Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D00814g6.9ON40840821930.0
SAKL0E00814g6.9ON39840712361e-169
KLTH0C11550g6.9ON39840712211e-167
NCAS0F001906.9ON41139911881e-161
Ecym_30126.9ON39739311811e-161
TDEL0G046206.9ON39239111741e-160
ZYRO0F00462g6.9ON39339011731e-159
NDAI0K029006.9ON43839311731e-159
ACR017W6.9ON42340011531e-156
Kpol_1045.786.9ON39240111481e-156
KNAG0E009806.9ON41439711441e-155
Suva_5.126.9ON40140111421e-155
Skud_5.336.9ON40139511281e-152
YEL056W (HAT2)6.9ON40140111251e-152
Smik_5.316.9ON42740211271e-152
Kwal_56.223456.9ON39640311191e-151
TPHA0M001906.9ON39141011121e-150
KAFR0L003206.9ON39139310661e-143
CAGL0B03575g6.9ON41940010411e-139
TBLA0A071206.9ON4074019961e-132
Kpol_1024.398.548ON4174374141e-45
TBLA0H036508.548ON4194353983e-43
AEL250C8.548ON4174263949e-43
Ecym_70428.548ON4144143842e-41
NDAI0C055108.548ON4194333816e-41
Suva_4.4498.548ON4244383731e-39
Smik_2.3358.548ON4224413694e-39
Skud_2.3218.548ON4224323677e-39
TPHA0L017208.548ON4194173678e-39
KLLA0E23541g8.548ON4174223661e-38
YBR195C (MSI1)8.548ON4224343661e-38
ZYRO0A13068g8.548ON3974103632e-38
KAFR0I008408.548ON4134263598e-38
KLTH0E12694g8.548ON4184233562e-37
SAKL0H09900g8.548ON4254173563e-37
Kwal_27.120708.548ON4184203544e-37
TDEL0B029808.548ON4124283441e-35
CAGL0M05291g8.548ON4194243441e-35
NCAS0B021708.548ON4144393388e-35
KNAG0A036708.548ON4264473344e-34
ZYRO0A08690g2.401ON5164101837e-14
KAFR0A003802.401ON5164071773e-13
Suva_13.3112.401ON5102841702e-12
CAGL0K03861g2.401ON5134111693e-12
TDEL0G033402.401ON5143481668e-12
KLLA0F17237g2.401ON5233481632e-11
TBLA0B092502.401ON5262201632e-11
Kpol_1041.202.401ON5154001623e-11
Sklu_YGOB_Anc_2.4012.401ON5203461613e-11
ADR242C2.401ON5213391613e-11
Skud_13.2912.401ON5093491614e-11
Smik_13.3292.401ON5092231605e-11
Ecym_60672.401ON5222291605e-11
Skud_4.637.310ON12732121581e-10
Smik_4.457.310ON12702121572e-10
Suva_3.936.325ON9202001572e-10
Smik_3.1576.325ON9242001572e-10
Skud_3.1336.325ON9162001562e-10
YMR131C (RRB1)2.401ON5111871552e-10
KNAG0E021802.401ON5173371552e-10
Kwal_47.178272.401ON5233371542e-10
TBLA0D055601.247ON5892651542e-10
CAGL0D05588g5.201ON4772451543e-10
NCAS0F019702.401ON5112201543e-10
YCR057C (PWP2)6.325ON9232001543e-10
NDAI0H027502.401ON5122211533e-10
Suva_4.537.310ON12711881544e-10
KLTH0B03410g5.201ON4771271524e-10
KLTH0G10296g2.283ON4261921515e-10
TPHA0G026502.401ON5163361516e-10
YDL195W (SEC31)7.310ON12732121526e-10
Kwal_33.151365.201ON4731711499e-10
AEL269C7.534ON4552091499e-10
NDAI0B051901.247ON6682831491e-09
Kwal_56.236858.288ON11021551501e-09
SAKL0A01738g6.325ON9091961482e-09
KLTH0E09394g2.401ON5223401472e-09
NCAS0G011206.276ON4943271472e-09
KLLA0F15598g5.201ON4782411462e-09
KLLA0F19734g8.288ON11331571472e-09
AAR057W6.325ON9221941463e-09
Ecym_20936.325ON9231931463e-09
CAGL0C03608g6.363ON6432181454e-09
KLLA0C08976g6.325ON9111901454e-09
KNAG0I025406.325ON9182001445e-09
NCAS0E037507.310ON12762131446e-09
KLLA0E08449g2.283ON4221761426e-09
ADR090W7.310ON12332101437e-09
TPHA0E030805.201ON4882421427e-09
NCAS0D044806.325ON9151931438e-09
TBLA0I022806.325ON9271941438e-09
Kpol_1036.658.316ON3712311409e-09
NDAI0I004606.325ON9172001421e-08
AAL157C5.201ON4791381411e-08
KLLA0E19515g7.356ON5721721411e-08
Kpol_1019.307.310ON12522151411e-08
KAFR0J025506.325ON9062001411e-08
KNAG0I028406.340ON5192461401e-08
TDEL0E042805.201ON4811281392e-08
Kpol_1028.546.325ON9051881402e-08
KAFR0H033402.283ON3672101382e-08
KLLA0E21187g5.429ON4291941382e-08
Ecym_71055.201ON4841881382e-08
Suva_10.645.201ON4901331382e-08
KLTH0G13068g8.288ON11011551383e-08
Smik_12.525.201ON4891331373e-08
TPHA0D038306.325ON9121781383e-08
Kpol_2002.995.201ON4871381364e-08
TDEL0C023607.310ON12642141374e-08
NCAS0D046106.340ON5151641355e-08
TBLA0C050107.356ON5721731355e-08
SAKL0F10384g7.310ON12612111366e-08
NDAI0I003506.340ON5151681356e-08
Kwal_56.244787.310ON12962101366e-08
Ecym_80617.310ON12282091357e-08
YLL011W (SOF1)5.201ON4891331347e-08
NCAS0D027305.201ON4752421347e-08
KLLA0E07085g3.25ON4522201337e-08
Kpol_1060.246.276ON4861731347e-08
Skud_12.565.201ON4891421348e-08
ZYRO0B10450g5.201ON4822411338e-08
SAKL0G12892g5.201ON4762461331e-07
Kwal_23.63246.340ON5141681321e-07
SAKL0E07766g2.283ON3981751311e-07
Kwal_55.220673.25ON4512371311e-07
NCAS0B036908.288ON11451381322e-07
KAFR0E012303.259ON3692331302e-07
Kwal_14.17106.135ON5742361312e-07
KAFR0J009805.201ON4801281302e-07
TBLA0F021407.310ON13002081312e-07
TBLA0H020005.201ON4731391293e-07
TDEL0A074006.325ON9011851303e-07
KNAG0M017505.201ON4851351283e-07
Suva_11.2681.247ON6452331293e-07
Ecym_21396.276ON4352651283e-07
TPHA0M018306.340ON5151831283e-07
Skud_3.1456.340ON5152501283e-07
KNAG0H020402.283ON3991991274e-07
NDAI0I021805.201ON4791281284e-07
Suva_3.1096.340ON5152501284e-07
SAKL0F11506g7.356ON5681711284e-07
YNL317W (PFS2)3.25ON4652161274e-07
KLTH0F19294g3.25ON4512371275e-07
Smik_3.1726.340ON5152491275e-07
NDAI0J010408.316ON3982061275e-07
KLTH0A06754g6.340ON5142441276e-07
KNAG0B025807.356ON5801681276e-07
YCR072C (RSA4)6.340ON5152501266e-07
Kpol_1048.598.544ON8502331276e-07
Smik_6.4516.276ON5233331267e-07
KNAG0B028007.310ON13072251277e-07
ZYRO0D08206g6.340ON5151771268e-07
NCAS0G038702.283ON3892061258e-07
Suva_16.1598.672ON4511571258e-07
SAKL0A00660g6.363ON6602171268e-07
Kpol_1028.416.340ON5122441258e-07
KAFR0F043506.340ON5151711258e-07
CAGL0B01529g8.316ON3692481248e-07
ZYRO0F05808g7.310ON12822111269e-07
YPL247C6.276ON5233021259e-07
TDEL0A075506.340ON5152441251e-06
YNL035C2.283ON3891841241e-06
SAKL0H16390g8.288ON11401401251e-06
SAKL0A01276g6.340ON5151701241e-06
CAGL0K09284g6.325ON9111731251e-06
TDEL0A068906.276ON4472061231e-06
Suva_14.223.25ON4692161231e-06
TBLA0F041306.340ON5142441231e-06
TPHA0C033702.283ON4131961222e-06
KAFR0L015207.356ON5841721232e-06
Skud_16.1318.672ON4511571222e-06
AAR078W7.356ON5621831222e-06
TPHA0P014903.25ON4592851222e-06
YPL151C (PRP46)8.672ON4511581212e-06
CAGL0G01628g2.283ON3761671212e-06
ZYRO0E08184g6.276ON5063531213e-06
TDEL0H003707.534ON4652181213e-06
KLLA0F05159g7.310ON12312091213e-06
KAFR0L013207.310ON12402101214e-06
KNAG0I010508.288ON11591501214e-06
Suva_16.606.276ON5263761204e-06
Smik_6.3488.672ON4511571194e-06
NDAI0G006302.283ON3972061194e-06
Skud_14.2982.283ON3891831194e-06
Kpol_530.257.356ON5741721194e-06
Suva_14.3112.283ON3891731194e-06
Ecym_28087.534ON4651721195e-06
KAFR0A064804.122ON5681691195e-06
NDAI0F012406.276ON5241721195e-06
TPHA0D035906.276ON5983461195e-06
Kwal_23.62406.325ON9131691195e-06
KLLA0A08822g4.122ON582641196e-06
Smik_14.2962.283ON3891851176e-06
KAFR0A033801.247ON6661961196e-06
NCAS0F033405.429ON4481691187e-06
CAGL0L03201g1.247ON5791721187e-06
CAGL0H00781g6.276ON5131851187e-06
Ecym_42808.288ON11321521187e-06
KLTH0A06380g6.325ON9151691188e-06
SAKL0H06666g8.672ON4411641178e-06
Ecym_24986.340ON5422441178e-06
CAGL0J03476g6.340ON5171641178e-06
YCR084C (TUP1)6.363ON7132171178e-06
KLTH0H02134g7.310ON12992091189e-06
