD RPWLPHPKAFE+LR FY+R GP FLE A
Sbjct: 530 AEPTNERLEAEDDDEEENEEDEGIDEMEIPDPRPWLPHPKAFESLREFYIREGPKFLEWA 589

Query: 582 ISSNRDSKGKHLKTKSFELCQDRWWERREQVRIEEDKLEELGGVEDVIEKD--TSKTQRR 639
           IS+N+ +KGKHLK KSFELCQDRWWERR+Q++IEEDKL+ELG   D+IE+D  +  T RR
Sbjct: 590 ISNNKHAKGKHLKQKSFELCQDRWWERRDQIQIEEDKLQELGVGGDIIERDAQSPPTARR 649

Query: 640 R 640
           R
Sbjct: 650 R 650

>Suva_16.42 Chr16 complement(60142..62106) [1965 bp, 654 aa] {ON}
           YPL263C (REAL)
          Length = 654

 Score =  558 bits (1438), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/606 (48%), Positives = 381/606 (62%), Gaps = 22/606 (3%)

Query: 51  LANFKREQENFEKINVENVDRPDQRINPCMFVNPAHGKRELMMFXXXXXXXXXXXXHFYN 110
           L++F ++Q   E +++  V+RP  R++P MF NP H K EL +F            HFYN
Sbjct: 55  LSSFTKKQTELEHVDITAVERPSCRVHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYN 114

Query: 111 DLFVYSLDTDTWKRYTSQNSPMPRSSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWL 170
           DL+ YS+  ++WK+Y SQN+P+PRSS AVA H +G+AL+HGGEFSSPKQ+ FYHYSD+WL
Sbjct: 115 DLYSYSIKNNSWKKYVSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWL 174

Query: 171 FDCSSKEWTKVE---QKNGPSARSGHRMAIWKNFIILHGGFRDLGTS-TTYLNDLWVFDI 226
           FDC  K++TK+E   + + PSARSGHR+  WKN+ IL GGFRDLG+  T+YLNDLW FDI
Sbjct: 175 FDCHEKKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDI 234

Query: 227 TNYKWKQVELPANHPIPDARSGHSLISTAEGAVLYGGYTK--VKAGKGLQKGKILSDCWY 284
           +NYKW ++E    +  PDARSGH  + T   A+L GGY K   K  K L KGKIL+D W 
Sbjct: 235 SNYKWTKLE---TNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWK 291

Query: 285 LKMKSDLGSIRWERRKKQGSQPSPRVGCSM-VHHKGRGVLFGGVYDFEETEESLRSIFYN 343
           L +  D    +WE+ K   +QPSPRVG S  +  + + V FGGVYD +ETEESL SIFYN
Sbjct: 292 LTLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYN 351

Query: 344 ELYTYQIENNRWYAMSLRPQRKKKN-----FVQSKSNRNKDKELEDILNQILDKANLRDA 398
           +LY + +E N+W  + ++PQR   N       + KSN++++KEL+D+LN IL K+NL D 
Sbjct: 352 DLYMFHLELNKWSKLRIKPQRHTNNRNAPATSKRKSNKDQEKELQDLLNSILAKSNLNDE 411

Query: 399 EDDDESKVIEEQLNQLXXXXXXXXXXXXXXXXXXYETMSTLPHARFNAATAVVDDTLFIF 458
           EDD++                                 + LPH RFNAAT VVDD+LFI+
Sbjct: 412 EDDNDDSTATTTGANSSNDEGDDEDDSDFENQENITISNQLPHPRFNAATCVVDDSLFIY 471

Query: 459 GGTVEIGEKDYPIDSFYSIDMNKLDGVKVYWEELKEVERAEKLXXXXXXXXXXXXXXXXX 518
            G  E+GEKDYPI+SFYSID+NKLDGVKVYWE+L  VE A++L                 
Sbjct: 472 SGVWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSTVEEAKRLGDRDSDEEEFEYEDEDD 531

Query: 519 XXXXXXIVDSK---LXXXXXXXXXXXXXXXXXXXIPDLRPWLPHPKAFETLRAFYVRTGP 575
                         L                   IPD R WLPHPK FETLRAFY+R G 
Sbjct: 532 DEDDDEEEPQDTRLLEDDDDEESEEEDDGQAQMEIPDERSWLPHPKPFETLRAFYLREGA 591

Query: 576 TFLELAISSNRDSKGKHLKTKSFELCQDRWWERREQVRIEEDKLEELGGVEDVIEKD-TS 634
            FL  +IS+NR+ KGK LKTKSFELC+DRWWERR+QV +EE++LE+ GG   +IE+D T+
Sbjct: 592 NFLTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG---IIERDATA 648

Query: 635 KTQRRR 640
           K  +RR
Sbjct: 649 KPSKRR 654

>Skud_16.14 Chr16 complement(23637..25595) [1959 bp, 652 aa] {ON}
           YPL263C (REAL)
          Length = 652

 Score =  557 bits (1436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/607 (47%), Positives = 385/607 (63%), Gaps = 26/607 (4%)

Query: 51  LANFKREQENFEKINVENVDRPDQRINPCMFVNPAHGKRELMMFXXXXXXXXXXXXHFYN 110
           L++F ++Q   E +++  V+R   R +P MF NP H KREL +F            HFYN
Sbjct: 55  LSSFTKKQTELEHVDITAVERLSCRTHPLMFANPQHNKRELFIFGGEFTDPETKLTHFYN 114

Query: 111 DLFVYSLDTDTWKRYTSQNSPMPRSSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWL 170
           DL+ YS+  ++WK+Y S+N+P+PRSSAAVA HP+G+AL+HGGEFSSPKQ+ FYHYSD+WL
Sbjct: 115 DLYSYSIKNNSWKKYVSKNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWL 174

Query: 171 FDCSSKEWTKVE---QKNGPSARSGHRMAIWKNFIILHGGFRDLGTS-TTYLNDLWVFDI 226
           FDC+ +++TK+E   + + PSARSGHR+  WKN+ IL GGFRDLG   T+YLNDLW FDI
Sbjct: 175 FDCAERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDI 234

Query: 227 TNYKWKQVELPANHPIPDARSGHSLISTAEGAVLYGGYTKV--KAGKGLQKGKILSDCWY 284
           +NYKW ++E    +  P+ARSGH  I T   A+L GGY K+  K  K L KGKIL+D W 
Sbjct: 235 SNYKWTKLE---TNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWK 291

Query: 285 LKMKSDLGSIRWERRKKQGSQPSPRVGCSM-VHHKGRGVLFGGVYDFEETEESLRSIFYN 343
           L +  D    +WE+ K   +QPSPRVG S  +  + + V FGGVYD +ETEESL S+FYN
Sbjct: 292 LNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYN 351

Query: 344 ELYTYQIENNRWYAMSLRPQRKKKN-----FVQSKSNRNKDKELEDILNQILDKANLRDA 398
           +LY + +E N+W  + ++PQR+  N       + KSN++++KEL+D+LN IL K+NL D 
Sbjct: 352 DLYMFHLELNKWSKLRIKPQRQTNNKNAPLTSKRKSNKDQEKELQDLLNSILAKSNLNDD 411

Query: 399 EDDDESKVIEEQLNQLXXXXXXXXXXXXXXXXXXYETMSTLPHARFNAATAVVDDTLFIF 458
           +   +        N +                      + LPH RFNAAT VVDD+LFI+
Sbjct: 412 D---DDDNTTTGSNSIDGDDEGEDDDSDLDNPENITISNQLPHPRFNAATCVVDDSLFIY 468

Query: 459 GGTVEIGEKDYPIDSFYSIDMNKLDGVKVYWEELKEVERAEKLXXXXXXXXXXXXXXXXX 518
            G  E+GEKDYPI+SFYSID+NKLDGV VYWE+L  +E A++L                 
Sbjct: 469 SGVWELGEKDYPINSFYSIDLNKLDGVNVYWEDLSTIEEAKRLGDRDSDEDDFEYEDDDD 528

Query: 519 XXXXXXIVDSK----LXXXXXXXXXXXXXXXXXXXIPDLRPWLPHPKAFETLRAFYVRTG 574
                   + +    L                   IPD R WLPHPK FETLRAFY+R G
Sbjct: 529 DDGEDNDEEEQDVALLEGDEDEEGENEDNGQAQMEIPDERSWLPHPKPFETLRAFYLREG 588

Query: 575 PTFLELAISSNRDSKGKHLKTKSFELCQDRWWERREQVRIEEDKLEELGGVEDVIEKD-T 633
             FL  +IS+N+D KGKHLKTKSFE+C+DRWWERR+QV +EE++LE+ GG   +IE+D T
Sbjct: 589 ANFLTWSISNNKDLKGKHLKTKSFEICEDRWWERRDQVTLEEERLEDTGG---IIERDTT 645

Query: 634 SKTQRRR 640
           +K  +RR
Sbjct: 646 TKISKRR 652

>YPL263C Chr16 complement(44551..46506) [1956 bp, 651 aa] {ON}
           KEL3Cytoplasmic protein of unknown function
          Length = 651

 Score =  550 bits (1417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/606 (48%), Positives = 386/606 (63%), Gaps = 25/606 (4%)

Query: 51  LANFKREQENFEKINVENVDRPDQRINPCMFVNPAHGKRELMMFXXXXXXXXXXXXHFYN 110
           L++F ++Q   E +++ +V++P  R +P MF NP H K EL +F            HFYN
Sbjct: 55  LSSFSKKQIELEHVDITSVEKPSCRTHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYN 114

Query: 111 DLFVYSLDTDTWKRYTSQNSPMPRSSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWL 170
           DL+ YS+  ++WK+Y SQN+P+PRSSAAVA HP+G+AL+HGGEFSSPKQ+ FYHYSD+WL
Sbjct: 115 DLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWL 174

Query: 171 FDCSSKEWTKVE---QKNGPSARSGHRMAIWKNFIILHGGFRDLGTS-TTYLNDLWVFDI 226
           FDC  +++TK+E   + + PSARSGHR+  WKN+ IL GGFRDLG   T+YLNDLW FDI
Sbjct: 175 FDCVERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDI 234

Query: 227 TNYKWKQVELPANHPIPDARSGHSLISTAEGAVLYGGYTKV--KAGKGLQKGKILSDCWY 284
           + YKW ++E  +    PDARSGH  I T   A+L GGY K+  K  K L KGKIL+D W 
Sbjct: 235 STYKWTKLETNSK---PDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWK 291

Query: 285 LKMKSDLGSIRWERRKKQGSQPSPRVGCSM-VHHKGRGVLFGGVYDFEETEESLRSIFYN 343
           L +  D    +WE+ K   +QPSPRVG S  +  + + V FGGVYD +ETEESL S+FYN
Sbjct: 292 LNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYN 351

Query: 344 ELYTYQIENNRWYAMSLRPQRKKKN-----FVQSKSNRNKDKELEDILNQILDKANLRDA 398
           +LY + +E N+W  + ++PQR+  +       + KSN++++KEL+D+LN IL K+NL D 
Sbjct: 352 DLYMFHLELNKWSKLRIKPQRQTNSKNSPATSKRKSNKDQEKELQDLLNSILAKSNLNDD 411

Query: 399 EDDDESKVIEEQLNQLXXXXXXXXXXXXXXXXXXYETMST-LPHARFNAATAVVDDTLFI 457
           +DD++        N +                    T+S  LPH RFNAAT VV D+LFI
Sbjct: 412 DDDNDDNSTTGP-NSIDDDEDNEDDSDLDNQEDI--TISNQLPHPRFNAATCVVGDSLFI 468

Query: 458 FGGTVEIGEKDYPIDSFYSIDMNKLDGVKVYWEELKEVERAEKLXXXXXXXXXXXXXXXX 517
           + G  E+GEKDYPI+SFYSID+NKLDGVKVYWE+L  +E A++L                
Sbjct: 469 YSGVWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSAIEEAKRLGDRDSDEDEFEYEDDE 528

Query: 518 XXXXXXXIVDSK--LXXXXXXXXXXXXXXXXXXXIPDLRPWLPHPKAFETLRAFYVRTGP 575
                         L                   IPD R WLPHPK FETLRAFY+R G 
Sbjct: 529 EDEDDGEEEQDAGPLEGDEDEESESDDDKQAQMEIPDERSWLPHPKPFETLRAFYLREGA 588

Query: 576 TFLELAISSNRDSKGKHLKTKSFELCQDRWWERREQVRIEEDKLEELGGVEDVIEKD-TS 634
            FL  +IS+NR+ KGK LKTKSFELC+DRWWERR+QV +EE++LE+ GG   +IE+D T+
Sbjct: 589 NFLTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG---IIERDTTT 645

Query: 635 KTQRRR 640
           K  +RR
Sbjct: 646 KPSKRR 651

>Smik_6.471 Chr6 (774663..776618) [1956 bp, 651 aa] {ON} YPL263C
           (REAL)
          Length = 651

 Score =  548 bits (1411), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/606 (48%), Positives = 383/606 (63%), Gaps = 25/606 (4%)

Query: 51  LANFKREQENFEKINVENVDRPDQRINPCMFVNPAHGKRELMMFXXXXXXXXXXXXHFYN 110
           L++F ++Q   E +++  V+RP  R +P MF NP H K EL +F            HFYN
Sbjct: 55  LSSFTKKQTELEHVDITAVERPSCRTHPLMFANPQHNKHELFIFGGEFTDSETKLTHFYN 114

Query: 111 DLFVYSLDTDTWKRYTSQNSPMPRSSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWL 170
           DL+ YS+  ++WK+Y SQN+P+PRSSAAVA HP+G+AL+HGGEFSSPKQ+ FYHYSD+WL
Sbjct: 115 DLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWL 174

Query: 171 FDCSSKEWTKVE---QKNGPSARSGHRMAIWKNFIILHGGFRDLGTS-TTYLNDLWVFDI 226
           FDC  +++ K+E   + + PSARSGHR+  WKN+ IL GGFRDLG   T+YLNDLW FDI
Sbjct: 175 FDCVERKFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDI 234

Query: 227 TNYKWKQVELPANHPIPDARSGHSLISTAEGAVLYGGYTK--VKAGKGLQKGKILSDCWY 284
           +NYKW ++E  +    PDARSGH  I T   A+L GGY K   K  K L KGKIL+D W 
Sbjct: 235 SNYKWSKIETNSK---PDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWK 291

Query: 285 LKMKSDLGSIRWERRKKQGSQPSPRVGCSM-VHHKGRGVLFGGVYDFEETEESLRSIFYN 343
           L +  D    +WE+ K   +QPSPRVG S  +  + + V FGGVYD +ETEESL S+FYN
Sbjct: 292 LNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYN 351

Query: 344 ELYTYQIENNRWYAMSLRPQRKKKN-----FVQSKSNRNKDKELEDILNQILDKANLRDA 398
           +LY + +E N+W  + ++ QR+  N       + KSN++++KEL+D+LN IL K+NL D 
Sbjct: 352 DLYMFHLELNKWSKLRIKSQRQTSNRNSPATSKRKSNKDQEKELQDLLNSILAKSNLNDD 411

Query: 399 EDDDESKVIEEQLNQLXXXXXXXXXXXXXXXXXXYETMST-LPHARFNAATAVVDDTLFI 457
           +D+++        N +                    T+S  LPH RFNAAT VV D+LFI
Sbjct: 412 DDENDDYTATGS-NSIDGDEDEEDDSDLDNQEDI--TISNQLPHPRFNAATCVVGDSLFI 468

Query: 458 FGGTVEIGEKDYPIDSFYSIDMNKLDGVKVYWEELKEVERAEKLXXXXXXXXXXXXXXXX 517
           + G  E+GEKDYPI+SFYSID+NKLDGVKVYWEEL  +E A++L                
Sbjct: 469 YSGVWELGEKDYPINSFYSIDLNKLDGVKVYWEELSAIEEAKRLGDRDSDEEEFEYEDEE 528

Query: 518 XXXXXXXIVDSK--LXXXXXXXXXXXXXXXXXXXIPDLRPWLPHPKAFETLRAFYVRTGP 575
                         L                   IPD R WLPHPK FETLRAFY+R G 
Sbjct: 529 DDEDQSEEEQDAGLLESDEDEESDDEDDGQAQMEIPDERSWLPHPKPFETLRAFYLREGA 588

Query: 576 TFLELAISSNRDSKGKHLKTKSFELCQDRWWERREQVRIEEDKLEELGGVEDVIEKD-TS 634
            FL  +IS+NR+ KGK LKTKSFELC+DRWWERR+QV +EE++LE+ GG   +IE+D T+
Sbjct: 589 NFLTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG---IIERDVTT 645

Query: 635 KTQRRR 640
           K  +RR
Sbjct: 646 KPSKRR 651

>Kpol_1050.69 s1050 complement(150301..153555) [3255 bp, 1084 aa]
           {ON} complement(150301..153555) [3255 nt, 1085 aa]
          Length = 1084

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 65/255 (25%), Positives = 102/255 (40%), Gaps = 54/255 (21%)

Query: 122 WKRYTSQNSPMPR---SSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWLFDCSSKEW 178
           W R   QNSP PR    S+A A+    + ++ G    S        Y D+W+  C+  + 
Sbjct: 139 WNRIKLQNSPFPRYRHVSSAYATASNNIYILGGLHDQS-------VYGDTWIISCNP-DA 190

Query: 179 TKVEQK------NGPSARSGHRMAIWKN-FIILHGGFRDLGTSTTYLNDLWVFDITNYKW 231
           T+   K      N P  R GH   +  N FI+  G    +       +D+++F+I +YKW
Sbjct: 191 TQFSSKSVDIGENTPPPRVGHAATLCGNAFIVFGGDTHKVNKEGLMDDDIYLFNINSYKW 250

Query: 232 KQVELPANHPIPDARSGHSLISTAEGAV-----LYGGYTKVKAGKGLQKGKILSDCWYLK 286
             +  P   P P  R GH +   A   V     L+GG                 D ++  
Sbjct: 251 -TIPNPIG-PRPLGRYGHKICILATSTVKTKLYLFGGQ--------------FDDTYFND 294

Query: 287 MKS-DLGSIR-----WERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRSI 340
           +   DL S R     WE  K +G  P P    +MV +     ++GG     +T++ L   
Sbjct: 295 LAVFDLSSFRRQDSHWEFIKSKGFMPPPLTNHTMVTYGSDLWIYGG-----DTQQGL--- 346

Query: 341 FYNELYTYQIENNRW 355
             N+++ +    N W
Sbjct: 347 -INDIFKFSPNTNTW 360

 Score = 39.7 bits (91), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 70/159 (44%), Gaps = 34/159 (21%)

Query: 108 FYNDLFVYSLDT-----DTWKRYTSQN-SPMPRSSAAVASHPTGVAL-IHGGEFSSPKQN 160
           ++NDL V+ L +       W+   S+   P P ++  + ++  G  L I+GG+      N
Sbjct: 291 YFNDLAVFDLSSFRRQDSHWEFIKSKGFMPPPLTNHTMVTY--GSDLWIYGGDTQQGLIN 348

Query: 161 TFYHYSDSWLFDCSSKEWTKVEQKNG-PSARSGHRMAIWKNFIILHGGFRDLGTSTTYLN 219
             + +S       ++  WTKVE     P     H   ++KN + + GG  +   +  YLN
Sbjct: 349 DIFKFS------PNTNTWTKVETTGTKPPPMQEHAAVVYKNIMCVVGGKDE---NDMYLN 399

Query: 220 DLWVFDITNYKWKQVELPANHPIPD-------ARSGHSL 251
            +++F+  + KW        +  PD        RSGHS+
Sbjct: 400 SVYLFNFDSSKW--------YTFPDFKSGIIQGRSGHSV 430

 Score = 35.0 bits (79), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 56/124 (45%), Gaps = 13/124 (10%)

Query: 108 FYNDLFVYSLDTDTWKRY-TSQNSPMPRSSAAVASHPTGVALIHGGEFSSPKQNTFYHYS 166
             ND+F +S +T+TW +  T+   P P    A   +   + ++ G +     +N  Y  S
Sbjct: 346 LINDIFKFSPNTNTWTKVETTGTKPPPMQEHAAVVYKNIMCVVGGKD-----ENDMYLNS 400

Query: 167 DSWLFDCSSKEW-TKVEQKNG-PSARSGHRMAIWKN--FIILHGGFRDLGTSTTYLNDLW 222
             +LF+  S +W T  + K+G    RSGH + +  N   +I+ G   D      Y  DL 
Sbjct: 401 -VYLFNFDSSKWYTFPDFKSGIIQGRSGHSVTLLNNDKLLIMGGDKYDFARPGDY--DLH 457

Query: 223 VFDI 226
             +I
Sbjct: 458 TSEI 461

 Score = 31.6 bits (70), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 49/129 (37%), Gaps = 25/129 (19%)

Query: 149 IHGGEFSSPKQNTFYHYSDSWLFDCSS-----KEWTKVEQKN-GPSARSGHRMAIWKNFI 202
           + GG+F         +++D  +FD SS       W  ++ K   P   + H M  + + +
Sbjct: 282 LFGGQFDD------TYFNDLAVFDLSSFRRQDSHWEFIKSKGFMPPPLTNHTMVTYGSDL 335

Query: 203 ILHGGFRDLGTSTTYLNDLWVFDITNYKWKQVELPANHPIPDARSGHSLISTAEGAVLYG 262
            ++GG     T    +ND++ F      W +VE     P P              AV+Y 
Sbjct: 336 WIYGG----DTQQGLINDIFKFSPNTNTWTKVETTGTKPPP---------MQEHAAVVYK 382

Query: 263 GYTKVKAGK 271
               V  GK
Sbjct: 383 NIMCVVGGK 391

>CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa]
           {ON} some similarities with uniprot|P38853 Saccharomyces
           cerevisiae YHR158c KEL1 involved in cell fusion and
           morphology
          Length = 1136

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 66/260 (25%), Positives = 101/260 (38%), Gaps = 52/260 (20%)

Query: 118 DTDTWKRYTSQNSPMPRSSAAVASHPT--GVALIHGGEFSSPKQNTFYHYSDSWLFDCS- 174
           D   W R    NSP PR     +SH T  G   + GG            Y D+W+   S 
Sbjct: 143 DYTPWGRIRLSNSPFPRYRHVSSSHITDQGKIYVIGGLHDQSV------YGDTWILTASD 196

Query: 175 --------SKEWTKVE-QKNGPSARSGHRMAIWKN-FIILHGGFRDLGTSTTYLNDLWVF 224
                   S + T +E  ++ P  R GH   +  N F++  G    + +     +DL++ 
Sbjct: 197 IDKTGAINSFKSTTIEITESTPPPRVGHASTLCGNAFVVFGGDTHKVNSDGLMDDDLYLL 256

Query: 225 DITNYKWKQVELPANHPIPDARSGHSLIS-TAEGAVLY--GGYTKVKAGKGLQKGKILSD 281
           +I +YKW   +     P+   R GH +++ +AE   LY  GG                 D
Sbjct: 257 NINSYKWTIPKPVGQRPL--GRYGHKIVTISAEQTKLYLFGGQ--------------FDD 300

Query: 282 CWYLKMKS-DLGSIR-----WERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEE 335
            ++  +   DL S R     W   K  G  P P    +MV ++ +  +FGG        +
Sbjct: 301 TYFGDLAVFDLSSFRRPDSHWVFLKPSGFNPPPLTNHTMVTYQDKIWVFGG--------D 352

Query: 336 SLRSIFYNELYTYQIENNRW 355
           +L     N +Y Y   NN W
Sbjct: 353 TLEEGLINRVYLYSPTNNSW 372

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 43/198 (21%), Positives = 80/198 (40%), Gaps = 32/198 (16%)

Query: 149 IHGGEFSSPKQNTFYHYSDSWLFDCSS-----KEWTKVEQKN-GPSARSGHRMAIWKNFI 202
           + GG+F         ++ D  +FD SS       W  ++     P   + H M  +++ I
Sbjct: 293 LFGGQFDD------TYFGDLAVFDLSSFRRPDSHWVFLKPSGFNPPPLTNHTMVTYQDKI 346

Query: 203 ILHGGFRDLGTSTTYLNDLWVFDITNYKWKQVELPANHPIPDARSGHSLISTAEGAVLYG 262
            + GG          +N ++++  TN  W+ VE   + P P              A++Y 
Sbjct: 347 WVFGGDT---LEEGLINRVYLYSPTNNSWEIVETTGDIPPP---------MQEHAAIVYK 394

Query: 263 GYTKVKAGKGLQKGKILSDCWYLKMKSDLGSIRWERRK-KQGSQPSPRVGCSMVHHKGRG 321
               V  GK  +    L+  ++L    +L S++W +    + + P  R G S+   K   
Sbjct: 395 DLMCVVGGKDAEDN-YLNTLYFL----NLQSLKWFKLPFYKNNIPQGRSGHSVTLLKNDQ 449

Query: 322 VLF--GGVYDFEETEESL 337
           +L   G  YD+  + E++
Sbjct: 450 ILIMGGDKYDYSSSTENM 467

>KAFR0B04320 Chr2 complement(893930..896890) [2961 bp, 986 aa] {ON}
           Anc_5.88 YGR238C
          Length = 986

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 61/229 (26%), Positives = 90/229 (39%), Gaps = 43/229 (18%)

Query: 118 DTDTWKRYTSQNSPMPR---SSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWLFDCS 174
           D   W R    NSP PR    ++A A+    + +I G    S        Y D+W+    
Sbjct: 130 DQTVWNRIKLANSPFPRYRHVASAYATEDDKIYVIGGLHDQSV-------YGDTWILTSE 182

Query: 175 SKEWTKVEQK-----NGPSARSGHRMAIWKN-FIILHGGFRDLGTSTTYLNDLWVFDITN 228
           +     + Q      N P  R GH   +  N FII  G    +       +DL++F+I +
Sbjct: 183 NNASRFISQTVDISDNTPPPRVGHAATLCGNAFIIFGGDTHKVNKDGLMDDDLYLFNINS 242

Query: 229 YKWKQVELPANHPIPDARSGH--SLISTAEGAV---LYGGYTKVKAGKGLQKGKILSDCW 283
           +KW  +  P   P P  R GH  S+I+TA       L+GG                 D +
Sbjct: 243 HKWT-IPNPVG-PRPLGRYGHKISIIATANSKTRLYLFGGQ--------------FDDAY 286

Query: 284 YLKMKS-DLGSI-----RWERRKKQGSQPSPRVGCSMVHHKGRGVLFGG 326
           +  +   DL S      RWE  K +   P P    +MV +  +  +FGG
Sbjct: 287 FNDLVVFDLSSFRRPDSRWEFVKPKSFVPPPLTNHTMVSYDNKLWVFGG 335

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 72/166 (43%), Gaps = 14/166 (8%)

Query: 108 FYNDLFVYSLDT----DTWKRYTSQNS--PMPRSSAAVASHPTGVALIHGGEFSSPKQNT 161
           ++NDL V+ L +    D+   +    S  P P ++  + S+   +  + GG+      N 
Sbjct: 286 YFNDLVVFDLSSFRRPDSRWEFVKPKSFVPPPLTNHTMVSYDNKL-WVFGGDTLQGLTNR 344

Query: 162 FYHYSDSWLFDCSSKEWTKVEQKNGPSARSGHRMAIWKNFIILHGGFRDLGTSTTYLNDL 221
            + Y D  + D ++ E +     N       H   ++K+ + + GG  +     TYLN +
Sbjct: 345 VFMY-DPMINDWTTIETSSDNPNNIAPPMQEHAAIVYKDLMCIFGGKDE---QDTYLNGV 400

Query: 222 WVFDITNYKWKQVELPANHP-IPDARSGHSLISTAEGAVLYGGYTK 266
           +  ++   KW   +LP   P IP  RSGHS+       +L  G  K
Sbjct: 401 YFLNLRTLKW--YKLPIFAPGIPQGRSGHSITLLKNDKLLIMGGDK 444

 Score = 37.4 bits (85), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 28/125 (22%), Positives = 52/125 (41%), Gaps = 13/125 (10%)

Query: 231 WKQVELPANHPIPDARSGHSLISTAEGAVLYGGYTKVKAGKGLQKGKILSDCWYLKMKSD 290
           W +++L AN P P  R   S  +T +  +   G        GL    +  D W L  +++
Sbjct: 134 WNRIKL-ANSPFPRYRHVASAYATEDDKIYVIG--------GLHDQSVYGDTWILTSENN 184

Query: 291 LGSIRWERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRSIFYNELYTYQI 350
                 +      + P PRVG +        ++FGG  D  +  +    +  ++LY + I
Sbjct: 185 ASRFISQTVDISDNTPPPRVGHAATLCGNAFIIFGG--DTHKVNKD--GLMDDDLYLFNI 240

Query: 351 ENNRW 355
            +++W
Sbjct: 241 NSHKW 245

>ZYRO0B08228g Chr2 (641988..645869) [3882 bp, 1293 aa] {ON} similar
           to uniprot|Q75AR9 Ashbya gossypii ADL149W ADL149Wp and
           some similarites with YHR158C uniprot|P38853
           Saccharomyces cerevisiae YHR158C KEL1 Protein required
           for proper cell fusion and cell morphology functions in
           a complex with Kel2p to negatively regulate mitotic exit
           interacts with Tem1p and Lte1p localizes to regions of
           polarized growth potential Cdc28p substrate
          Length = 1293

 Score = 57.4 bits (137), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 63/258 (24%), Positives = 103/258 (39%), Gaps = 60/258 (23%)

Query: 122 WKRYTSQNSPMPR---SSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWLFDCSSKEW 178
           W R   QNSP PR    +++  S    + +I G    S        Y D+W+   ++   
Sbjct: 141 WNRVKLQNSPFPRYRHVASSNCSEDNSLYVIGGLHDQS-------VYGDTWII-STNDNG 192

Query: 179 TKVEQKN------GPSARSGHRMAIWKNFIILHGG-FRDLGTSTTYLNDLWVFDITNYKW 231
           T+ + K        P  R GH   +  N  +L GG    + +     +DL++F++ +YKW
Sbjct: 193 TQFQSKTVEISETTPPPRVGHAATLCGNAFVLFGGDTHKVNSEGLMDDDLYLFNVNSYKW 252

Query: 232 KQVELPANHPI---PDARSGHSLISTAEGAV-----LYGGYTKVKAGKGLQKGKILSDCW 283
               +P  HPI   P  R GH +   A   +     L+GG                 D +
Sbjct: 253 T---IP--HPIGPRPLGRYGHKISIMAANQMKTKLYLFGGQ--------------FDDTY 293