AFR199C2.431ON3341791159e-06
TBLA0A023106.276ON5313161171e-05
KLTH0A07282g6.363ON7252171171e-05
ZYRO0D08558g6.325ON9121851171e-05
KLTH0B01628g5.139ON7902051171e-05
KNAG0J016808.672ON3981581161e-05
Ecym_33212.283ON4092421161e-05
KLTH0E08162g4.122ON556641161e-05
KLLA0F21406g1.247ON7052041161e-05
SAKL0C13266g3.25ON4592371151e-05
NCAS0D047806.363ON6211591161e-05
Skud_16.326.276ON5223151161e-05
Skud_3.1566.363ON7132171161e-05
TBLA0H036208.544ON8121801161e-05
ZYRO0A09636g8.435ON8081491161e-05
Kpol_1014.193.25ON4521501151e-05
SAKL0A02970g6.276ON4152461151e-05
SAKL0H15708g8.316ON3682361141e-05
Kpol_1038.203.22ON1313921162e-05
ADL184W3.25ON4492211152e-05
Kpol_1061.63.259ON4511331142e-05
NCAS0G036001.399ON3272001142e-05
KAFR0E039005.429ON4391971142e-05
Suva_3.1216.363ON7002171152e-05
CAGL0A00605g4.122ON6401441152e-05
Ecym_47177.356ON6031761152e-05
ZYRO0A03234g3.259ON4131931142e-05
Kwal_23.64296.363ON7502061152e-05
Skud_7.5365.139ON7882471152e-05
KNAG0H016901.399ON3032001122e-05
TBLA0B059202.283ON4031701132e-05
KAFR0H024508.672ON4171581132e-05
ZYRO0B02486g7.356ON5751721142e-05
AGL234W6.363ON6291611142e-05
AER263C6.340ON5131681132e-05
Kwal_27.115502.283ON4072031133e-05
CAGL0A04037g7.356ON5831741133e-05
TDEL0D013101.247ON7091721133e-05
AFL157C6.276ON4382201133e-05
ZYRO0C03124g3.25ON4452871133e-05
Ecym_70284.309ON6252261133e-05
TPHA0A003803.22ON13102491143e-05
Ecym_25236.363ON6461611133e-05
TPHA0C008608.316ON3782261123e-05
Smik_3.1836.363ON7091561133e-05
KLTH0H06160g6.135ON5742331133e-05
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D00814g
         (408 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON...   849   0.0  
SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON...   480   e-169
KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} simila...   474   e-167
NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}...   462   e-161
Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON} s...   459   e-161
TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9...   456   e-160
ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON...   456   e-159
NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9     456   e-159
ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic ho...   448   e-156
Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON} (1830...   446   e-156
KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {O...   445   e-155
Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)   444   e-155
Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)   439   e-152
YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit ...   437   e-152
Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)   438   e-152
Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON...   435   e-151
TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON...   432   e-150
KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9 ...   415   e-143
CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {...   405   e-139
TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa] ...   388   e-132
Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa] ...   164   1e-45
TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.5...   157   3e-43
AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON} S...   156   9e-43
Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to ...   152   2e-41
NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON} Anc_8...   151   6e-41
Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON...   148   1e-39
Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON...   146   4e-39
Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON...   145   7e-39
TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8....   145   8e-39
KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} simi...   145   1e-38
YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}  ...   145   1e-38
ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} simi...   144   2e-38
KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {O...   142   8e-38
KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} simi...   141   2e-37
SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {...   141   3e-37
Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR1...   140   4e-37
TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {O...   137   1e-35
CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa] ...   137   1e-35
NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {O...   134   8e-35
KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {O...   133   4e-34
ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly...    75   7e-14
KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401...    73   3e-13
Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {...    70   2e-12
CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa] ...    70   3e-12
TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.4...    69   8e-12
KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} high...    67   2e-11
TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON} Anc_2...    67   2e-11
Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {O...    67   3e-11
Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 52...    67   3e-11
ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}...    67   3e-11
Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {...    67   4e-11
Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {...    66   5e-11
Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar t...    66   5e-11
Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W ...    65   1e-10
Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W (R...    65   2e-10
Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}...    65   2e-10
Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON...    65   2e-10
Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON...    65   2e-10
YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON} ...    64   2e-10
KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.4...    64   2e-10
Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {...    64   2e-10
TBLA0D05560 Chr4 complement(1366222..1367991) [1770 bp, 589 aa] ...    64   2e-10
CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly...    64   3e-10
NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {O...    64   3e-10
YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}  ...    64   3e-10
NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.4...    64   3e-10
Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W (R...    64   4e-10
KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {...    63   4e-10
KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {...    63   5e-10
TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.4...    63   6e-10
YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}  SEC31Comp...    63   6e-10
Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011...    62   9e-10
AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON} S...    62   9e-10
NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa] ...    62   1e-09
Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] ...    62   1e-09
SAKL0A01738g Chr1 (157360..160089) [2730 bp, 909 aa] {ON} highly...    62   2e-09
KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {...    61   2e-09
NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {O...    61   2e-09
KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} high...    61   2e-09
KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON} sim...    61   2e-09
AAR057W Chr1 (442821..445589) [2769 bp, 922 aa] {ON} Syntenic ho...    61   3e-09
Ecym_2093 Chr2 (165578..168349) [2772 bp, 923 aa] {ON} similar t...    61   3e-09
CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} simila...    60   4e-09
KLLA0C08976g Chr3 (784536..787271) [2736 bp, 911 aa] {ON} highly...    60   4e-09
KNAG0I02540 Chr9 (489509..492265) [2757 bp, 918 aa] {ON} Anc_6.3...    60   5e-09
NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {...    60   6e-09
KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} simila...    59   6e-09
ADR090W Chr4 (868742..872443) [3702 bp, 1233 aa] {ON} Syntenic h...    60   7e-09
TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {O...    59   7e-09
NCAS0D04480 Chr4 complement(851440..854187) [2748 bp, 915 aa] {O...    60   8e-09
TBLA0I02280 Chr9 complement(523331..526114) [2784 bp, 927 aa] {O...    60   8e-09
Kpol_1036.65 s1036 complement(180839..181954) [1116 bp, 371 aa] ...    59   9e-09
NDAI0I00460 Chr9 (91809..94562) [2754 bp, 917 aa] {ON} Anc_6.325       59   1e-08
AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON} Syn...    59   1e-08
KLLA0E19515g Chr5 complement(1733708..1735426) [1719 bp, 572 aa]...    59   1e-08
Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON} (56367...    59   1e-08
KAFR0J02550 Chr10 complement(484360..487080) [2721 bp, 906 aa] {...    59   1e-08
KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.3...    59   1e-08
TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {O...    58   2e-08
Kpol_1028.54 s1028 (125940..128657) [2718 bp, 905 aa] {ON} (1259...    59   2e-08
KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.2...    58   2e-08
KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} simi...    58   2e-08
Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}...    58   2e-08
Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W...    58   2e-08
KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa...    58   3e-08
Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W...    57   3e-08
TPHA0D03830 Chr4 complement(802754..805492) [2739 bp, 912 aa] {O...    58   3e-08
Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON} (2370...    57   4e-08
TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7....    57   4e-08
NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340     57   5e-08
TBLA0C05010 Chr3 complement(1217846..1219564) [1719 bp, 572 aa] ...    57   5e-08
SAKL0F10384g Chr6 complement(799553..803338) [3786 bp, 1261 aa] ...    57   6e-08
NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340       57   6e-08
Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa...    57   6e-08
Ecym_8061 Chr8 complement(131761..135447) [3687 bp, 1228 aa] {ON...    57   7e-08
YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}  SOF1Essen...    56   7e-08
NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201     56   7e-08
KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} simila...    56   7e-08
Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {O...    56   7e-08
Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W...    56   8e-08
ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {...    56   8e-08
SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]...    56   1e-07
Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa] ...    55   1e-07
SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} simila...    55   1e-07
Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]...    55   1e-07
NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {...    55   2e-07
KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {O...    55   2e-07
Kwal_14.1710 s14 (433526..435250) [1725 bp, 574 aa] {ON} YGL116W...    55   2e-07
KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5....    55   2e-07
TBLA0F02140 Chr6 complement(526982..530884) [3903 bp, 1300 aa] {...    55   2e-07
TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {O...    54   3e-07
TDEL0A07400 Chr1 complement(1292494..1295199) [2706 bp, 901 aa] ...    55   3e-07
KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {...    54   3e-07
Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {...    54   3e-07
Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}...    54   3e-07
TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {...    54   3e-07
Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON...    54   3e-07
KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.2...    54   4e-07
NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {O...    54   4e-07
Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON...    54   4e-07
SAKL0F11506g Chr6 complement(894080..895786) [1707 bp, 568 aa] {...    54   4e-07
YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integra...    54   4e-07
KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]...    54   5e-07
Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON...    54   5e-07
NDAI0J01040 Chr10 (238940..240136) [1197 bp, 398 aa] {ON} Anc_8....    54   5e-07
KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {...    54   6e-07
KNAG0B02580 Chr2 (501215..502957) [1743 bp, 580 aa] {ON} Anc_7.3...    54   6e-07
YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}  ...    53   6e-07
Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa] ...    54   6e-07
Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C ...    53   7e-07
KNAG0B02800 Chr2 (537056..540979) [3924 bp, 1307 aa] {ON} Anc_7....    54   7e-07
ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly...    53   8e-07
NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283     53   8e-07
Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {...    53   8e-07
SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some sim...    53   8e-07
Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON} (1007...    53   8e-07
KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.3...    53   8e-07
CAGL0B01529g Chr2 (137174..138283) [1110 bp, 369 aa] {ON} highly...    52   8e-07
ZYRO0F05808g Chr6 complement(479060..482908) [3849 bp, 1282 aa] ...    53   9e-07
YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON} Pu...    53   9e-07
TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa] ...    53   1e-06
YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON} ...    52   1e-06
SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa...    53   1e-06
SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly...    52   1e-06
CAGL0K09284g Chr11 (915766..918501) [2736 bp, 911 aa] {ON} highl...    53   1e-06
TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON} Anc_6...    52   1e-06
Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W (...    52   1e-06
TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa] ...    52   1e-06
TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {O...    52   2e-06
KAFR0L01520 Chr12 complement(278754..280508) [1755 bp, 584 aa] {...    52   2e-06
Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {...    52   2e-06
AAR078W Chr1 (483989..485677) [1689 bp, 562 aa] {ON} Syntenic ho...    52   2e-06
TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {...    52   2e-06
YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON} ...    51   2e-06
CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {...    51   2e-06
ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} simila...    51   3e-06
TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}...    51   3e-06
KLLA0F05159g Chr6 (506007..509702) [3696 bp, 1231 aa] {ON} simil...    51   3e-06
KAFR0L01320 Chr12 complement(244228..247950) [3723 bp, 1240 aa] ...    51   4e-06
KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {...    51   4e-06
Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}...    51   4e-06
Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C ...    50   4e-06
NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {O...    50   4e-06
Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {...    50   4e-06
Kpol_530.25 s530 (67445..69169) [1725 bp, 574 aa] {ON} (67445..6...    50   4e-06
Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {...    50   4e-06
Ecym_2808 Chr2 (1568103..1569500) [1398 bp, 465 aa] {ON} similar...    50   5e-06
KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa] ...    50   5e-06
NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {O...    50   5e-06
TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.2...    50   5e-06
Kwal_23.6240 s23 complement(1503990..1506731) [2742 bp, 913 aa] ...    50   5e-06
KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} simila...    50   6e-06
Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {...    50   6e-06
KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.2...    50   6e-06
NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {O...    50   7e-06
CAGL0L03201g Chr12 complement(368792..370531) [1740 bp, 579 aa] ...    50   7e-06
CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON...    50   7e-06
Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON...    50   7e-06
KLTH0A06380g Chr1 complement(532367..535114) [2748 bp, 915 aa] {...    50   8e-06
SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {...    50   8e-06
Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}...    50   8e-06
CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highl...    50   8e-06
YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}  ...    50   8e-06
KLTH0H02134g Chr8 (191540..195439) [3900 bp, 1299 aa] {ON} simil...    50   9e-06
AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,...    49   9e-06
TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.2...    50   1e-05
KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {...    50   1e-05
ZYRO0D08558g Chr4 (736975..739713) [2739 bp, 912 aa] {ON} highly...    50   1e-05
KLTH0B01628g Chr2 (129632..132004) [2373 bp, 790 aa] {ON} simila...    50   1e-05
KNAG0J01680 Chr10 (307280..308476) [1197 bp, 398 aa] {ON} Anc_8....    49   1e-05
Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}...    49   1e-05
KLTH0E08162g Chr5 complement(749584..751254) [1671 bp, 556 aa] {...    49   1e-05
KLLA0F21406g Chr6 complement(1996260..1998377) [2118 bp, 705 aa]...    49   1e-05
SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]...    49   1e-05
NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363     49   1e-05
Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}...    49   1e-05
Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON...    49   1e-05
TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.5...    49   1e-05
ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly...    49   1e-05
Kpol_1014.19 s1014 complement(30466..31824) [1359 bp, 452 aa] {O...    49   1e-05
SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {...    49   1e-05
SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} high...    49   1e-05
Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {...    49   2e-05
ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic ho...    49   2e-05
Kpol_1061.6 s1061 complement(19407..20762) [1356 bp, 451 aa] {ON...    49   2e-05
NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON...    49   2e-05
KAFR0E03900 Chr5 complement(771649..772968) [1320 bp, 439 aa] {O...    49   2e-05
Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON...    49   2e-05
CAGL0A00605g Chr1 complement(67281..69203) [1923 bp, 640 aa] {ON...    49   2e-05
Ecym_4717 Chr4 (1407391..1409202) [1812 bp, 603 aa] {ON} similar...    49   2e-05
ZYRO0A03234g Chr1 (258942..260183) [1242 bp, 413 aa] {ON} simila...    49   2e-05
Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa] ...    49   2e-05
Skud_7.536 Chr7 complement(874704..877070) [2367 bp, 788 aa] {ON...    49   2e-05
KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.39...    48   2e-05
TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa] ...    48   2e-05
KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {O...    48   2e-05
ZYRO0B02486g Chr2 complement(199474..201201) [1728 bp, 575 aa] {...    49   2e-05
AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic ho...    49   2e-05
AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}...    48   2e-05
Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035...    48   3e-05
CAGL0A04037g Chr1 complement(404063..405814) [1752 bp, 583 aa] {...    48   3e-05
TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {O...    48   3e-05
AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON} S...    48   3e-05
ZYRO0C03124g Chr3 complement(240321..241658) [1338 bp, 445 aa] {...    48   3e-05
Ecym_7028 Chr7 (52132..52136,52211..54083) [1878 bp, 625 aa] {ON...    48   3e-05
TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON...    49   3e-05
Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {O...    48   3e-05
TPHA0C00860 Chr3 (180116..181252) [1137 bp, 378 aa] {ON} Anc_8.3...    48   3e-05
Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON...    48   3e-05
KLTH0H06160g Chr8 complement(538741..540465) [1725 bp, 574 aa] {...    48   3e-05
SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]...    48   3e-05
KLLA0E07965g Chr5 (717476..718648) [1173 bp, 390 aa] {ON} simila...    48   3e-05
NDAI0B05630 Chr2 complement(1376242..1377549) [1308 bp, 435 aa] ...    48   3e-05
NDAI0J00330 Chr10 (54580..55998) [1419 bp, 472 aa] {ON} Anc_7.534      48   3e-05
Skud_12.261 Chr12 (490588..492330) [1743 bp, 580 aa] {ON} YLR196...    48   3e-05
SAKL0E03960g Chr5 complement(319708..320130,320346..320885) [963...    47   3e-05
KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly...    48   3e-05
AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic h...    48   3e-05
TDEL0A00440 Chr1 (78820..80175) [1356 bp, 451 aa] {ON} Anc_3.25 ...    47   4e-05
KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {O...    48   4e-05
Kwal_56.24661 s56 complement(1093040..1094725) [1686 bp, 561 aa]...    48   4e-05
TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.1...    48   4e-05
NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25      47   4e-05
Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W...    48   5e-05
SAKL0D04796g Chr4 (372598..374907) [2310 bp, 769 aa] {ON} simila...    47   5e-05
SAKL0G02398g Chr7 complement(200123..201538) [1416 bp, 471 aa] {...    47   5e-05
Ecym_8090 Chr8 (194643..196793) [2151 bp, 716 aa] {ON} similar t...    47   5e-05
TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {...    47   5e-05
TBLA0C00990 Chr3 (195791..196972) [1182 bp, 393 aa] {ON} Anc_2.6...    47   5e-05
NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25      47   5e-05
Ecym_4249 Chr4 complement(516064..517188) [1125 bp, 374 aa] {ON}...    47   6e-05
CAGL0G09845g Chr7 (940598..942100) [1503 bp, 500 aa] {ON} simila...    47   6e-05
NDAI0J01850 Chr10 (461283..463010) [1728 bp, 575 aa] {ON} Anc_4....    47   6e-05
NDAI0C02600 Chr3 complement(605643..606554) [912 bp, 303 aa] {ON}      47   6e-05
YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON} ...    47   6e-05
Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {...    47   6e-05
TDEL0C01920 Chr3 (337685..339376) [1692 bp, 563 aa] {ON} Anc_7.3...    47   6e-05
Suva_10.292 Chr10 (516694..518436) [1743 bp, 580 aa] {ON} YLR196...    47   6e-05
ZYRO0G10472g Chr7 complement(844939..846621) [1683 bp, 560 aa] {...    47   7e-05
CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some sim...    47   7e-05
TBLA0A03750 Chr1 complement(937167..938510) [1344 bp, 447 aa] {O...    47   7e-05
NCAS0E02840 Chr5 (558336..560159) [1824 bp, 607 aa] {ON} Anc_7.3...    47   7e-05
ZYRO0F06776g Chr6 (555965..557263) [1299 bp, 432 aa] {ON} simila...    47   7e-05
Smik_12.256 Chr12 (490929..492659) [1731 bp, 576 aa] {ON} YLR196...    47   7e-05
KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {O...    47   7e-05
KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON} unipro...    47   7e-05
KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON...    47   7e-05
Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to ...    47   8e-05
TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON} Anc_6...    47   8e-05
NDAI0H02710 Chr8 complement(668900..669322,669678..670211) [957 ...    46   8e-05
TPHA0B00590 Chr2 complement(134906..136672) [1767 bp, 588 aa] {O...    47   8e-05
NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa] ...    47   8e-05
TPHA0O00710 Chr15 (135136..136050) [915 bp, 304 aa] {ON} Anc_1.3...    46   9e-05
TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {O...    47   9e-05
YLR196W Chr12 (543968..545698) [1731 bp, 576 aa] {ON}  PWP1Prote...    46   1e-04
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    47   1e-04
NCAS0J01110 Chr10 (189535..191322) [1788 bp, 595 aa] {ON}              46   1e-04
Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222...    46   1e-04
KAFR0B05700 Chr2 complement(1176020..1177138) [1119 bp, 372 aa] ...    46   1e-04
ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]...    46   1e-04
KLLA0E04093g Chr5 (371642..372760) [1119 bp, 372 aa] {ON} simila...    46   1e-04
Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {...    46   1e-04
ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {...    46   1e-04
KLTH0H01122g Chr8 (113798..115537) [1740 bp, 579 aa] {ON} simila...    46   1e-04
TPHA0F00770 Chr6 (175091..176986) [1896 bp, 631 aa] {ON} Anc_4.1...    46   1e-04
Smik_14.322 Chr14 (578426..579337) [912 bp, 303 aa] {ON} YNL006W...    45   1e-04
YNL006W Chr14 (620067..620978) [912 bp, 303 aa] {ON}  LST8Protei...    45   1e-04
Kwal_26.8776 s26 (938508..939809) [1302 bp, 433 aa] {ON} YPL151C...    46   1e-04
CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa] ...    46   1e-04
YDR128W Chr4 (709549..712995) [3447 bp, 1148 aa] {ON}  MTC5Subun...    46   1e-04
KAFR0C03830 Chr3 complement(776653..777798) [1146 bp, 381 aa] {O...    45   1e-04
NDAI0E04440 Chr5 (1002113..1003858) [1746 bp, 581 aa] {ON} Anc_7...    46   1e-04
TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa] ...    46   1e-04
ZYRO0D05852g Chr4 (498219..499334) [1116 bp, 371 aa] {ON} simila...    45   1e-04
CAGL0J08998g Chr10 (884779..888624) [3846 bp, 1281 aa] {ON} high...    46   2e-04
Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W...    46   2e-04
KNAG0B05550 Chr2 (1080707..1082560) [1854 bp, 617 aa] {ON} Anc_4...    46   2e-04
KNAG0I00920 Chr9 (173033..174178) [1146 bp, 381 aa] {ON} Anc_8.3...    45   2e-04
TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON...    46   2e-04
CAGL0K11836g Chr11 complement(1143042..1144610) [1569 bp, 522 aa...    45   2e-04
Suva_2.181 Chr2 complement(312873..314396) [1524 bp, 507 aa] {ON...    45   2e-04
YMR049C Chr13 complement(368094..370517) [2424 bp, 807 aa] {ON} ...    46   2e-04
SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON} sim...    46   2e-04
CAGL0J04818g Chr10 (458449..460413) [1965 bp, 654 aa] {ON} highl...    45   2e-04
ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} simila...    45   2e-04
TDEL0A06180 Chr1 (1082208..1083512) [1305 bp, 434 aa] {ON} Anc_8...    45   2e-04
Ecym_8044 Chr8 (97649..98584) [936 bp, 311 aa] {ON} similar to A...    45   2e-04
AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homo...    45   2e-04
AFL007C Chr6 complement(424004..425659) [1656 bp, 551 aa] {ON} S...    45   2e-04
Kpol_2001.63 s2001 complement(171777..175607) [3831 bp, 1276 aa]...    45   2e-04
TDEL0F02230 Chr6 (407699..409369) [1671 bp, 556 aa] {ON} Anc_4.1...    45   2e-04
KAFR0H03140 Chr8 complement(600224..601135) [912 bp, 303 aa] {ON...    45   2e-04
Smik_4.265 Chr4 complement(483300..484820) [1521 bp, 506 aa] {ON...    45   2e-04
KLLA0D04840g Chr4 (413362..414273) [912 bp, 303 aa] {ON} highly ...    45   2e-04