Query: 284 YLKMKS-DLGSIR-----WERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESL 337
           +  +   DL S R     WE  K     P P    +M+ +     +FGG        ++L
Sbjct: 294 FNDLAVFDLSSFRRPDSHWEFLKPTTFSPPPLTNHTMISYDNHLWVFGG--------DTL 345

Query: 338 RSIFYNELYTYQIENNRW 355
           + +  N+++ Y + NN W
Sbjct: 346 QGLI-NQVFKYDVANNDW 362

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 51/195 (26%), Positives = 88/195 (45%), Gaps = 35/195 (17%)

Query: 167 DSWLFDCSSKEWTKVEQKNGPS--ARSGHRMAIW-----KNFIILHGGFRDLGTSTTYLN 219
           D +LF+ +S +WT +    GP    R GH+++I      K  + L GG  D     TY N
Sbjct: 241 DLYLFNVNSYKWT-IPHPIGPRPLGRYGHKISIMAANQMKTKLYLFGGQFD----DTYFN 295

Query: 220 DLWVFDITNYK-----WKQVELPANHPIPDARSGHSLISTAEGAVLYGGYTKVKAGKGLQ 274
           DL VFD+++++     W+ ++     P P   + H++IS      ++GG T         
Sbjct: 296 DLAVFDLSSFRRPDSHWEFLKPTTFSPPP--LTNHTMISYDNHLWVFGGDT--------- 344

Query: 275 KGKILSDCWYLKMKSDLGSIRWERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETE 334
               L        K D+ +  W   +  G++P P    + V +K   V+ GG    +E +
Sbjct: 345 ----LQGLINQVFKYDVANNDWSIAETTGTKPPPMQEHAAVVYKHVMVVVGGK---DEHD 397

Query: 335 ESLRSIFYNELYTYQ 349
             L S+++  L T++
Sbjct: 398 TYLNSVYFLNLKTHE 412

>Suva_15.357 Chr15 complement(617637..618952,619001..621203) [3519
           bp, 1172 aa] {ON} YHR158C (REAL)
          Length = 1172

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 61/257 (23%), Positives = 107/257 (41%), Gaps = 52/257 (20%)

Query: 122 WKRYTSQNSPMPR---SSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWL---FDCSS 175
           W R   QNSP PR    ++A A+    + +I G    S        Y D+W+   FD ++
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYATDKNQIYVIGGLHDQSV-------YGDTWILSAFDDAT 165

Query: 176 K-EWTKVE-QKNGPSARSGHRMAIWKN-FIILHGGFRDLGTSTTYLNDLWVFDITNYKWK 232
           K   T ++  +  P  R GH   +  N F++  G    +       +D+++ ++ +YKW 
Sbjct: 166 KFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNREGLMDDDIYLLNVNSYKWT 225

Query: 233 QVELPANHPIPDARSGH--SLISTAEGAV---LYGGYTKVKAGKGLQKGKILSDCWYLKM 287
            V  P   P P  R GH  S+I+T +      ++GG                 D ++  +
Sbjct: 226 -VPAPVG-PRPLGRYGHKISIIATTQMKTKLYVFGGQ--------------FDDTYFNDL 269

Query: 288 KS-DLGSIR-----WERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRSIF 341
              DL S R     W+  K     P P    +M+ +  +  +FGG        ++L+ + 
Sbjct: 270 AVYDLSSFRRPDSHWDFLKPMTFTPPPMTNFTMISYDSKLWVFGG--------DTLQGLI 321

Query: 342 YNELYTYQIENNRWYAM 358
            N+++ Y    N W+ +
Sbjct: 322 -NDVFMYDPAKNDWFTI 337

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 70/165 (42%), Gaps = 22/165 (13%)

Query: 108 FYNDLFVYSLDT--------DTWKRYTSQNSPMPRSSAAVASHPTGVALIHGGEFSSPKQ 159
           ++NDL VY L +        D  K  T   +P P ++  + S+ + + +  G        
Sbjct: 265 YFNDLAVYDLSSFRRPDSHWDFLKPMTF--TPPPMTNFTMISYDSKLWVFGGDTLQG--- 319

Query: 160 NTFYHYSDSWLFDCSSKEWTKVEQKN-GPSARSGHRMAIWKNFIILHGGFRDLGTSTTYL 218
                 +D +++D +  +W  +E     P     H   ++ + + + GG  +      YL
Sbjct: 320 ----LINDVFMYDPAKNDWFTIETSGEKPPPVQEHATVVYNDLMCVVGGKDE---HDAYL 372

Query: 219 NDLWVFDITNYKWKQVELPANHPIPDARSGHSLISTAEGAVLYGG 263
           N ++  ++  +KW ++ + A   IP  RSGHSL       VL  G
Sbjct: 373 NTVYFLNLKTHKWFKLPIFAAG-IPQGRSGHSLTLLKNDKVLIMG 416

>NCAS0F00520 Chr6 (100048..103308) [3261 bp, 1086 aa] {ON} Anc_5.88
           YGR238C
          Length = 1086

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 66/256 (25%), Positives = 99/256 (38%), Gaps = 48/256 (18%)

Query: 122 WKRYTSQNSPMPR---SSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWLFDCSSKEW 178
           W R   QNSP PR    +++V S    V +I G    S        Y D+W+  C   + 
Sbjct: 131 WNRIKLQNSPFPRYRHVASSVISDTNQVYVIGGLHDQS-------VYGDTWVLTCEDPQT 183

Query: 179 TKV-------EQKNGPSARSGHRMAIWKN-FIILHGGFRDLGTSTTYLNDLWVFDITNYK 230
           + +         +  P  R GH   +  N F+I  G            +D+++F+I +YK
Sbjct: 184 STMFSSRTVDITETTPPPRVGHASTLCGNAFVIFGGDTHKKNEMGEMDDDIYLFNINSYK 243

Query: 231 WKQVELPANHPI---PDARSGHSLISTAEGAVLYGGYTKVKAGKGLQKGKILSDCWYLKM 287
           W    +P  HPI   P  R GH +   A   +     TK+    G       +D      
Sbjct: 244 WT---IP--HPIGPRPKGRYGHKISIIARKQM----QTKLYLFGGQFDDNYFNDLVVF-- 292

Query: 288 KSDLGSIR-----WERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRSIFY 342
             DL S R     WE  K +   P P    +MV +  +  +FGG     +T E L     
Sbjct: 293 --DLSSFRRDDSHWEFIKPRSFIPPPITNHTMVSYDFKLWVFGG-----DTLEGL----L 341

Query: 343 NELYTYQIENNRWYAM 358
           N+++ Y    N W  +
Sbjct: 342 NQVFMYDPAVNDWCVV 357

 Score = 39.7 bits (91), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 45/103 (43%), Gaps = 13/103 (12%)

Query: 169 WLFDCSSKEWTKVEQ-------KNGPSARSGHRMAIWKNFIILHGGFRDLGTSTTYLNDL 221
           +++D +  +W  VE        +N P     H   I+K  + + GG  +      YLND+
Sbjct: 345 FMYDPAVNDWCVVETTCQDDDLENMPPPMQEHATLIYKGLMCIVGGKDE---QDHYLNDV 401

Query: 222 WVFDITNYKWKQVELPA-NHPIPDARSGHSLISTAEGAVLYGG 263
           +  ++ + KW    LP     IP  RSGHS+       +L  G
Sbjct: 402 YFLNLKSLKW--FRLPRFMDGIPQGRSGHSVTLLKNDKLLIMG 442

>SAKL0H02618g Chr8 (259684..262941) [3258 bp, 1085 aa] {ON} similar
           to uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 1085

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 70/258 (27%), Positives = 104/258 (40%), Gaps = 54/258 (20%)

Query: 122 WKRYTSQNSPMPR---SSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWLFDCSSKEW 178
           W R    +SP PR    ++A AS    V +I G    S        Y D+W+    +   
Sbjct: 73  WNRIKLGSSPFPRYRHVASAYASEQNQVFVIGGLHDQS-------VYGDTWILTAHANN- 124

Query: 179 TKVEQKN------GPSARSGHRMAIWKN-FIILHGGFRDLGTSTTYLNDLWVFDITNYKW 231
           T+   K        P  R GH   +  N F+I  G    +       +D+++F+I +YKW
Sbjct: 125 TRFTSKTVDISDTTPPPRVGHASTLCGNAFVIFGGDTHKVNNEGLMDDDVYLFNINSYKW 184

Query: 232 KQVELPANHPI---PDARSGH--SLISTAEGAVLYGGYTKVKAGKGLQKGKILSD-CWYL 285
               +P  HP+   P  R GH  S+I+T++        TK+    G       +D C Y 
Sbjct: 185 T---IP--HPVGPRPLGRYGHKISVIATSQMK------TKLYVFGGQFDDTYFNDLCVY- 232

Query: 286 KMKSDLGSIR-----WERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRSI 340
               DL S R     WE  K Q   P P    +MV +  +  +FGG     +T + L   
Sbjct: 233 ----DLSSFRRPDSHWEFLKPQSFVPPPLTNHTMVSYDYKLWIFGG-----DTAQGL--- 280

Query: 341 FYNELYTYQIENNRWYAM 358
             NE++ Y    N W  +
Sbjct: 281 -INEVFMYDPTVNDWTVV 297

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 70/149 (46%), Gaps = 18/149 (12%)

Query: 108 FYNDLFVYSLDT-----DTWKRYTSQN-SPMPRSSAAVASHPTGVALIHGGEFSSPKQNT 161
           ++NDL VY L +       W+    Q+  P P ++  + S+   +  I GG+ +    N 
Sbjct: 225 YFNDLCVYDLSSFRRPDSHWEFLKPQSFVPPPLTNHTMVSYDYKL-WIFGGDTAQGLINE 283

Query: 162 FYHYSDSWLFDCSSKEWTKVEQKNG-PSARSGHRMAIWKNFIILHGGFRDLGTSTTYLND 220
            +      ++D +  +WT VE     P A   H   ++K+ + + GG  +     +Y ND
Sbjct: 284 VF------MYDPTVNDWTVVETTGSKPPAIQEHAAVVYKDLMCVTGGKDE---QDSYSND 334

Query: 221 LWVFDITNYKWKQVELPANHPIPDARSGH 249
           ++  ++ ++KW ++    N  +P  RSGH
Sbjct: 335 VYFLNLKSFKWFKLPFFKNG-VPQGRSGH 362

>YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON}
           KEL1Protein required for proper cell fusion and cell
           morphology; functions in a complex with Kel2p to
           negatively regulate mitotic exit, interacts with Tem1p
           and Lte1p; localizes to regions of polarized growth;
           potential Cdc28p substrate
          Length = 1164

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 61/257 (23%), Positives = 107/257 (41%), Gaps = 52/257 (20%)

Query: 122 WKRYTSQNSPMPR---SSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWL---FDCSS 175
           W R   QNSP PR    ++A  +    + +I G    S        Y D+W+   FD ++
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYVTDKNQIYVIGGLHDQSV-------YGDTWILTAFDNAT 165

Query: 176 K-EWTKVE-QKNGPSARSGHRMAIWKN-FIILHGGFRDLGTSTTYLNDLWVFDITNYKWK 232
           +   T ++  +  P  R GH   +  N F++  G    +       +D+++ +I +YKW 
Sbjct: 166 RFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMDDDIYLLNINSYKWT 225

Query: 233 QVELPANHPIPDARSGH--SLISTAEGAV---LYGGYTKVKAGKGLQKGKILSDCWYLKM 287
            V  P   P P  R GH  S+I+T +      ++GG                 D ++  +
Sbjct: 226 -VPAPVG-PRPLGRYGHKISIIATTQMKTKLYVFGGQ--------------FDDTYFNDL 269

Query: 288 KS-DLGSIR-----WERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRSIF 341
              DL S R     WE  K +   P P    +M+ +  +  +FGG        ++L+ + 
Sbjct: 270 AVYDLSSFRRPDSHWEFLKPRTFTPPPITNFTMISYDSKLWVFGG--------DTLQGLV 321

Query: 342 YNELYTYQIENNRWYAM 358
            N+++ Y    N W+ +
Sbjct: 322 -NDVFMYDPAINDWFII 337

 Score = 37.7 bits (86), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 36/167 (21%), Positives = 70/167 (41%), Gaps = 20/167 (11%)

Query: 108 FYNDLFVYSLDT-----DTWKRYTSQN-SPMPRSSAAVASHPTGVALIHGGEFSSPKQNT 161
           ++NDL VY L +       W+    +  +P P ++  + S+ + + +  G          
Sbjct: 265 YFNDLAVYDLSSFRRPDSHWEFLKPRTFTPPPITNFTMISYDSKLWVFGGDTLQG----- 319

Query: 162 FYHYSDSWLFDCSSKEWTKVEQKN-GPSARSGHRMAIWKNFIILHGGFRDLGTSTTYLND 220
               +D +++D +  +W  ++     P     H   ++ + + + GG  +      YLN 
Sbjct: 320 --LVNDVFMYDPAINDWFIIDTTGEKPPPVQEHATVVYNDLMCVVGGKDE---HDAYLNS 374

Query: 221 LWVFDITNYKWKQVELPA-NHPIPDARSGHSLISTAEGAVLYGGYTK 266
           ++  ++ + KW   +LP     IP  RSGHSL       +L  G  K
Sbjct: 375 VYFLNLKSRKW--FKLPVFTAGIPQGRSGHSLTLLKNDKILIMGGDK 419

>Kpol_1010.62 s1010 complement(151895..154816) [2922 bp, 973 aa]
           {ON} complement(151895..154816) [2922 nt, 974 aa]
          Length = 973

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 65/257 (25%), Positives = 101/257 (39%), Gaps = 53/257 (20%)

Query: 122 WKRYTSQNSPMPRSSAAVASHPT--GVALIHGGEFSSPKQNTFY------HYSDSWLFDC 173
           W R+    SP PR     +SH +      I GG     ++ + Y      ++ D   F  
Sbjct: 37  WNRFKLNPSPFPRYRHVASSHASKDDTLFIIGGL----REQSVYGDVWSINHKDDKSFSA 92

Query: 174 SSKEWTKVEQKNGPSARSGHRMAIWKNFIILHGG-FRDLGTSTTYLNDLWVFDITNYKWK 232
           SS E T       P  R GH   I  N +IL GG    +       +DL++F++ +YKW 
Sbjct: 93  SSIEITPTT----PPPRVGHASTICGNALILFGGDTHKVNEDGLMDDDLYLFNLNSYKWT 148

Query: 233 QVELPANHPIPDARSGH--SLISTAEGAV---LYGGYTKVKAGKGLQKGKILSDCWYLKM 287
             E     P+   R GH  S+I+T        L+GG                 D ++  +
Sbjct: 149 IPEPIGLRPL--GRYGHKISIIATQPTKTKLFLFGGQ--------------FDDTYFNDL 192

Query: 288 KS-DLGSIR-----WERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRSIF 341
              DL + R     WE  K +   P P    +M+ +  +  +FGG        E+L+ + 
Sbjct: 193 SMFDLSTFRKPDAQWEFIKPKSFFPPPVSNHTMISYDNKLWVFGG--------ETLQGLI 244

Query: 342 YNELYTYQIENNRWYAM 358
            NE++ Y    N W  +
Sbjct: 245 -NEVFVYDPIVNDWSVI 260

 Score = 39.3 bits (90), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 71/167 (42%), Gaps = 31/167 (18%)

Query: 137 AAVASHPTGVAL-IHGGEFSSPKQNTFYHYSDSWLFDCSS-----KEWTKVEQKNG-PSA 189
           + +A+ PT   L + GG+F         +++D  +FD S+      +W  ++ K+  P  
Sbjct: 166 SIIATQPTKTKLFLFGGQFDD------TYFNDLSMFDLSTFRKPDAQWEFIKPKSFFPPP 219

Query: 190 RSGHRMAIWKNFIILHGGFRDLGTSTTYLNDLWVFDITNYKWKQVELPANHPIPDARSGH 249
            S H M  + N + + GG     T    +N+++V+D     W  +E   + P P      
Sbjct: 220 VSNHTMISYDNKLWVFGG----ETLQGLINEVFVYDPIVNDWSVIETTGSSPPPIQE--- 272

Query: 250 SLISTAEGAVLYGGYTKVKAGKGLQKGKILSDCWYLKMKSDLGSIRW 296
                   AV+Y     V  GK   K   ++  ++L    +L +++W
Sbjct: 273 ------HAAVVYKNLMCVVGGKD-SKDNYMNSVYFL----NLNTLKW 308

>Skud_8.222 Chr8 complement(385114..388623) [3510 bp, 1169 aa] {ON}
           YHR158C (REAL)
          Length = 1169

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 61/257 (23%), Positives = 106/257 (41%), Gaps = 52/257 (20%)

Query: 122 WKRYTSQNSPMPR---SSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWL---FDCSS 175
           W R   QNSP PR    ++A  +    + +I G    S        Y D+W+    D ++
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYVTDKNQIYVIGGLHDQSV-------YGDTWILTALDNAT 165

Query: 176 K-EWTKVE-QKNGPSARSGHRMAIWKN-FIILHGGFRDLGTSTTYLNDLWVFDITNYKWK 232
           K   T ++  +  P  R GH   +  N F++  G    +       +D+++ +I +YKW 
Sbjct: 166 KFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMDDDIYLLNINSYKW- 224

Query: 233 QVELPANHPIPDARSGH--SLISTAEGAV---LYGGYTKVKAGKGLQKGKILSDCWYLKM 287
            V  P   P P  R GH  S+I+T +      ++GG                 D ++  +
Sbjct: 225 TVPAPVG-PRPLGRYGHKISIIATTQMKTKLYVFGGQ--------------FDDTYFNDL 269

Query: 288 KS-DLGSIR-----WERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRSIF 341
              DL S R     WE  K +   P P    +M+ +  +  +FGG        ++L+ + 
Sbjct: 270 AVYDLSSFRRPDSHWEFLKPKAFTPPPITNFTMISYDSKLWVFGG--------DTLQGLI 321

Query: 342 YNELYTYQIENNRWYAM 358
            N+++ Y    N W+ +
Sbjct: 322 -NDVFMYDPAINDWFII 337

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 43/193 (22%), Positives = 83/193 (43%), Gaps = 35/193 (18%)

Query: 108 FYNDLFVYSLDTDTWKRYTSQ--------NSPMPRSSAAVASHPTGVALIHGGEFSSPKQ 159
           ++NDL VY  D  +++R  S          +P P ++  + S+ + + +  G        
Sbjct: 265 YFNDLAVY--DLSSFRRPDSHWEFLKPKAFTPPPITNFTMISYDSKLWVFGGDTLQG--- 319

Query: 160 NTFYHYSDSWLFDCSSKEWTKVEQKN-GPSARSGHRMAIWKNFIILHGGFRDLGTSTTYL 218
                 +D +++D +  +W  +E     P     H   ++ + + + GG  +      YL
Sbjct: 320 ----LINDVFMYDPAINDWFIIETTGEKPPPVQEHASVVYNDLMCVVGGKDE---HDAYL 372

Query: 219 NDLWVFDITNYKWKQVELPA-NHPIPDARSGHSLISTAEGAVLYGG-----YTKVK---- 268
           N ++  ++ ++KW   +LP     IP  RSGHSL    +  +L  G     Y +V+    
Sbjct: 373 NSVYFLNLKSHKW--FKLPVFTAGIPQGRSGHSLTLLKDDKILIMGGDKFDYARVEEFDL 430

Query: 269 --AGKGLQKGKIL 279
             +   LQ+G I+
Sbjct: 431 HTSDIDLQRGTIV 443

>Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {ON}
           YHR158C (REAL)
          Length = 1168

 Score = 55.5 bits (132), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 62/257 (24%), Positives = 107/257 (41%), Gaps = 52/257 (20%)

Query: 122 WKRYTSQNSPMPR---SSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWL---FDCSS 175
           W R   Q+SP PR    S+A  +    + +I G    S        Y D+W+   FD ++
Sbjct: 113 WNRIKLQDSPFPRYRHVSSAYVTDKNQIYVIGGLHDQSV-------YGDTWILTAFDNAT 165

Query: 176 K-EWTKVE-QKNGPSARSGHRMAIWKN-FIILHGGFRDLGTSTTYLNDLWVFDITNYKWK 232
           K   T ++  +  P  R GH   +  N F++  G    +       +D+++ +I +YKW 
Sbjct: 166 KFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMDDDIYLLNINSYKWT 225

Query: 233 QVELPANHPIPDARSGH--SLISTAEGAV---LYGGYTKVKAGKGLQKGKILSDCWYLKM 287
            V  P   P P  R GH  S+I+T +      ++GG                 D ++  +
Sbjct: 226 -VPAPVG-PRPLGRYGHKISIIATNQMKTKLYVFGGQ--------------FDDTYFNDL 269

Query: 288 KS-DLGSIR-----WERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRSIF 341
              DL S R     WE  K +   P P    +M+ +  +  +FGG        ++L+ + 
Sbjct: 270 AVYDLSSFRRPDSHWEFLKPKTFSPPPITNFTMISYDSKLWVFGG--------DTLQGLV 321

Query: 342 YNELYTYQIENNRWYAM 358
            N+++ Y    N W+ +
Sbjct: 322 -NDVFMYDPALNDWFII 337

 Score = 40.4 bits (93), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 43/191 (22%), Positives = 79/191 (41%), Gaps = 31/191 (16%)

Query: 108 FYNDLFVYSLDT-----DTWKRYTSQN-SPMPRSSAAVASHPTGVALIHGGEFSSPKQNT 161
           ++NDL VY L +       W+    +  SP P ++  + S+ + + +  G          
Sbjct: 265 YFNDLAVYDLSSFRRPDSHWEFLKPKTFSPPPITNFTMISYDSKLWVFGGDTLQG----- 319

Query: 162 FYHYSDSWLFDCSSKEWTKVEQKN-GPSARSGHRMAIWKNFIILHGGFRDLGTSTTYLND 220
               +D +++D +  +W  +E     P     H   ++ + + + GG  +      YLN 
Sbjct: 320 --LVNDVFMYDPALNDWFIIETTGEKPPPVQEHATVVYNDLMCVVGGKDE---HDAYLNS 374

Query: 221 LWVFDITNYKWKQVELPA-NHPIPDARSGHSLISTAEGAVLYGG-----YTKVKAGK--- 271
           ++  ++ + KW   +LP     IP  RSGHSL       +L  G     Y +V+      
Sbjct: 375 VYFLNLKSNKW--FKLPVFTAGIPQGRSGHSLTLLKNDKILIMGGDKFDYARVEESDLHT 432

Query: 272 ---GLQKGKIL 279
               +QKG I+
Sbjct: 433 SDIDMQKGTIV 443

>TDEL0G01120 Chr7 (229805..232834) [3030 bp, 1009 aa] {ON} Anc_5.88
           YGR238C
          Length = 1009

 Score = 55.1 bits (131), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 63/258 (24%), Positives = 106/258 (41%), Gaps = 60/258 (23%)

Query: 122 WKRYTSQNSPMPRSSAAVASHPTG---VALIHGGEFSSPKQNTFYHYSDSWLFDCSSKEW 178
           W R   Q+SP PR     +S+ +    + +I G    S        Y D+W+ +      
Sbjct: 94  WNRVKLQDSPFPRYRHVASSYVSDDNRIYVIGGLHDES-------VYGDTWIINVDDS-G 145

Query: 179 TKVEQKN------GPSARSGHRMAIWKN-FIILHGGFRDLGTSTTYLNDLWVFDITNYKW 231
           T+   K        P  R GH   +  N F+I  G    + +     +DL++F+I ++KW
Sbjct: 146 TQFSSKTVDISEFTPPPRVGHAATLCGNAFVIFGGDTHKVNSEGLMDDDLYLFNINSFKW 205

Query: 232 KQVELPANHPI---PDARSGH--SLISTAEGAV---LYGGYTKVKAGKGLQKGKILSDCW 283
               +P  HP+   P  R GH  S+I+T +      L+GG                 D +
Sbjct: 206 T---IP--HPVGPRPLGRYGHKISIIATNQMKTKLYLFGGQ--------------FDDTF 246

Query: 284 YLKMKS-DLGSIR-----WERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESL 337
           +  +   DL S R     WE  K +   P P    +MV +  +  +FGG        +++
Sbjct: 247 FNDLAVYDLSSFRRSDSHWEFLKPKTFVPPPLANHTMVSYDHKLWIFGG--------DTM 298

Query: 338 RSIFYNELYTYQIENNRW 355
           + +  N+++ Y I +N W
Sbjct: 299 QGLI-NKVFVYDIMSNDW 315

 Score = 35.4 bits (80), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 77/190 (40%), Gaps = 31/190 (16%)

Query: 149 IHGGEFSSPKQNTFYHYSDSWLFDCSS-----KEWTKVEQKN-GPSARSGHRMAIWKNFI 202
           + GG+F     +TF++  D  ++D SS       W  ++ K   P   + H M  + + +
Sbjct: 237 LFGGQFD----DTFFN--DLAVYDLSSFRRSDSHWEFLKPKTFVPPPLANHTMVSYDHKL 290

Query: 203 ILHGGFRDLGTSTTYLNDLWVFDITNYKWKQVELPANHPIPDARSGHSLISTAEGAVLYG 262
            + GG     T    +N ++V+DI +  W  VE     P P              A++Y 
Sbjct: 291 WIFGG----DTMQGLINKVFVYDIMSNDWSLVETTGARPPP---------LQEHAALIYK 337

Query: 263 GYTKVKAGKGLQKGKILSDCWYLKMKSDLGSIRWERRKK-QGSQPSPRVGCSMVHHKGRG 321
               V  GK  ++   L+  ++L +K    S RW +    +   P  R G S+   K   
Sbjct: 338 DLMCVVGGKD-EQDIYLNSIYFLNLK----SCRWFKFPVFKAGIPQGRSGHSITLLKNNK 392

Query: 322 VLFGGVYDFE 331
           +L  G   F+
Sbjct: 393 ILIMGGDKFD 402

>KNAG0K00560 Chr11 complement(96678..99992) [3315 bp, 1104 aa] {ON}
           Anc_5.88 YGR238C
          Length = 1104

 Score = 54.7 bits (130), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 65/268 (24%), Positives = 108/268 (40%), Gaps = 51/268 (19%)

Query: 122 WKRYTSQNSPMPRSSAAVASHPT--GVALIHGGEFSSPKQNTFYHYSDSWLFDC--SSKE 177
           W R   ++SP PR     +S+ T      + GG      Q+ F    D W+     +  +
Sbjct: 197 WNRIKLKDSPFPRYRHVTSSYATEDDRVFVIGGLHD---QSVF---GDVWIIKSLENGTK 250

Query: 178 WTKVE---QKNGPSARSGHRMAIWKN-FIILHGGFRDLGTSTTYLNDLWVFDITNYKWKQ 233
           +T       +N P  R GH   +  N F++  G    +       +DL++F+I +YKW  
Sbjct: 251 FTSTTIDITENTPPPRVGHAATLCGNAFVVFGGDTHKVNKDGLMDDDLYLFNINSYKWT- 309

Query: 234 VELPANHPIPDARSGH--SLISTAEGAV---LYGGYTKVKAGKGLQKGKILSDCWYLKMK 288
           +  P   P P  R GH  S+I+T        L+GG                 D ++  + 
Sbjct: 310 IPNPIG-PRPLGRYGHKVSIIATTPMKTKLYLFGGQ--------------FDDTYFNNLA 354

Query: 289 S-DLGSIR-----WERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRSIFY 342
             DL   R     WE  K +   P P    +MV ++ +  +FGG        ++L+ +  
Sbjct: 355 VFDLSQFRRPDSHWEFLKPKSFMPPPLTNHTMVSYQNKLWIFGG--------DTLQGLI- 405

Query: 343 NELYTYQIENNRWYAMSLRPQRK-KKNF 369
           N+++ Y  E N W  +   P    ++NF
Sbjct: 406 NKIFMYDPEVNDWTVVETFPANNDQENF 433

 Score = 39.7 bits (91), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 56/132 (42%), Gaps = 18/132 (13%)

Query: 169 WLFDCSSKEWTKVE-------QKNGPSARSGHRMAIWKNFIILHGGFRDLGTSTTYLNDL 221
           +++D    +WT VE       Q+N P     H   ++ + +++ GG  +      YLN +
Sbjct: 409 FMYDPEVNDWTVVETFPANNDQENFPPPMQEHASVMYGDLMVVMGGKDE---QDNYLNTV 465

Query: 222 WVFDITNYKWKQVELPANHPIPDARSGHSLISTAEGAVLYGGYTKVKAGKGLQKGKILSD 281
           +   I   +W ++    +  IP  RSGHS+       +L  G  K    +  + G   +D
Sbjct: 466 YFLKINTLEWYKLPF-LSVGIPQGRSGHSITLLKGNKLLIMGGDKFDYARPEEHGLHTTD 524

Query: 282 CWYLKMKSDLGS 293
                  +D+GS
Sbjct: 525 -------TDMGS 529

>NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {ON}
           Anc_5.88 YGR238C
          Length = 1167

 Score = 54.3 bits (129), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 61/258 (23%), Positives = 103/258 (39%), Gaps = 52/258 (20%)

Query: 119 TDTWKRYTSQNSPMPRSSAAVASHPT--GVALIHGGEFSSPKQNTFYHYSDSWLFDCSSK 176
           T  W R   QNSP PR     +S+ +  G   + GG            Y D+W+    + 
Sbjct: 157 TTIWNRIKLQNSPFPRYRHVASSYVSDDGKIYVIGGLHDQSV------YGDTWILSYENN 210

Query: 177 EW-TKVEQK------NGPSARSGHRMAIWKN-FIILHGGFRDLGTSTTYLNDLWVFDITN 228
              T +  K      N P  R GH   +  N F+I  G    +    +  +D+++F+I +
Sbjct: 211 GLSTTITSKTVDISENTPPPRVGHAATLCGNAFVIFGGDTHKVNKDGSMDDDIYLFNINS 270

Query: 229 YKWKQVELPANHPIPDARSGH--SLISTAEGAV---LYGGYTKVKAGKGLQKGKILSDCW 283
           YKW   +     P+   R GH  S+I+T++      L+GG                 D +
Sbjct: 271 YKWTIPKPVGQRPL--GRYGHKISIIATSQMKTKLYLFGGQ--------------FDDTY 314