ABR101C Chr2 complement(567358..569841) [2484 bp, 827 aa] {ON} S...    45   2e-04
Suva_13.295 Chr13 complement(480518..480940,481217..481753) [960...    45   3e-04
Skud_13.275 Chr13 complement(474770..475192,475471..476007) [960...    45   3e-04
Smik_13.305 Chr13 complement(482912..483334,483612..484148) [960...    45   3e-04
YMR116C Chr13 complement(499456..499878,500152..500688) [960 bp,...    45   3e-04
Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W...    45   3e-04
Kpol_1061.36 s1061 (100800..102569) [1770 bp, 589 aa] {ON} (1008...    45   3e-04
KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON} sim...    45   3e-04
TPHA0G01610 Chr7 complement(332529..333773) [1245 bp, 414 aa] {O...    45   3e-04
KNAG0A03080 Chr1 complement(380346..381686) [1341 bp, 446 aa] {O...    45   3e-04
NCAS0B03550 Chr2 complement(627953..629080) [1128 bp, 375 aa] {O...    45   3e-04
Suva_14.342 Chr14 (600032..600943) [912 bp, 303 aa] {ON} YNL006W...    44   3e-04
YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}  MDV1Perip...    45   3e-04
Kwal_55.21450 s55 (842483..843994) [1512 bp, 503 aa] {ON} YDR364...    45   3e-04
CAGL0A02772g Chr1 complement(293966..295291) [1326 bp, 441 aa] {...    45   3e-04
Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON} (63032....    45   3e-04
KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {O...    45   3e-04
Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178...    44   4e-04
CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa] ...    45   4e-04
TDEL0F02410 Chr6 complement(447058..449568) [2511 bp, 836 aa] {O...    45   4e-04
AAL009C Chr1 complement(325785..326696) [912 bp, 303 aa] {ON} Sy...    44   4e-04
YGR225W Chr7 (945145..946327,946421..947019) [1782 bp, 593 aa] {...    44   4e-04
TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8....    45   4e-04
ZYRO0D01122g Chr4 complement(86927..88327) [1401 bp, 466 aa] {ON...    44   4e-04
KAFR0A05610 Chr1 complement(1126349..1128211) [1863 bp, 620 aa] ...    44   4e-04
Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON} c...    44   4e-04
CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa] ...    44   4e-04
TPHA0E01790 Chr5 (359679..361004) [1326 bp, 441 aa] {ON} Anc_5.4...    44   4e-04
YPR178W Chr16 (892332..893729) [1398 bp, 465 aa] {ON}  PRP4Splic...    44   4e-04
TBLA0G02090 Chr7 (545989..547911) [1923 bp, 640 aa] {ON} Anc_4.3...    44   4e-04
Skud_13.205 Chr13 complement(349265..351682) [2418 bp, 805 aa] {...    44   5e-04
Skud_12.521 Chr12 (924571..926508) [1938 bp, 645 aa] {ON} YLR429...    44   5e-04
AGL190W Chr7 (341382..342494) [1113 bp, 370 aa] {ON} Syntenic ho...    44   5e-04
Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON...    44   5e-04
NDAI0D02250 Chr4 complement(526907..529294) [2388 bp, 795 aa] {O...    44   5e-04
SAKL0G16962g Chr7 (1463359..1463363,1463442..1465290) [1854 bp, ...    44   5e-04
Suva_10.545 Chr10 (945641..947569) [1929 bp, 642 aa] {ON} YLR429...    44   5e-04
TPHA0G01740 Chr7 complement(357600..358946) [1347 bp, 448 aa] {O...    44   5e-04
Kwal_56.23035 s56 complement(373146..374420) [1275 bp, 424 aa] {...    44   5e-04
Skud_14.321 Chr14 (586864..587775) [912 bp, 303 aa] {ON} YNL006W...    44   5e-04
Kwal_47.17567 s47 complement(459443..461215) [1773 bp, 590 aa] {...    44   6e-04
ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} simi...    44   6e-04
SAKL0B11836g Chr2 complement(1020766..1023195) [2430 bp, 809 aa]...    44   6e-04
KLLA0F26653g Chr6 (2461876..2464251) [2376 bp, 791 aa] {ON} simi...    44   6e-04
Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}...    44   6e-04
KLTH0C07634g Chr3 (654087..655364) [1278 bp, 425 aa] {ON} weakly...    44   6e-04
YGR200C Chr7 complement(899904..902270) [2367 bp, 788 aa] {ON}  ...    44   7e-04
ZYRO0F09922g Chr6 complement(805666..807033) [1368 bp, 455 aa] {...    44   7e-04
NCAS0I01170 Chr9 complement(210377..212017) [1641 bp, 546 aa] {O...    44   7e-04
Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {O...    44   7e-04
YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}  ...    44   8e-04
Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112...    44   8e-04
NCAS0C04430 Chr3 complement(905927..909862) [3936 bp, 1311 aa] {...    44   8e-04
NDAI0E02400 Chr5 (499223..500527) [1305 bp, 434 aa] {ON} Anc_8.672     43   8e-04
Smik_15.398 Chr15 (692606..693883) [1278 bp, 425 aa] {ON} YOR212...    43   8e-04
CAGL0M02563g Chr13 complement(295156..296529) [1374 bp, 457 aa] ...    43   8e-04
Ecym_3243 Chr3 (460611..463448) [2838 bp, 945 aa] {ON} similar t...    44   9e-04
TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {...    44   9e-04
Ecym_6169 Chr6 complement(314473..316128) [1656 bp, 551 aa] {ON}...    43   9e-04
Skud_4.283 Chr4 complement(493677..495191) [1515 bp, 504 aa] {ON...    43   9e-04
NDAI0D04730 Chr4 (1109256..1111241) [1986 bp, 661 aa] {ON} Anc_4...    43   0.001
YLR429W Chr12 (990777..992732) [1956 bp, 651 aa] {ON}  CRN1Coron...    43   0.001
KLLA0F10791g Chr6 complement(991642..993279) [1638 bp, 545 aa] {...    43   0.001
KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {O...    43   0.001
Kpol_1016.11 s1016 (27192..29201) [2010 bp, 669 aa] {ON} (27192....    43   0.001
Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON...    43   0.001
KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {O...    43   0.001
Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {O...    43   0.001
TPHA0A03100 Chr1 (679875..683672) [3798 bp, 1265 aa] {ON} Anc_7....    43   0.001
Smik_7.287 Chr7 complement(484376..486076) [1701 bp, 566 aa] {ON...    43   0.001
KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.3...    43   0.001
KAFR0A00700 Chr1 (126326..128149) [1824 bp, 607 aa] {ON} Anc_2.4...    43   0.001
Smik_16.79 Chr16 complement(149712..150310,150409..151591) [1782...    43   0.001
KLTH0E15576g Chr5 complement(1384027..1386198) [2172 bp, 723 aa]...    43   0.001
Suva_8.265 Chr8 (481783..483054) [1272 bp, 423 aa] {ON} YOR212W ...    43   0.001
Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON...    43   0.001
YGL003C Chr7 complement(492474..494174) [1701 bp, 566 aa] {ON}  ...    43   0.001
KLLA0D12760g Chr4 complement(1090428..1091909) [1482 bp, 493 aa]...    43   0.001
Kwal_27.12667 s27 complement(1325822..1327987) [2166 bp, 721 aa]...    43   0.001
Kpol_1018.103 s1018 complement(268887..269966) [1080 bp, 359 aa]...    42   0.001
TDEL0F04430 Chr6 complement(831678..832781) [1104 bp, 367 aa] {O...    42   0.001
Suva_7.519 Chr7 (900889..901503) [615 bp, 205 aa] {ON} YGR225W (...    42   0.001
KNAG0G00800 Chr7 (147792..150164) [2373 bp, 790 aa] {ON} Anc_5.1...    43   0.001
Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON} (40266...    43   0.001
KLLA0A04928g Chr1 (439349..441934) [2586 bp, 861 aa] {ON} simila...    43   0.001