Query: 284 YLKMKS-DLGSIR-----WERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESL 337
           +  +   DL S R     WE  + +   P P    +M  +  +  +FGG        ++L
Sbjct: 315 FNDLVVFDLSSFRRPDSHWEFIRPKSFIPPPLTNHTMCSYDHKLWVFGG--------DTL 366

Query: 338 RSIFYNELYTYQIENNRW 355
           + +  N+++ Y   +N W
Sbjct: 367 QGL-TNQVFMYDPVDNDW 383

 Score = 39.7 bits (91), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 45/103 (43%), Gaps = 13/103 (12%)

Query: 169 WLFDCSSKEWTKVEQ-------KNGPSARSGHRMAIWKNFIILHGGFRDLGTSTTYLNDL 221
           +++D    +W  VE         N P     H   ++K+ + + GG  +   S  YLND+
Sbjct: 374 FMYDPVDNDWCVVETFANNNDVSNIPPPIQEHAAVLYKDLMCVIGGKDE---SDNYLNDV 430

Query: 222 WVFDITNYKWKQVELP-ANHPIPDARSGHSLISTAEGAVLYGG 263
           +  ++   KW   +LP     +P  RSGHS+       +L  G
Sbjct: 431 YFLNLKTLKW--FKLPFYKEGVPQGRSGHSVTLLKNDKILIMG 471

>Skud_7.572 Chr7 complement(940820..943471) [2652 bp, 883 aa] {ON}
           YGR238C (REAL)
          Length = 883

 Score = 54.3 bits (129), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 61/246 (24%), Positives = 112/246 (45%), Gaps = 48/246 (19%)

Query: 128 QNSPMPRSSAAVASHPTGVA-LIHGGEFSSPKQNTFYHYSDSWLFDCSSKEWTKVEQKNG 186
           +N+P PR     AS   G A ++ GG+     ++      D +LF+ +S +WT + Q  G
Sbjct: 134 RNTPPPR--VGHASTLCGNAYVVFGGDTHKLNEDKLLD-DDIYLFNVNSYKWT-IPQPIG 189

Query: 187 --PSARSGHRMAI-----WKNFIILHGGFRDLGTSTTYLNDLWVFDITNYK-----WKQV 234
             P  R GH+++I      +  + L GG  D     TY NDL +FD+++++     W+ +
Sbjct: 190 SRPLGRYGHKISIIAYNPMQTKLYLFGGQLD----KTYFNDLAMFDLSSFRRRNSHWEFL 245

Query: 235 ELPANHPIPDARSGHSLISTAEGAVLYGGYTKVKAGKGLQKGKILSDCWYL--KMKSDLG 292
           E PA   +P   + H++++      ++GG T           K +S+  Y    +++D  
Sbjct: 246 E-PATT-VPPPLANHTMVTYGNKLWVFGGETP----------KTVSNETYCYDPIQND-- 291

Query: 293 SIRWERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRSIFYNELYTYQIEN 352
              W + +  G  P P    + V +K    +FGG Y          + + N++Y   + +
Sbjct: 292 ---WSKIETTGEIPPPVQEHASVVYKHIMCVFGGKYT--------HNAYSNDVYFLDLLS 340

Query: 353 NRWYAM 358
            +WY +
Sbjct: 341 FKWYKL 346

 Score = 48.5 bits (114), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 81/168 (48%), Gaps = 27/168 (16%)

Query: 108 FYNDLFVYSLDTDTWKRYTSQ--------NSPMPRSSAAVASHPTGVAL-IHGGEFSSPK 158
           ++NDL ++  D  +++R  S           P P ++  + ++  G  L + GGE  +PK
Sbjct: 223 YFNDLAMF--DLSSFRRRNSHWEFLEPATTVPPPLANHTMVTY--GNKLWVFGGE--TPK 276

Query: 159 QNTFYHYSDSWLFDCSSKEWTKVEQKNG-PSARSGHRMAIWKNFIILHGGFRDLGTSTTY 217
             +    ++++ +D    +W+K+E     P     H   ++K+ + + GG     T   Y
Sbjct: 277 TVS----NETYCYDPIQNDWSKIETTGEIPPPVQEHASVVYKHIMCVFGGKY---THNAY 329

Query: 218 LNDLWVFDITNYKWKQVELP-ANHPIPDARSGHSL-ISTAEGAVLYGG 263
            ND++  D+ ++KW   +LP     IP  RSGHSL +   E  ++ GG
Sbjct: 330 SNDVYFLDLLSFKW--YKLPHIKEGIPRERSGHSLTLMKNEKILIMGG 375

 Score = 40.8 bits (94), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 60/144 (41%), Gaps = 13/144 (9%)

Query: 212 GTSTTYLNDLWVFDITNYKWKQVELPANHPIPDARSGHSLISTAEGAVLYGGYTKVKAGK 271
           G STT  + +   +   Y W +++L  + P P  R   S I ++E  +   G        
Sbjct: 52  GASTTLPSPIERENAKKYVWNRIKL-KDSPFPRYRHSSSPIVSSENRIFVTG-------- 102

Query: 272 GLQKGKILSDCWYLKMKSDLGSIRWERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFE 331
           GL    +  D W +   +D  S   +  +   + P PRVG +        V+FGG  D  
Sbjct: 103 GLYNQSVYGDVWQITANADGTSFTPKAIQIDRNTPPPRVGHASTLCGNAYVVFGG--DTH 160

Query: 332 ETEESLRSIFYNELYTYQIENNRW 355
           +  E    +  +++Y + + + +W
Sbjct: 161 KLNED--KLLDDDIYLFNVNSYKW 182

>TPHA0H01080 Chr8 complement(232804..235290) [2487 bp, 828 aa] {ON}
           Anc_5.88 YGR238C
          Length = 828

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 61/256 (23%), Positives = 98/256 (38%), Gaps = 39/256 (15%)

Query: 118 DTDTWKRYTSQNSPMPRSSAAVASH--PTGVALIHGGEFSSP------KQNTFYHYSDS- 168
           D   W +   + +P PR     +S+  P+    I+GG F S       K N   +Y+++ 
Sbjct: 18  DYSPWSKINVKGTPFPRYRHITSSYIYPSNDLYINGGLFESDVYGDTWKLNIKENYNEND 77

Query: 169 ---WLFDCSSKEWTKVEQKNGPSARSGHRMAIWKNFIILHGG-FRDLGTSTTYLND-LWV 223
              W + C+  +         P  R GH   +  N +I+ GG    +  S   ++D L+ 
Sbjct: 78  LERWHYSCNIIDIMGT----TPPPRVGHAATLCGNALIVFGGDTHKVNVSNGLMDDDLYF 133

Query: 224 FDITNYKWKQVELPANHPI-PDARSGHSLISTAEGAVLYGGYTKVKAGKGLQKGKILSDC 282
            ++   KW    +P+   I P  R GH +        L+GG         L K  +L+  
Sbjct: 134 LNLDTTKWT---IPSPKGIRPLGRYGHKISVINSNLYLFGGQFDETYFNDLVKFDLLN-- 188

Query: 283 WYLKMKSDLGSIRWERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRSIFY 342
                  D  S +WE  K +G  P P    SM   + +  +FGG             +  
Sbjct: 189 -----FKDANS-QWEFIKPKGFIPPPLSNFSMCTFENKLYVFGG---------DTYQVLT 233

Query: 343 NELYTYQIENNRWYAM 358
           NE + Y  E N W  +
Sbjct: 234 NETFVYDPELNEWSIL 249

>KLTH0C01474g Chr3 (131243..134413) [3171 bp, 1056 aa] {ON} similar
           to uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 1056

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 65/257 (25%), Positives = 104/257 (40%), Gaps = 52/257 (20%)

Query: 122 WKRYTSQNSPMPR---SSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWLF---DCSS 175
           W R    NSP PR    ++A AS    V +I G    S        Y D+W+    D  S
Sbjct: 78  WSRVKLANSPFPRYRHVASAYASEQNQVYVIGGLHDQS-------VYGDTWIISAHDNGS 130

Query: 176 KEWTKVEQ--KNGPSARSGHRMAIWKN-FIILHGGFRDLGTSTTYLNDLWVFDITNYKWK 232
           K  +K        P  R GH   +  N F+I  G    + +     +D+++F+I +YKW 
Sbjct: 131 KFSSKTVDITDTTPPPRVGHASTLCGNAFVIFGGDTHKVNSDGLMDDDVYLFNINSYKWT 190

Query: 233 QVELPANHPIPDARSGH--SLISTAEGAV---LYGGYTKVKAGKGLQKGKILSDCWYLKM 287
            +  P   P P  R GH  S+I+T++      ++GG                 D ++  +
Sbjct: 191 -IPRPVG-PRPLGRYGHKISIIATSQMRTKLYVFGGQ--------------FDDTYFNDL 234

Query: 288 KS-DLGSIR-----WERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRSIF 341
              DL S R     W+  K     P P    +M+ +  +  +FGG     +T + L    
Sbjct: 235 TVFDLSSFRRPDSHWQFIKPNTFTPPPLTNHTMISYDYKLWVFGG-----DTPQGL---- 285

Query: 342 YNELYTYQIENNRWYAM 358
            N+++ +  + N W  M
Sbjct: 286 INDVFMFDPQINDWKVM 302

 Score = 38.9 bits (89), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 76/174 (43%), Gaps = 22/174 (12%)

Query: 108 FYNDLFVYSLDT----DTWKRYTSQNS--PMPRSSAAVASHPTGVALIHGGEFSSPKQNT 161
           ++NDL V+ L +    D+  ++   N+  P P ++  + S+   +  + GG+      N 
Sbjct: 230 YFNDLTVFDLSSFRRPDSHWQFIKPNTFTPPPLTNHTMISYDYKL-WVFGGDTPQGLIN- 287

Query: 162 FYHYSDSWLFDCSSKEWTKVEQKNG--PSARSGHRMAIWKNFIILHGGFRDLGTSTTYLN 219
                D ++FD    +W KV Q  G  P     H   ++ + + + GG  +      Y N
Sbjct: 288 -----DVFMFDPQINDW-KVMQTTGDKPPPLQEHAAVLYGDLMCVVGGKDE---QDVYSN 338

Query: 220 DLWVFDITNYKWKQVELPA-NHPIPDARSGHSLISTAEGAVLYGGYTKVKAGKG 272
            ++  ++ + KW   +LP+    IP  RSGHSL       +L  G  K    +G
Sbjct: 339 SVFFLNLISLKW--FKLPSYRSGIPQGRSGHSLTLLPNHKLLIMGGDKFDYARG 390

>YGR238C Chr7 complement(966039..968687) [2649 bp, 882 aa] {ON}
           KEL2Protein that functions in a complex with Kel1p to
           negatively regulate mitotic exit, interacts with Tem1p
           and Lte1p; localizes to regions of polarized growth;
           potential Cdc28p substrate
          Length = 882

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 61/248 (24%), Positives = 98/248 (39%), Gaps = 40/248 (16%)

Query: 122 WKRYTSQNSPMPR---SSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWLF----DCS 174
           W R   +NSP PR   SS+ + ++   + +  G    S        Y D W      D +
Sbjct: 73  WNRVKLKNSPFPRYRHSSSFIVTNDNRIFVTGGLHDQSV-------YGDVWQIAANADGT 125

Query: 175 SKEWTKVE-QKNGPSARSGHRMAIWKN-FIILHGGFRDLGTSTTYLNDLWVFDITNYKWK 232
           S    +++  +N P  R GH   I  N +++  G    L  +    +DL++F+I +YKW 
Sbjct: 126 SFTSKRIDIDQNTPPPRVGHASTICGNAYVVFGGDTHKLNKNGLLDDDLYLFNINSYKWT 185

Query: 233 QVELPANHPIPDARSGHSLISTAEGAVLYGGYTKVKAGKGLQKGKILSDCWYLKMKSDLG 292
             +     P+   R GH +   A   +     TK+    G       +D        DL 
Sbjct: 186 IPQPIGRRPL--GRYGHKISIIASNPM----QTKLYLFGGQVDETYFNDLVVF----DLS 235

Query: 293 SIR-----WERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRSIFYNELYT 347
           S R     WE  +  G  P P    +MV +  +  +FGG     ET +++     N+ Y 
Sbjct: 236 SFRRPNSHWEFLEPVGDLPPPLTNHTMVAYDNKLWVFGG-----ETPKTIS----NDTYR 286

Query: 348 YQIENNRW 355
           Y    + W
Sbjct: 287 YDPAQSEW 294

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 52/127 (40%), Gaps = 13/127 (10%)

Query: 229 YKWKQVELPANHPIPDARSGHSLISTAEGAVLYGGYTKVKAGKGLQKGKILSDCWYLKMK 288
           Y W +V+L  N P P  R   S I T +  +   G        GL    +  D W +   
Sbjct: 71  YIWNRVKL-KNSPFPRYRHSSSFIVTNDNRIFVTG--------GLHDQSVYGDVWQIAAN 121

Query: 289 SDLGSIRWERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRSIFYNELYTY 348
           +D  S   +R     + P PRVG +        V+FGG    +  + +   +  ++LY +
Sbjct: 122 ADGTSFTSKRIDIDQNTPPPRVGHASTICGNAYVVFGG----DTHKLNKNGLLDDDLYLF 177

Query: 349 QIENNRW 355
            I + +W
Sbjct: 178 NINSYKW 184

 Score = 40.8 bits (94), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 72/330 (21%), Positives = 129/330 (39%), Gaps = 66/330 (20%)

Query: 110 NDLFVYSLDTDTWKRYTSQNSPMPRSSAAVASHPTGVALIHGGEFSSPKQNTFY------ 163
           +DL+++++++  W        P P     +  +   +++I     S+P Q   Y      
Sbjct: 172 DDLYLFNINSYKW------TIPQPIGRRPLGRYGHKISII----ASNPMQTKLYLFGGQV 221

Query: 164 ---HYSDSWLFDCSS-----KEWTKVEQ-KNGPSARSGHRMAIWKNFIILHGGFRDLGTS 214
              +++D  +FD SS       W  +E   + P   + H M  + N + + GG     T 
Sbjct: 222 DETYFNDLVVFDLSSFRRPNSHWEFLEPVGDLPPPLTNHTMVAYDNKLWVFGG----ETP 277

Query: 215 TTYLNDLWVFDITNYKWKQVELPANHPIPDARSGHSLISTAEGAVLYGGYTKVKAGKGLQ 274
            T  ND + +D    +W +V+     P P              +V+Y     V  GK   
Sbjct: 278 KTISNDTYRYDPAQSEWSKVKTTGEKPPPIQE---------HASVVYKHLMCVLGGKDTH 328

Query: 275 KGKILSDCWYLKMKSDLGSIRWER--RKKQGSQPSPRVGCSMVHHKGRGVLFGG------ 326
                +D ++L    +L S++W +  R K+G  P  R G S+   K   +L  G      
Sbjct: 329 NA-YSNDVYFL----NLLSLKWYKLPRMKEGI-PQERSGHSLTLMKNEKLLIMGGDKTDY 382

Query: 327 ----VYDFE--ETEESLRSIFY-------NELYTYQIENNRWYAMSLRPQRKKKNFVQSK 373
               ++D +  ET++   ++ Y       NEL    I     +A           F  SK
Sbjct: 383 ASPNIHDLQTSETDQGEGTLLYTLDLSSLNELCP-GIMCESLHAGESFSNSLSGGFTPSK 441

Query: 374 SNRNKDKELEDILNQILDKANLRDAEDDDE 403
           S  ++++E+ +IL   L  + +    D DE
Sbjct: 442 STESENQEIINILTPRLPDSKVLSYNDIDE 471

>Smik_16.68 Chr16 (128068..130752) [2685 bp, 894 aa] {ON} YGR238C
           (REAL)
          Length = 894

 Score = 51.2 bits (121), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 48/167 (28%), Positives = 80/167 (47%), Gaps = 25/167 (14%)

Query: 108 FYNDLFVYSLDTDTWKRYTSQ---NSPMPRSSAAVASHPTGVAL-----IHGGEFSSPKQ 159
           ++NDL V+  D  +++R  S      P+      + +H T V       + GGE  +PK 
Sbjct: 225 YFNDLAVF--DLSSFRRPNSHWEFLEPISALPPPLTNH-TMVTFDNKLWVFGGE--TPKT 279

Query: 160 NTFYHYSDSWLFDCSSKEWTKVEQKN-GPSARSGHRMAIWKNFIILHGGFRDLGTSTTYL 218
            +    +D++ +D     W+KVE     P     H   ++K+ + + GG +D+    TY 
Sbjct: 280 IS----NDTYCYDPIQNAWSKVETTGEKPPPVQEHASVVYKHLMCVFGG-KDI--HNTYS 332

Query: 219 NDLWVFDITNYKWKQVELPA-NHPIPDARSGHSL-ISTAEGAVLYGG 263
           ND++  ++ + KW   +LP     IP  RSGHSL +   E  V+ GG
Sbjct: 333 NDVYFLNLLSLKW--FKLPCVKEGIPQERSGHSLTLMNNEKLVIMGG 377

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 61/257 (23%), Positives = 105/257 (40%), Gaps = 58/257 (22%)

Query: 122 WKRYTSQNSPMPR---SSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWLFDCSSKEW 178
           W R   ++SP PR   SS+ + ++   +  + GG +          Y D W    ++   
Sbjct: 73  WNRIKLKDSPFPRYRHSSSFITTNDNRI-FVTGGLYDQSV------YGDVWEITANANGT 125

Query: 179 TKVEQK-----NGPSARSGHRMAIWKN-FIILHGGFRDLGTSTTYLNDLWVFDITNYKWK 232
           +   ++     N P  R GH   +  N +++  G    L  +    +DL++F+I +YKW 
Sbjct: 126 SFTSKRIQIDHNTPPPRVGHASTMCGNAYVVFGGDTHKLNKNRLLDDDLYLFNINSYKWT 185

Query: 233 QVELPANHPI---PDARSGH--SLISTAEGAV---LYGGYTKVKAGKGLQKGKILSDCWY 284
              +P  HPI   P  R GH  S+I++ +      L+GG               + + ++
Sbjct: 186 ---IP--HPIGSRPLGRYGHKISIIASKQMHTELYLFGGQ--------------IDETYF 226

Query: 285 LKMKS-DLGSIR-----WERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLR 338
             +   DL S R     WE  +   + P P    +MV    +  +FGG     ET +++ 
Sbjct: 227 NDLAVFDLSSFRRPNSHWEFLEPISALPPPLTNHTMVTFDNKLWVFGG-----ETPKTIS 281

Query: 339 SIFYNELYTYQIENNRW 355
               N+ Y Y    N W
Sbjct: 282 ----NDTYCYDPIQNAW 294

 Score = 36.6 bits (83), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 50/231 (21%), Positives = 94/231 (40%), Gaps = 39/231 (16%)

Query: 110 NDLFVYSLDTDTWKRYTSQNSPMPRSSAAVASHPTGVALIHGGEFSSP-----KQNTFYH 164
           +DL+++++++  W        P P  S  +  +   +++I   +  +       Q    +
Sbjct: 172 DDLYLFNINSYKW------TIPHPIGSRPLGRYGHKISIIASKQMHTELYLFGGQIDETY 225

Query: 165 YSDSWLFDCSS-----KEWTKVEQKNG-PSARSGHRMAIWKNFIILHGGFRDLGTSTTYL 218
           ++D  +FD SS       W  +E  +  P   + H M  + N + + GG     T  T  
Sbjct: 226 FNDLAVFDLSSFRRPNSHWEFLEPISALPPPLTNHTMVTFDNKLWVFGG----ETPKTIS 281

Query: 219 NDLWVFDITNYKWKQVELPANHPIPDARSGHSLISTAEGAVLYGGYTKVKAGKGLQKGKI 278
           ND + +D     W +VE     P P              +V+Y     V  GK +     
Sbjct: 282 NDTYCYDPIQNAWSKVETTGEKPPP---------VQEHASVVYKHLMCVFGGKDIH-NTY 331

Query: 279 LSDCWYLKMKSDLGSIRWERRK--KQGSQPSPRVGCSM-VHHKGRGVLFGG 326
            +D ++L    +L S++W +    K+G  P  R G S+ + +  + V+ GG
Sbjct: 332 SNDVYFL----NLLSLKWFKLPCVKEGI-PQERSGHSLTLMNNEKLVIMGG 377

>TPHA0A05170 Chr1 complement(1161610..1164660) [3051 bp, 1016 aa]
           {ON} Anc_5.88 YGR238C
          Length = 1016

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 56/225 (24%), Positives = 87/225 (38%), Gaps = 43/225 (19%)

Query: 122 WKRYTSQNSPMPRSSAAVASHPT--GVALIHGGEFSSPKQNTFYHYSDSWLFDCSSKEWT 179
           W R    NSP PR     +S+ +      + GG            Y D+W    S+   T
Sbjct: 142 WNRIKLTNSPFPRYRHVASSYESVDNEIFVIGGLHDQSV------YGDTWSI-TSTNNGT 194

Query: 180 KVEQKN------GPSARSGHRMAIWKN-FIILHGGFRDLGTSTTYLNDLWVFDITNYKWK 232
           +   K        P  R GH   +  N F++  G    +       +D+++F+I ++KW 
Sbjct: 195 QFISKALEILDLSPPPRVGHASTLCGNAFVVFGGDTHKVNKDGLMDDDIYLFNINSHKWT 254

Query: 233 QVELPANHPIPDARSGH--SLISTAEGAV---LYGGYTKVKAGKGLQKGKILSDCWYLKM 287
            +  P   P P  R GH  S+I+T+       L+GG                 D ++  +
Sbjct: 255 -IPSPVG-PRPLGRYGHKISIIATSSSKTKLYLFGGQ--------------FDDTYFNDI 298

Query: 288 KS-DLGSIR-----WERRKKQGSQPSPRVGCSMVHHKGRGVLFGG 326
              DL S R     WE  K +G  P P    +MV +  +  +FGG
Sbjct: 299 AVFDLSSFRRADSHWEFIKPKGLIPPPMTNHTMVTYDNKLWVFGG 343

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 55/239 (23%), Positives = 100/239 (41%), Gaps = 40/239 (16%)

Query: 130 SPMPRSSAAVASHPTGVA-LIHGGEFSSPKQNTFYHYSDSWLFDCSSKEWTKVEQKNGPS 188
           SP PR     AS   G A ++ GG+     ++      D +LF+ +S +WT +    GP 
Sbjct: 207 SPPPR--VGHASTLCGNAFVVFGGDTHKVNKDGLMD-DDIYLFNINSHKWT-IPSPVGPR 262

Query: 189 --ARSGHRMAIW-----KNFIILHGG-FRDLGTSTTYLNDLWVFDITNYKWKQVELPANH 240
              R GH+++I      K  + L GG F D     TY ND+ VFD+++++          
Sbjct: 263 PLGRYGHKISIIATSSSKTKLYLFGGQFDD-----TYFNDIAVFDLSSFRRADSHWEFIK 317

Query: 241 P---IPDARSGHSLISTAEGAVLYGGYTKVKAGKGLQKGKILSDCWYLKMKSDLGSIRWE 297
           P   IP   + H++++      ++GG TK     GL     ++D +       + +  W 
Sbjct: 318 PKGLIPPPMTNHTMVTYDNKLWVFGGDTK----DGL-----INDIYAFDPADSINT--WT 366

Query: 298 RRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRSIFYNELYTYQIENNRWY 356
           +    G  P P    S + +     + GG        +    ++ N ++ +  +  +W+
Sbjct: 367 KIDVTGDIPCPVQEHSALIYDNLMCVIGG--------KDENDMYLNSVHFFNFDKLKWF 417

>KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} similar
           to uniprot|P50090 Saccharomyces cerevisiae YGR238C KEL2
           Protein that functions in a complex with Kel1p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate AND similar to YHR158C
           uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 905

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 59/251 (23%), Positives = 94/251 (37%), Gaps = 40/251 (15%)

Query: 122 WKRYTSQNSPMPRSSAAVASHPT--GVALIHGGEFSSPKQNTFYHYSDSWLFD-----CS 174
           W R   + SP PR     +S+ T  G   + GG            Y D+W+        S
Sbjct: 93  WNRIRLKQSPFPRYRHVASSYATDSGELFVIGGLHDQSV------YGDTWIIKSLDNATS 146

Query: 175 SKEWTKVEQKNGPSARSGHRMAIWKN-FIILHGGFRDLGTSTTYLNDLWVFDITNYKWKQ 233
            K  T       P  R GH   +  N F+I  G    +  +    +D+++F+I ++KW  
Sbjct: 147 FKSITVPIADATPPPRVGHASTLCGNAFVIFGGDTHKVNDAGLMDDDIYLFNINSHKWT- 205

Query: 234 VELPANHPIPDARSGHSLISTAEGAVLYGGYTKVKAGKGLQKGKILSDCWYLKMKS-DLG 292
           +  P   P P  R GH +      +++     K K       G    D ++  +   DL 
Sbjct: 206 IPTPQG-PRPLGRYGHKI------SIIAANQMKTKL---YVFGGQFDDTYFNDLAEFDLS 255

Query: 293 SIR-----WERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRSIFYNELYT 347
           S R     WE  K     P P    +M+    +  +FGG     +T + L     NE++ 
Sbjct: 256 SFRRSDSHWEFIKPATFMPPPLANHTMISFDHKLWVFGG-----DTPQGLT----NEVFM 306

Query: 348 YQIENNRWYAM 358
           +    N W  +
Sbjct: 307 FDPAANDWCVV 317

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 51/106 (48%), Gaps = 7/106 (6%)

Query: 169 WLFDCSSKEWTKVEQK-NGPSARSGHRMAIWKNFIILHGGFRDLGTSTTYLNDLWVFDIT 227
           ++FD ++ +W  V+   N P     H   I+++ + + GG +D      Y N ++  +  
Sbjct: 305 FMFDPAANDWCVVQTTGNIPPPLQEHAAIIYRDLMCVFGG-KD--AQDNYSNAVYFLNFR 361

Query: 228 NYKWKQVELPA-NHPIPDARSGHSLISTAEGAVLYGGYTKVKAGKG 272
           + KW   +LP  N+ IP ARSGHSL   +   +L  G  K     G
Sbjct: 362 SLKW--FKLPTFNNMIPRARSGHSLTLLSNNKLLIMGGDKFDYAVG 405

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 53/241 (21%), Positives = 92/241 (38%), Gaps = 43/241 (17%)

Query: 126 TSQNSPMPRSSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWLFDCSSKEWTKVEQKN 185
           T QN P P + + + +    V +    + S+  Q+T        +F      W ++  K 
Sbjct: 49  TKQNYPKPAADSGLLAAQQRVMVSPVEQRSTSTQSTLQQ----QVF----TPWNRIRLKQ 100

Query: 186 GPSARSGHRMAIWKN-----FIILHGGFRDLGTSTTYLNDLWVFDITN--YKWKQVELPA 238
            P  R  H  + +       F+I  GG  D     +   D W+    +    +K + +P 
Sbjct: 101 SPFPRYRHVASSYATDSGELFVI--GGLHD----QSVYGDTWIIKSLDNATSFKSITVPI 154

Query: 239 NHPIPDARSGHSLISTAEGAVLYGGYTKVKAGKGLQKGKILSDCWYLKMKSDLGSIRWER 298
               P  R GH+        V++GG T      GL     + D  YL    ++ S +W  
Sbjct: 155 ADATPPPRVGHASTLCGNAFVIFGGDTHKVNDAGL-----MDDDIYL---FNINSHKWTI 206

Query: 299 RKKQGSQPSPRVG--CSMV---HHKGRGVLFGGVYDFEETEESLRSIFYNELYTYQIENN 353
              QG +P  R G   S++     K +  +FGG +D           ++N+L  + + + 
Sbjct: 207 PTPQGPRPLGRYGHKISIIAANQMKTKLYVFGGQFD---------DTYFNDLAEFDLSSF 257

Query: 354 R 354
           R
Sbjct: 258 R 258

>Suva_7.530 Chr7 complement(920446..923130) [2685 bp, 894 aa] {ON}
           YGR238C (REAL)
          Length = 894

 Score = 48.5 bits (114), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 59/264 (22%), Positives = 100/264 (37%), Gaps = 52/264 (19%)

Query: 121 TWKRYTSQNSPMPR---SSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWLFDCSSKE 177
            W R   +NSP PR   S++ + ++   +  + GG       +    Y D+W    +   
Sbjct: 72  VWNRIKLKNSPFPRYRHSASPIVTNDNRI-FVTGG------LHDHLVYGDTWQITGNLDG 124

Query: 178 WTKVEQ-----KNGPSARSGHRMAIWKN-FIILHGGFRDLGTSTTYLNDLWVFDITNYKW 231
            + V +     +N P  R GH   I  N +++  G    L  +    +DL++F+I +YKW
Sbjct: 125 TSFVSKTIQIGQNTPPPRVGHASTICGNAYVVFGGDTHKLNMNRLLDDDLYLFNINSYKW 184

Query: 232 KQVELPANHPIPDARSGHSLISTAEGAV-----LYGGYTKVKAGKGLQKGKILSDCWYLK 286
              +     P+   R GH +   A   +     L+GG               + + ++  
Sbjct: 185 TIPQPVGTRPL--GRYGHKISIIANNPMQTKLFLFGGQ--------------IDETYFND 228

Query: 287 MKS-DLGSIR-----WERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRSI 340
           +   DL S R     W   K     P P    +MV    +  +FGG     +T  +L   
Sbjct: 229 LAMFDLSSFRRPNSHWVFLKPVSIVPPPLTNHTMVTFDNKLWVFGG-----KTPNTLS-- 281

Query: 341 FYNELYTYQIENNRWYAMSLRPQR 364
             NE + Y    N W  +    +R
Sbjct: 282 --NETFCYDPVQNDWSKIQTTGER 303

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 80/196 (40%), Gaps = 30/196 (15%)

Query: 172 DCSSKEWTKVEQKNGPSARSGHR---MAIWKNFIILHGGFRDLGTSTTYLNDLWV----F 224
           D     W +++ KN P  R  H    +    N I + GG  D         D W      
Sbjct: 67  DAGKYVWNRIKLKNSPFPRYRHSASPIVTNDNRIFVTGGLHD----HLVYGDTWQITGNL 122

Query: 225 DITNYKWKQVELPANHPIPDARSGHSLISTAEGAVLYGGYTKVKAGKGLQKGKILSDCWY 284
           D T++  K +++  N P P  R GH+        V++GG T       L   ++L D  Y
Sbjct: 123 DGTSFVSKTIQIGQNTPPP--RVGHASTICGNAYVVFGGDT-----HKLNMNRLLDDDLY 175