TBLA0D04130 Chr4 (1027726..1029450) [1725 bp, 574 aa] {ON} Anc_7...    43   0.001
Kwal_0.212 s0 (105364..106275) [912 bp, 303 aa] {ON} YNL006W (LS...    42   0.001
TBLA0C04110 Chr3 complement(994729..997278) [2550 bp, 849 aa] {O...    43   0.001
CAGL0E01485g Chr5 complement(139067..143077) [4011 bp, 1336 aa] ...    43   0.001
ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON} ...    43   0.001
TBLA0A03890 Chr1 complement(973249..974337) [1089 bp, 362 aa] {O...    42   0.001
AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic ...    43   0.001
TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa] ...    43   0.001
AER255C Chr5 complement(1107932..1109335) [1404 bp, 467 aa] {ON}...    42   0.002
Smik_16.106 Chr16 (194195..196564) [2370 bp, 789 aa] {ON} YGR200...    43   0.002
KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} simi...    42   0.002
Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON...    43   0.002
Ecym_2287 Chr2 (558921..561386) [2466 bp, 821 aa] {ON} similar t...    43   0.002
Suva_2.303 Chr2 complement(535706..536839) [1134 bp, 377 aa] {ON...    42   0.002
Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W (...    42   0.002
NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa] ...    42   0.002
TPHA0G03100 Chr7 complement(659503..661032) [1530 bp, 509 aa] {O...    42   0.002
ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} simila...    42   0.002
KLTH0C00616g Chr3 complement(62501..63724) [1224 bp, 407 aa] {ON...    42   0.002
TPHA0C01050 Chr3 complement(235500..238874) [3375 bp, 1124 aa] {...    42   0.002
TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {O...    42   0.002
Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON} ...    42   0.002
Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {...    42   0.002
Kpol_262.1 s262 (224..2131) [1908 bp, 635 aa] {ON} (224..2131) [...    42   0.002
Kwal_56.23895 s56 complement(763257..764360) [1104 bp, 367 aa] {...    42   0.002
TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.6...    42   0.002
TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.2...    42   0.002
NCAS0A03470 Chr1 (684361..686811) [2451 bp, 816 aa] {ON} Anc_4.106     42   0.002
Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to ...    42   0.002
AFL118W Chr6 (216252..216269,216423..218903) [2499 bp, 832 aa] {...    42   0.002
CAGL0H03729g Chr8 (342948..343859) [912 bp, 303 aa] {ON} highly ...    42   0.002
Skud_7.284 Chr7 complement(495549..497249) [1701 bp, 566 aa] {ON...    42   0.002
KNAG0B01610 Chr2 (294433..296457) [2025 bp, 674 aa] {ON} Anc_1.2...    42   0.002
KLLA0E23453g Chr5 (2088516..2090996) [2481 bp, 826 aa] {ON} simi...    42   0.002
TDEL0B05970 Chr2 (1055359..1056270) [912 bp, 303 aa] {ON} Anc_1....    42   0.002
NDAI0I01520 Chr9 complement(358776..360710) [1935 bp, 644 aa] {O...    42   0.002
KNAG0A03700 Chr1 complement(477870..480323) [2454 bp, 817 aa] {O...    42   0.003
KLTH0A02750g Chr1 complement(239284..241545) [2262 bp, 753 aa] {...    42   0.003
TBLA0E04570 Chr5 (1163562..1165349) [1788 bp, 595 aa] {ON} Anc_4...    42   0.003
KLTH0H12122g Chr8 (1034092..1035003) [912 bp, 303 aa] {ON} highl...    41   0.003
KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {...    42   0.003
YDR030C Chr4 complement(501753..503273) [1521 bp, 506 aa] {ON}  ...    42   0.003
KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} simila...    42   0.003
Suva_7.518 Chr7 (899625..900807,900908..901506) [1782 bp, 593 aa...    42   0.003
KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.5...    42   0.003
TDEL0A06650 Chr1 (1160677..1162032) [1356 bp, 451 aa] {ON} Anc_8...    41   0.003
TPHA0F00550 Chr6 complement(127250..129736) [2487 bp, 828 aa] {O...    42   0.003
KAFR0A04550 Chr1 complement(901244..903100) [1857 bp, 618 aa] {O...    42   0.003
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    42   0.003
Smik_7.159 Chr7 (285146..286981) [1836 bp, 611 aa] {ON} YGL116W ...    42   0.003
TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {O...    41   0.003
TDEL0A01730 Chr1 complement(310640..312433) [1794 bp, 597 aa] {O...    42   0.003
SAKL0H05456g Chr8 complement(490546..491886) [1341 bp, 446 aa] {...    41   0.003
Ecym_1293 Chr1 (595329..596240) [912 bp, 303 aa] {ON} similar to...    41   0.003
SAKL0A03872g Chr1 (361507..361524,361720..364338) [2637 bp, 878 ...    42   0.004
Suva_13.269 Chr13 complement(433166..435016) [1851 bp, 616 aa] {...    42   0.004
SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {...    42   0.004
TDEL0F04150 Chr6 (765748..769152) [3405 bp, 1134 aa] {ON} Anc_8....    42   0.004
Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W (...    41   0.004
Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {...    42   0.004
NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {O...    42   0.004
KNAG0H00180 Chr8 complement(26550..27719) [1170 bp, 389 aa] {ON}...    41   0.004
Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON} (1894...    42   0.004
KNAG0C04950 Chr3 (955701..957023) [1323 bp, 440 aa] {ON} Anc_5.4...    41   0.004
Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112...    41   0.004
NDAI0A05790 Chr1 (1315884..1317374) [1491 bp, 496 aa] {ON}             41   0.004
KAFR0I01050 Chr9 complement(205792..208320) [2529 bp, 842 aa] {O...    41   0.004
CAGL0F06853g Chr6 (671942..673108) [1167 bp, 388 aa] {ON} highly...    41   0.004
KLTH0D15840g Chr4 (1305121..1305125,1305195..1307283) [2094 bp, ...    41   0.004
YGL116W Chr7 (289809..291641) [1833 bp, 610 aa] {ON}  CDC20Cell-...    41   0.004
Kpol_1064.35 s1064 (64223..65584) [1362 bp, 453 aa] {ON} (64223....    41   0.005
TBLA0A01540 Chr1 complement(355418..357592) [2175 bp, 724 aa] {O...    41   0.005
TPHA0F03030 Chr6 complement(661801..663549) [1749 bp, 582 aa] {O...    41   0.005
Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {...    41   0.005
TPHA0D04480 Chr4 complement(970967..974989) [4023 bp, 1340 aa] {...    41   0.005
Suva_8.321 Chr8 (572329..573711) [1383 bp, 460 aa] {ON} YOR272W ...    41   0.005
NCAS0J01860 Chr10 (350125..352011) [1887 bp, 628 aa] {ON} Anc_4....    41   0.005
Kwal_27.12586 s27 (1290276..1291805) [1530 bp, 509 aa] {ON} YBR1...    41   0.005
TBLA0D02630 Chr4 (645439..648027) [2589 bp, 862 aa] {ON} Anc_8.6...    41   0.005
TDEL0D01090 Chr4 complement(204076..206004) [1929 bp, 642 aa] {O...    41   0.005
CAGL0M04279g Chr13 (469040..471862) [2823 bp, 940 aa] {ON} highl...    41   0.006
ZYRO0E04620g Chr5 (348647..349558) [912 bp, 303 aa] {ON} highly ...    40   0.006
ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa] ...    41   0.006
YDR142C Chr4 complement(740473..741600) [1128 bp, 375 aa] {ON}  ...    40   0.006
NDAI0G03310 Chr7 complement(777538..780195) [2658 bp, 885 aa] {O...    41   0.006
Kwal_56.24526 s56 (1036575..1040207) [3633 bp, 1210 aa] {ON} YDL...    41   0.006