Query: 285 LKMKSDLGSIRWERRKKQGSQPSPRVG--CSMVHH---KGRGVLFGGVYDFEETEESLRS 339
           L    ++ S +W   +  G++P  R G   S++ +   + +  LFGG  D    E     
Sbjct: 176 L---FNINSYKWTIPQPVGTRPLGRYGHKISIIANNPMQTKLFLFGGQID----ETYFND 228

Query: 340 IFYNELYTYQIENNRW 355
           +   +L +++  N+ W
Sbjct: 229 LAMFDLSSFRRPNSHW 244

>TBLA0C06530 Chr3 complement(1577728..1581246) [3519 bp, 1172 aa]
           {ON} Anc_5.88 YGR238C
          Length = 1172

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 68/270 (25%), Positives = 103/270 (38%), Gaps = 65/270 (24%)

Query: 122 WKRYTSQNSPMPR---SSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWLFDCSSKEW 178
           W RY   NSP PR    +++V S    V +I G    S        Y D+W+   ++   
Sbjct: 55  WCRYKLHNSPFPRYRHVASSVVSSDNKVFVIGGLHDQS-------VYGDTWIISENTINI 107

Query: 179 TK-----------------------VE-QKNGPSARSGHRMAIWKN-FIILHGGFRDLGT 213
                                    VE  +  P  R GH   +  N F+I  G       
Sbjct: 108 NSPATMHTPTSTTSTTSNISFSSKTVEITEYTPPPRVGHASTLCGNAFVIFGGDTHKTNK 167

Query: 214 STTYLNDLWVFDITNYKWKQVELPANHPIPDARSGH--SLISTAEGAVLYGGYTKVKAGK 271
                +D+++F+I +YKW  +  P   P P  R GH  S+I+T++        TK+    
Sbjct: 168 DGLMDDDIYLFNINSYKW-TIPQPVG-PRPLGRYGHKISIIATSQMK------TKLYVFG 219

Query: 272 GLQKGKILSD-CWYLKMKSDLGSIR-----WERRKKQGSQPSPRVGCSMVHHKGRGVLFG 325
           G       +D C Y     DL S R     WE  K +   P P    +MV +  +  +FG
Sbjct: 220 GQFDDSYFNDLCVY-----DLSSFRKPESHWEFLKPKSFIPPPLTNHTMVSYDYKLWVFG 274

Query: 326 GVYDFEETEESLRSIFYNELYTYQIENNRW 355
           G     +T++ L     N+L+ +    N W
Sbjct: 275 G-----DTQQGL----INQLFMFDPVINDW 295

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 43/197 (21%), Positives = 80/197 (40%), Gaps = 33/197 (16%)

Query: 149 IHGGEFSSPKQNTFYHYSDSWLFDCSS-----KEWTKVEQKN-GPSARSGHRMAIWKNFI 202
           + GG+F         +++D  ++D SS       W  ++ K+  P   + H M  +   +
Sbjct: 217 VFGGQFDD------SYFNDLCVYDLSSFRKPESHWEFLKPKSFIPPPLTNHTMVSYDYKL 270

Query: 203 ILHGGFRDLGTSTTYLNDLWVFDITNYKWKQVELPANHPIPDARSGHSLISTAEGAVLYG 262
            + GG    G     +N L++FD     W+ VE     P P              AV++ 
Sbjct: 271 WVFGGDTQQG----LINQLFMFDPVINDWRVVETTGEKPPPVQE---------HAAVMFN 317

Query: 263 GYTKVKAGKGLQKGKILSDCWYLKMKSDLGSIRWER-RKKQGSQPSPRVGCSMVHHKGRG 321
               +  GK  ++   L+  ++L +K    S++W +    + + P  R G S+   K   
Sbjct: 318 DLMCIMGGKD-EQDVYLNSVYFLNLK----SLKWFKFNDYKLNIPQGRSGHSITLLKNNR 372

Query: 322 VLF--GGVYDFEETEES 336
           +L   G  +D+   +ES
Sbjct: 373 LLIMGGDKFDYARLDES 389

>Kwal_14.1019 s14 (159934..162870) [2937 bp, 978 aa] {ON} YHR158C
           (KEL1) - involved in cell fusion and morphology;
           contains six Kelch repeats [contig 244] FULL
          Length = 978

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 54/221 (24%), Positives = 84/221 (38%), Gaps = 35/221 (15%)

Query: 122 WKRYTSQNSPMPR---SSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWLFDCSSKEW 178
           W+R    NSP PR    ++A AS    V +I G    S        Y D+W+   S +  
Sbjct: 76  WRRIKLANSPFPRYRHVASAYASEQNQVYVIGGLHDQS-------VYGDTWIV-TSHENG 127

Query: 179 TKVEQKN------GPSARSGHRMAIWKN-FIILHGGFRDLGTSTTYLNDLWVFDITNYKW 231
            +   K        P  R GH   +  N F+I  G    + +     +D+++F+I +YKW
Sbjct: 128 ARFTSKTVEISDATPPPRVGHASTLCGNAFVIFGGDTHKVNSDGLMDDDVYLFNINSYKW 187

Query: 232 KQVELPANHPIPDARSGHSLISTAEGAVLYGGYTKVKAGKGLQKGKILSDCWYLKMKS-D 290
             +  P   P P  R GH +   A   +    Y           G    D ++  +   D
Sbjct: 188 T-IPNPVG-PRPLGRYGHKISIIAMSPMKTKLYV---------FGGQFDDTYFNDLAVFD 236

Query: 291 LGSIR-----WERRKKQGSQPSPRVGCSMVHHKGRGVLFGG 326
           L S R     W+        P P    +M+ +  +  +FGG
Sbjct: 237 LSSFRRPDSSWQFITPNSFTPPPLTNHAMISYDYKLWVFGG 277

 Score = 38.1 bits (87), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 46/200 (23%), Positives = 83/200 (41%), Gaps = 24/200 (12%)

Query: 108 FYNDLFVYSLDT-----DTWKRYTSQN-SPMPRSSAAVASHPTGVALIHGGEFSSPKQNT 161
           ++NDL V+ L +      +W+  T  + +P P ++ A+ S+   +  + GG+  +P+   
Sbjct: 228 YFNDLAVFDLSSFRRPDSSWQFITPNSFTPPPLTNHAMISYDYKL-WVFGGD--TPQG-- 282

Query: 162 FYHYSDSWLFDCSSKEWTKVEQKNG--PSARSGHRMAIWKNFIILHGGFRDLGTSTTYLN 219
                D ++FD    +W K  Q  G  P     H   ++ + + + GG  +      Y N
Sbjct: 283 --LIDDVFVFDPQVNDW-KFIQTTGQKPPPLQEHASVLYGDLMCIVGGKDE---QDVYSN 336

Query: 220 DLWVFDITNYKWKQVELPANHPIPDARSGHSLISTAEGAVLYGGYTKVKAGKG----LQK 275
            ++  ++ + KW +        IP  RSGHSL       +L  G  K    +G       
Sbjct: 337 GVYFLNLISLKWFKFPF-FRAGIPQGRSGHSLTLLPNHKLLIMGGDKFDYARGGDDDFHT 395

Query: 276 GKILSDCWYLKMKSDLGSIR 295
            ++   C  L    DL  +R
Sbjct: 396 SEVDMACGTLLYTLDLSKLR 415

>CAGL0F07997g Chr6 complement(785803..788613) [2811 bp, 936 aa] {ON}
           weakly similar to uniprot|P50090 Saccharomyces
           cerevisiae YGR238c KEL2 or uniprot|P38853 Saccharomyces
           cerevisiae YHR158c KEL1
          Length = 936

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 59/268 (22%), Positives = 113/268 (42%), Gaps = 47/268 (17%)

Query: 108 FYNDLFVYSLDTDTWKRYTSQ------NSPMPRSSAAVASHPTGVALIHGGEFSSPKQNT 161
            Y D ++ + ++D+   +T+Q      N+P PR   A A+      +I GG+        
Sbjct: 200 VYGDTWMLTANSDSTN-FTTQVIDLTVNTPPPRVGHA-ATLCGNALVIFGGDTHKLNSEG 257

Query: 162 FYHYSDSWLFDCSSKEWT-KVEQKNGPSARSGHRMAIW-----KNFIILHGGFRDLGTST 215
                D +LF+  S  WT        P  R GH++++      K  + L GG  D     
Sbjct: 258 LLD-DDLYLFNVDSHRWTIPTPIGTRPLGRYGHQVSVIATTPKKAKLYLFGGQLD----D 312

Query: 216 TYLNDLWVFDITNYK-----WKQVELPANHPIPDARSGHSLISTAEGAVLYGGYTKVKAG 270
            Y NDL ++D+++++     W+ ++  A  P P   + H++++      ++GG ++ +  
Sbjct: 313 NYFNDLAMYDLSDFRNPHSRWQFLKSKAFTPPP--LTNHTMVAYDYKLWVFGGSSRGE-- 368

Query: 271 KGLQKGKILSDCWYLKMKSDLGSIRWERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDF 330
                   L +  Y+ +  DL    W   + +G +P P    S   +K    +FGG    
Sbjct: 369 --------LQNQLYVYI-PDLN--EWRCLETEGDKPQPIQEHSATIYKNLMCVFGGKNKD 417

Query: 331 EETEESLRSIFYNELYTYQIENNRWYAM 358
           +E        + N +Y   ++  +WY +
Sbjct: 418 DE--------YQNTMYFLNLQTLKWYRL 437

>TBLA0A04320 Chr1 (1068199..1070715) [2517 bp, 838 aa] {ON} Anc_7.9
           YAL056W
          Length = 838

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 43/100 (43%), Gaps = 10/100 (10%)

Query: 170 LFDCSSKEWTKVEQKNGPSARSGHRMAIWKNFIILHGGFRDLGTSTTYLNDLWVFDITNY 229
           LF   S + TK    +GP  +         + +++HGG      +T   +D+W FD    
Sbjct: 627 LFPIGSPKSTKSNGPSGPVLQLHINETSEGHTLVMHGG----SNATHIYSDMWWFDFETE 682

Query: 230 KWKQVELPANH------PIPDARSGHSLISTAEGAVLYGG 263
            W Q+E  A        PI  A +GHS+ +    ++  GG
Sbjct: 683 SWVQIETQAQTEDKGLVPIEMALAGHSMATVGSASIFVGG 722

 Score = 32.3 bits (72), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 32/80 (40%), Gaps = 15/80 (18%)

Query: 148 LIHGGEFSSPKQNTFYHYSDSWLFDCSSKEWTKVEQKNGPS---------ARSGHRMAIW 198
           ++HGG       N  + YSD W FD  ++ W ++E +             A +GH MA  
Sbjct: 660 VMHGG------SNATHIYSDMWWFDFETESWVQIETQAQTEDKGLVPIEMALAGHSMATV 713

Query: 199 KNFIILHGGFRDLGTSTTYL 218
            +  I  GG         YL
Sbjct: 714 GSASIFVGGMMQSDVDKLYL 733

>ADL149W Chr4 (427096..430731) [3636 bp, 1211 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR158C (KEL1) and
           YGR238C (KEL2)
          Length = 1211

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 54/245 (22%), Positives = 101/245 (41%), Gaps = 44/245 (17%)

Query: 127 SQNSPMPRSSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWLFDCSSKEWTKVEQKNG 186
           ++ +P PR   A      G A +  G  +    N      D +L + +S +WT +    G
Sbjct: 114 TETTPPPRVGHAATL--CGNAFVIFGGDTHKTNNEGLMDDDVYLLNVNSHKWT-IPHPVG 170

Query: 187 PS--ARSGHRMAIWKN------FIILHGGFRDLGTSTTYLNDLWVFDITNYK-----WKQ 233
           P    R GH+++I           +  G F D     TY NDL V+D+++++     W  
Sbjct: 171 PRPLGRYGHKISIIATSQMKTKLYVFGGQFDD-----TYFNDLAVYDLSSFRRPDSHWVF 225

Query: 234 VELPANHPIPDARSGHSLISTAEGAVLYGGYTKVKAGKGLQKGKILSDCWYLKMKSDLGS 293
           V+ PA+  +P   + H+++S      ++GG T         +G I     Y  + +D   
Sbjct: 226 VK-PASF-VPPPLTNHTMVSYDYKLWVFGGDTP--------QGLINELFVYDPVVND--- 272

Query: 294 IRWERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRSIFYNELYTYQIENN 353
             W   +  G++P P    + V ++    + GG  D +         +  ++Y   ++  
Sbjct: 273 --WSVVETTGAKPPPLQEHAAVLYRDLMCVVGGKDDQDN--------YSQDVYFMNMKTF 322

Query: 354 RWYAM 358
           RW+ +
Sbjct: 323 RWFKL 327

 Score = 35.8 bits (81), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 45/100 (45%), Gaps = 7/100 (7%)

Query: 169 WLFDCSSKEWTKVEQKNG-PSARSGHRMAIWKNFIILHGGFRDLGTSTTYLNDLWVFDIT 227
           +++D    +W+ VE     P     H   ++++ + + GG  D      Y  D++  ++ 
Sbjct: 264 FVYDPVVNDWSVVETTGAKPPPLQEHAAVLYRDLMCVVGGKDD---QDNYSQDVYFMNMK 320

Query: 228 NYKWKQVELPA-NHPIPDARSGHSLISTAEGAVLYGGYTK 266
            ++W   +LP     +P  RSGHS+   A   +L  G  K
Sbjct: 321 TFRW--FKLPHFQDMVPSPRSGHSVTLLANRKLLIMGGDK 358

>ZYRO0C00550g Chr3 (39312..41858) [2547 bp, 848 aa] {ON} similar to
           uniprot|Q08886 Saccharomyces cerevisiae YOR371C GPB1
           Proposed beta subunit of the heterotrimeric G protein
           that interacts with the receptor Grp1p has signaling
           role in response to nutrients involved in regulation of
           pseudohyphal growth through cAMP levels homolog of Gpb2p
          Length = 848

 Score = 39.3 bits (90), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 62/169 (36%), Gaps = 38/169 (22%)

Query: 202 IILHGGFRDLGTSTTYLNDLWVFDITNYKWKQVELPANH------PIPDARSGHSLISTA 255
           +I+HGG       T    D+W +DI    W Q+     H      PI     GHSL+   
Sbjct: 671 LIMHGG----SNKTDVCRDMWWYDIETETWSQITTHGKHEASKMIPIGVGLVGHSLVCVG 726

Query: 256 EGAVLYGG--------------YTKVKAGKGLQKGKILSDCWYLKMKSDLGS-------- 293
             AV  GG              Y  ++    L  G    + + L  +  LG         
Sbjct: 727 GMAVFVGGLLQEDVDFLYHGVDYEDMRIPPQLAIGSDFINLFDLATQCLLGHTVIGDETN 786

Query: 294 --IRWERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYD--FEETEESLR 338
             +R +   + G   S   G +++   G  +LFGGV    FE +  +LR
Sbjct: 787 AYLRDDLEARLGVILS--CGFTVIQFNGDILLFGGVVSRRFETSGLNLR 833

>Ecym_2061 Chr2 (99788..103876) [4089 bp, 1362 aa] {ON} similar to
           Ashbya gossypii ADL149W
          Length = 1362

 Score = 38.9 bits (89), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 43/189 (22%), Positives = 73/189 (38%), Gaps = 35/189 (18%)

Query: 178 WTKVEQKNGPSARSGHRMAIW---KNFIILHGGFRDLGTSTTYLNDLWVF----DITNYK 230
           W +V+    P  R  H  + +    N + + GG  D     +   D W+     +   + 
Sbjct: 158 WNRVKLLQSPFPRYRHVASSYASDSNEVFVIGGLHD----QSVYGDTWIIKSHENGNKFT 213

Query: 231 WKQVELPANHPIPDARSGHSLISTAEGAVLYGGYTKVKAGKGLQKGKILSDCWYLKMKSD 290
            K VE+    P P  R GH+        V++GG T     +GL     + D  YL    +
Sbjct: 214 SKTVEITETTPPP--RVGHASTLCGNAFVIFGGDTHKTNAEGL-----MDDDVYLL---N 263

Query: 291 LGSIRWERRKKQGSQPSPRVG-----CSMVHHKGRGVLFGGVYDFEETEESLRSIFYNEL 345
           + S +W   +  G +P  R G      +    K +  +FGG +D           ++N+L
Sbjct: 264 INSHKWTIPRPVGPRPLGRYGHKISIIATSQMKTKLYVFGGQFD---------DTYFNDL 314

Query: 346 YTYQIENNR 354
             Y + + R
Sbjct: 315 AVYDLSSFR 323

 Score = 38.9 bits (89), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 52/227 (22%), Positives = 94/227 (41%), Gaps = 46/227 (20%)

Query: 167 DSWLFDCSSKEWTKVEQKNGPS--ARSGHRMAIWKN------FIILHGGFRDLGTSTTYL 218
           D +L + +S +WT + +  GP    R GH+++I           +  G F D     TY 
Sbjct: 258 DVYLLNINSHKWT-IPRPVGPRPLGRYGHKISIIATSQMKTKLYVFGGQFDD-----TYF 311

Query: 219 NDLWVFDITNYK-----WKQVELPANHPIPDARSGHSLISTAEGAVLYGGYTKVKAGKGL 273
           NDL V+D+++++     W Q   P +  +P   + H+++S      ++GG T        
Sbjct: 312 NDLAVYDLSSFRRPDSHW-QFLKPVSF-VPPPLTNHTMVSYDYKLWVFGGDTP------- 362

Query: 274 QKGKILSDCWYLKMKSDLGSIRWERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEET 333
            +G I     Y    +D     W      G +P P    + + +K    + GG  D +  
Sbjct: 363 -QGLINELFMYDPTTND-----WSVVDTTGVKPPPLQEHAALLYKDLMCIVGGKDDQDN- 415

Query: 334 EESLRSIFYNELYTYQIENNRWYAM----SLRPQRKKKNFVQSKSNR 376
                  +  E+Y   +++ RW+ +    SL P  +  + V   SN+
Sbjct: 416 -------YSQEVYFLNLKSFRWFKLPHFRSLVPSPRSGHSVTLLSNK 455

>KAFR0C04910 Chr3 (975629..978265) [2637 bp, 878 aa] {ON} Anc_7.9
           YAL056W
          Length = 878

 Score = 38.5 bits (88), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 37/76 (48%), Gaps = 12/76 (15%)

Query: 202 IILHGGFRDLGTSTTYLNDLWVFDITNYKWKQVEL---PANH-----PIPDARSGHSLIS 253
           I+LHGG  D    T    D+W FD+  ++W +V     P +      PI     GH++++
Sbjct: 696 IVLHGGSDD----TNVYGDMWWFDLETFQWTKVATYIKPKDQDSSLVPINIKIVGHTMMT 751

Query: 254 TAEGAVLYGGYTKVKA 269
           +   AV  GG T+ + 
Sbjct: 752 SGCMAVCVGGITQAEV 767

>TPHA0H00290 Chr8 (48215..52654) [4440 bp, 1479 aa] {ON} Anc_8.157
           YGL197W
          Length = 1479

 Score = 38.1 bits (87), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 24/115 (20%), Positives = 52/115 (45%), Gaps = 12/115 (10%)

Query: 192 GHRMAIWKNFIILHGGF-------RDLGTSTTYLNDLWVFDITNYKWKQV-ELPANHPIP 243
           G    ++++ II+HGG         D      + N++++ D+ + KW+ + ++      P
Sbjct: 26  GAASTLFRSSIIMHGGIIAAEDNDGDGDDDALFDNNMYMLDLISRKWRVLDQIDTATAAP 85

Query: 244 DARSGHSLISTAEGAVLYGGYTKVKAGKGLQKGKILSDCWYLKMKSDLGSIRWER 298
            +R  HS++        +GG TK    +   +  I ++ W L+  S    + W++
Sbjct: 86  RSRCRHSIVGCGSSFFFFGGITK---HQTTNENIITNELWELQF-SATNKVSWKK 136

>KAFR0I00200 Chr9 (39428..41689) [2262 bp, 753 aa] {ON} Anc_7.9
           YAL056W
          Length = 753

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 32/67 (47%), Gaps = 9/67 (13%)

Query: 202 IILHGGFRDLGTSTTYLNDLWVFDITNYKWKQVELPAN-----HPIPDARSGHSLISTAE 256
           II+HGG  +         DLW FD+ +  W ++++ A       P+     GH++++   
Sbjct: 647 IIIHGGSNNFDV----FGDLWWFDLESLTWNKLDISAKINGTLQPVELKLVGHTMVNIGH 702

Query: 257 GAVLYGG 263
            A+  GG
Sbjct: 703 VAIFSGG 709

>TDEL0A00340 Chr1 (58839..60872) [2034 bp, 677 aa] {ON} Anc_3.15
           YOL141W
          Length = 677

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 44/101 (43%), Gaps = 12/101 (11%)

Query: 110 NDLFVYSLDTDTWKRYTSQNSPMPRSSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSW 169
           N+L    +DT  +    +  +P  R    + S  +    +  G   SPK      Y+D+W
Sbjct: 400 NELIEVDVDTGNYIPLDTGEAPPVRMCHTLTSLGSSQEFMMIGGRQSPKDG----YTDTW 455

Query: 170 LFDCSSKEWTKVEQKNGPS---ARSGHRMAIWKNFIILHGG 207
           +F+  S  W     + GPS   +R  H   + +N I++ GG
Sbjct: 456 VFNMGSNLW-----RQGPSLPESRYRHAACLIENQILVFGG 491

>Kpol_538.45 s538 complement(101351..103897) [2547 bp, 848 aa] {ON}
           complement(101351..103897) [2547 nt, 849 aa]
          Length = 848

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 68/175 (38%), Gaps = 41/175 (23%)

Query: 201 FIILHGGFRDLGTSTTYLNDLWVFDITNYKWKQVELPANHPIPD-------ARSGHSLIS 253
            +I+HGG       T  + D+W+F+ T   W+       +P  D          GH+L  
Sbjct: 665 ILIIHGG----SDHTNVIGDMWLFNFTKETWEHEHFLIKNPQEDRYKAIDIPLVGHTLTF 720

Query: 254 TAEGAVLYGGYTK------------VKAG---KGLQKGKILSDCWYLK--------MKSD 290
               AV +GG T+             K G   +GL  G  L +   LK        +K  
Sbjct: 721 IGYSAVSFGGLTQDDINSVYNLGDEAKVGGDHEGLALGSNLVNYINLKTFQLESKELKLV 780

Query: 291 LGSIRWE--RRKKQGSQPSP-RVGCSMVHHKGRGVLFGGVYDFEETEESLRSIFY 342
            G+  ++  R K   ++ +   +GC +  + G  +L GGV      E S  S FY
Sbjct: 781 AGTDEYKLVRDKTVNARSTVLAIGCIVAMNNGSYLLIGGVL----AERSKLSKFY 831

>NCAS0A07640 Chr1 complement(1521774..1524515) [2742 bp, 913 aa]
           {ON} Anc_7.9 YAL056W
          Length = 913

 Score = 35.4 bits (80), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 36/86 (41%), Gaps = 17/86 (19%)

Query: 146 VALIHGGEFSSPKQNTFYHYSDSWLFDCSSKEWTKVEQ-----------KNGPSARSGHR 194
           + +IHGG       N    Y D W FD   ++WTK++             N   A  GH 
Sbjct: 728 MIIIHGG------SNDHKVYGDMWWFDVEMEKWTKIDMYAETNDAKEGLVNCDLALVGHT 781

Query: 195 MAIWKNFIILHGGFRDLGTSTTYLND 220
           MAI  ++ I  GG       T ++++
Sbjct: 782 MAIIGHYAISVGGLIQQDVDTLFISE 807

>Kwal_55.20756 s55 (545793..550520) [4728 bp, 1575 aa] {ON} YGL197W
           (MDS3) - 1:1 [contig 139] FULL
          Length = 1575

 Score = 35.0 bits (79), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 38/87 (43%), Gaps = 16/87 (18%)

Query: 290 DLGSIRWER--------------RKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEE 335
           DL + +WER               +K  +    RV  SM  H GR  LFGG+    +++ 
Sbjct: 105 DLITCKWERVCIDEGMSSMAESPEQKPNAVMKKRVFHSMCFHDGRLYLFGGLVVSPQSDY 164

Query: 336 SLRSIFYNELYTYQIENNRWYAMSLRP 362
            L  I  NEL++  +E   W  +S  P
Sbjct: 165 EL--IASNELWSLDLETKTWLQLSSDP 189

>ADR414C Chr4 complement(1450330..1452684) [2355 bp, 784 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YAL056W
           (KRH1) and YOR371C (KRH2)
          Length = 784

 Score = 34.7 bits (78), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 35/72 (48%), Gaps = 11/72 (15%)

Query: 202 IILHGGFRDLGTSTTYLNDLWVFDITNYKWKQVELPANHPIPDARS-------GHSLIST 254
           +I+HGG       +    D+W FD+ + +W ++ L +  P    R        GHS+  +
Sbjct: 611 VIIHGG----SDGSRVYGDMWWFDLADERWSRIALYSRDPDSGERRPIGLPAVGHSIFHS 666

Query: 255 AEGAVLYGGYTK 266
            +  +LYGG ++
Sbjct: 667 RDEFLLYGGLSQ 678

>TPHA0N00440 Chr14 complement(82249..84522) [2274 bp, 757 aa] {ON}
           Anc_7.56 YOR337W
          Length = 757

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 51/122 (41%), Gaps = 18/122 (14%)

Query: 211 LGTSTTYLNDLWVFDITNYKWKQVELPANHPIPDARSGHSLISTAEGAVLYGGYTKVKAG 270
           +G+STT        DIT    + V+L    PI  ++S   ++   E   L   Y  V+  
Sbjct: 164 VGSSTT--------DIT----RTVKLEETDPILRSKSDTEIV---EKTSLDQTYHNVRKK 208

Query: 271 KGLQKGKILSD---CWYLKMKSDLGSIRWERRKKQGSQPSPRVGCSMVHHKGRGVLFGGV 327
           K L KG +  +    +  K+KS   +I +   +K  S  SP +      H     LF G+
Sbjct: 209 KALVKGSLYPEGPVSYKPKIKSTNLTISFLVSEKNSSANSPNIDIGTQEHHSNSSLFNGL 268

Query: 328 YD 329
            D
Sbjct: 269 SD 270

>KNAG0E04180 Chr5 complement(833612..836071) [2460 bp, 819 aa] {ON} 
          Length = 819

 Score = 33.1 bits (74), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 5/62 (8%)

Query: 175 SKEWTKVEQKNGPSARSGHRMAIWKNFIILHGGFRDLGTSTTYLNDLWVFDITNYKWKQV 234
           S ++   + K G  A S       ++FII HGG      +     DLW FD+   KW+++
Sbjct: 601 SSDFKPADDKYGCVANSTPSKTCKRSFII-HGG----SNNAKVYGDLWWFDLQKLKWEKI 655

Query: 235 EL 236
           EL
Sbjct: 656 EL 657

>KLTH0E06380g Chr5 (580587..585320) [4734 bp, 1577 aa] {ON} similar
           to uniprot|P53094 Saccharomyces cerevisiae YGL197W MDS3
           Protein with an N-terminal kelch- like domain putative
           negative regulator of early meiotic gene expression
           required with Pmd1p for growth under alkaline conditions
          Length = 1577

 Score = 33.1 bits (74), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 47/104 (45%), Gaps = 20/104 (19%)

Query: 278 ILSDCWYLKMKSDLGSIRWERR-KKQGSQP-------------SPRVGCSMVHHKGRGVL 323
           I ++ ++L    DL S  WER   ++G+ P               RV  S+ HH G   +
Sbjct: 97  ISTETFFL----DLISRTWERVITEEGTSPIVEGSENNKSAVMRERVFHSICHHDGHLYI 152

Query: 324 FGGVYDFEETEESLRSIFYNELYTYQIENNRWYAMSLRPQRKKK 367
           FGG+    +++  L  I  NEL++  +E   W  +S  P   ++
Sbjct: 153 FGGLVVSSQSDYEL--IASNELWSLDLETKTWLRLSSDPSITRR 194

>YOR371C Chr15 complement(1031489..1034182) [2694 bp, 897 aa] {ON}
           GPB1Multistep regulator of cAMP-PKA signaling; inhibits
           PKA downstream of Gpa2p and Cyr1p, thereby increasing
           cAMP dependency; promotes ubiquitin-dependent
           proteolysis of Ira2p; regulated by G-alpha protein
           Gpa2p; homolog of Gpb2p
          Length = 897

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 33/88 (37%), Gaps = 12/88 (13%)

Query: 184 KNGPSARSGHRMAIWKNFIILHGGFRDLGTSTTYLNDLWVFDITNYKWKQVELPANH--- 240
           K+ P      + A     I  HGG           +D+W FD  +  W +++L A     
Sbjct: 698 KHTPPLNPSKKCASIGRTIAFHGG----SDGYDVCSDMWWFDFDSETWTKIDLYAKTQEE 753

Query: 241 -----PIPDARSGHSLISTAEGAVLYGG 263
                PI     GHS+ +     VL GG
Sbjct: 754 SDGLVPINLCMVGHSMTTVGHKVVLIGG 781

>NCAS0I00340 Chr9 complement(45659..48235) [2577 bp, 858 aa] {ON}
           Anc_7.9 YAL056W
          Length = 858

 Score = 31.6 bits (70), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 35/80 (43%), Gaps = 10/80 (12%)

Query: 198 WKNFIILHGGFRDLGTSTTYLNDLWVFDITNYKWKQVEL------PANHPIPDARSGHSL 251
           +   I+LHGG      +     D+W F++T  +W +VE        A  P+     GH++
Sbjct: 672 FPQIIVLHGG----SNNREVYGDMWWFNVTEERWTKVETYVEQAGEALVPMEMKLVGHTM 727

Query: 252 ISTAEGAVLYGGYTKVKAGK 271
           ++  +     GG T+    K
Sbjct: 728 VTAGKMIGTVGGLTQDDVNK 747

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,492,325
Number of extensions: 2537058
Number of successful extensions: 9863
Number of sequences better than 10.0: 85
Number of HSP's gapped: 9748
Number of HSP's successfully gapped: 142
Length of query: 640
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 524
Effective length of database: 40,180,143
Effective search space: 21054394932
Effective search space used: 21054394932
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)