NCAS0B00480 Chr2 (69598..70968) [1371 bp, 456 aa] {ON} Anc_8.721       40   0.006
TPHA0I03240 Chr9 (714446..715879) [1434 bp, 477 aa] {ON} Anc_7.5...    41   0.006
TDEL0E04900 Chr5 complement(913381..915738) [2358 bp, 785 aa] {O...    41   0.006
Ecym_5635 Chr5 (1285780..1286937) [1158 bp, 385 aa] {ON} similar...    40   0.006
CAGL0E02805g Chr5 complement(265374..267896) [2523 bp, 840 aa] {...    41   0.006
SAKL0H07150g Chr8 complement(626019..627341,627428..627430) [132...    40   0.006
ZYRO0G10054g Chr7 (802784..805312) [2529 bp, 842 aa] {ON} simila...    41   0.006
KLTH0E07700g Chr5 (705358..707778) [2421 bp, 806 aa] {ON} simila...    41   0.006
Suva_7.279 Chr7 complement(484066..485766) [1701 bp, 566 aa] {ON...    40   0.006
KNAG0A03220 Chr1 complement(399879..401150) [1272 bp, 423 aa] {O...    40   0.007
TPHA0E03760 Chr5 complement(791726..794116) [2391 bp, 796 aa] {O...    40   0.007
Ecym_3481 Chr3 complement(897444..898958) [1515 bp, 504 aa] {ON}...    40   0.007
YBL008W Chr2 (209653..212175) [2523 bp, 840 aa] {ON}  HIR1Subuni...    40   0.007
Suva_2.117 Chr2 (203652..206174) [2523 bp, 840 aa] {ON} YBL008W ...    40   0.007
ZYRO0C15994g Chr3 (1255015..1256529) [1515 bp, 504 aa] {ON} simi...    40   0.007
NDAI0J02410 Chr10 complement(586395..589244) [2850 bp, 949 aa] {...    40   0.007
Ecym_7229 Chr7 (475040..477529) [2490 bp, 829 aa] {ON} similar t...    40   0.007
TBLA0G03080 Chr7 complement(817595..818923) [1329 bp, 442 aa] {O...    40   0.007
NDAI0E01320 Chr5 complement(262712..263995) [1284 bp, 427 aa] {O...    40   0.007
AFL014C Chr6 complement(409496..411169) [1674 bp, 557 aa] {ON} S...    40   0.007
KNAG0D00250 Chr4 (32581..34548) [1968 bp, 655 aa] {ON} Anc_6.363...    40   0.008
Skud_15.379 Chr15 (681934..683211) [1278 bp, 425 aa] {ON} YOR212...    40   0.008
KAFR0I02860 Chr9 (573406..577503) [4098 bp, 1365 aa] {ON} Anc_3....    40   0.008
Smik_11.233 Chr11 complement(384291..385538) [1248 bp, 415 aa] {...    40   0.008
ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic ho...    40   0.008
KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {...    40   0.008
TBLA0E00760 Chr5 (158338..159492) [1155 bp, 384 aa] {ON}               40   0.008
Kpol_1031.36 s1031 complement(87105..89225) [2121 bp, 706 aa] {O...    40   0.008
YOR272W Chr15 (832813..834195) [1383 bp, 460 aa] {ON}  YTM1Const...    40   0.008
TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {O...    40   0.008
Suva_7.152 Chr7 (284623..286461) [1839 bp, 612 aa] {ON} YGL116W ...    40   0.008
SAKL0E03080g Chr5 (253338..254885) [1548 bp, 515 aa] {ON} highly...    40   0.009
TDEL0A02460 Chr1 (439489..441321) [1833 bp, 610 aa] {ON} Anc_2.4...    40   0.009
TPHA0B02080 Chr2 (477775..480600) [2826 bp, 941 aa] {ON} Anc_4.2...    40   0.009
KNAG0B06450 Chr2 complement(1274888..1276792) [1905 bp, 634 aa] ...    40   0.009
Smik_2.112 Chr2 (202544..205069) [2526 bp, 841 aa] {ON} YBL008W ...    40   0.009
Kpol_1031.49 s1031 (132811..133005,133055..133063,133288..133320...    40   0.009
TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {O...    40   0.009
YKL021C Chr11 complement(397344..398750) [1407 bp, 468 aa] {ON} ...    40   0.010
Kwal_26.8975 s26 (1026741..1028078) [1338 bp, 445 aa] {ON} YOR27...    40   0.010
TPHA0L01080 Chr12 (226790..229297) [2508 bp, 835 aa] {ON} Anc_8....    40   0.010
YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON} ...    40   0.010
NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {...    40   0.011
NDAI0C00170 Chr3 complement(24683..25888) [1206 bp, 401 aa] {ON}...    40   0.011
KLLA0F22000g Chr6 complement(2044973..2047354) [2382 bp, 793 aa]...    40   0.011
NDAI0C05490 Chr3 (1275046..1277625) [2580 bp, 859 aa] {ON}             40   0.012
YMR092C Chr13 complement(451632..453479) [1848 bp, 615 aa] {ON} ...    40   0.012
Smik_4.386 Chr4 complement(701174..702304) [1131 bp, 376 aa] {ON...    39   0.013
Skud_7.561 Chr7 (920014..921196,921300..921898) [1782 bp, 593 aa...    40   0.013
NCAS0D03330 Chr4 (623172..625046) [1875 bp, 624 aa] {ON} Anc_6.135     40   0.013
Skud_4.401 Chr4 complement(712131..713261) [1131 bp, 376 aa] {ON...    39   0.013
AER114W Chr5 (850726..850730,850789..852685) [1902 bp, 633 aa] {...    40   0.013
CAGL0M09845g Chr13 (975007..977817) [2811 bp, 936 aa] {ON} highl...    40   0.013
KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25 ...    39   0.013
Kwal_56.24332 s56 (959476..960732) [1257 bp, 418 aa] {ON} YPL247...    39   0.014
KLTH0H01892g Chr8 complement(167262..170891) [3630 bp, 1209 aa] ...    40   0.014
CAGL0D02090g Chr4 (214357..214893,215564..215860) [834 bp, 277 a...    39   0.014
SAKL0D08756g Chr4 complement(728765..729676) [912 bp, 303 aa] {O...    39   0.015
Kpol_1057.12 s1057 (22322..23515) [1194 bp, 397 aa] {ON} (22322....    39   0.015
KLTH0H02508g Chr8 complement(225069..225998) [930 bp, 309 aa] {O...    39   0.015
KNAG0H01290 Chr8 (227947..229341) [1395 bp, 464 aa] {ON} Anc_3.2...    39   0.016
NCAS0C01680 Chr3 (309670..310965) [1296 bp, 431 aa] {ON} Anc_8.672     39   0.016
ZYRO0B15268g Chr2 complement(1243795..1244396,1244475..1245684) ...    39   0.016
NDAI0A02880 Chr1 (644069..647938) [3870 bp, 1289 aa] {ON} Anc_7....    40   0.016
CAGL0C00737g Chr3 complement(75028..77478) [2451 bp, 816 aa] {ON...    39   0.016
NCAS0A13430 Chr1 complement(2641588..2643414) [1827 bp, 608 aa] ...    39   0.016
TPHA0N01850 Chr14 (393690..394910) [1221 bp, 406 aa] {ON} Anc_2....    39   0.017
ZYRO0F14960g Chr6 complement(1228479..1229438) [960 bp, 319 aa] ...    39   0.017
TDEL0A00410 Chr1 complement(70940..74728) [3789 bp, 1262 aa] {ON...    39   0.017
KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON} Anc_7...    39   0.017
Smik_12.525 Chr12 (919777..921735) [1959 bp, 652 aa] {ON} YLR429...    39   0.017
Kwal_26.7738 s26 (493416..495251) [1836 bp, 611 aa] {ON} YMR092C...    39   0.017
Suva_11.205 Chr11 complement(381101..382348) [1248 bp, 415 aa] {...    39   0.017
Kpol_1032.61 s1032 (141357..143825) [2469 bp, 822 aa] {ON} (1413...    39   0.018
KNAG0C02890 Chr3 (571926..574418) [2493 bp, 830 aa] {ON} Anc_4.1...    39   0.018
TDEL0C02240 Chr3 complement(388060..391665) [3606 bp, 1201 aa] {...    39   0.019
Skud_7.160 Chr7 (294214..296055) [1842 bp, 613 aa] {ON} YGL116W ...    39   0.019
AER448W Chr5 (1497416..1499560) [2145 bp, 714 aa] {ON} Syntenic ...    39   0.019
Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR1...    39   0.019
ZYRO0C14564g Chr3 (1135755..1137491) [1737 bp, 578 aa] {ON} simi...    39   0.019
KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} simi...    39   0.021
Skud_2.103 Chr2 (193155..195677) [2523 bp, 840 aa] {ON} YBL008W ...    39   0.022
TBLA0B02480 Chr2 complement(569751..571400) [1650 bp, 549 aa] {O...    39   0.022
KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {O...    39   0.022
TPHA0C00810 Chr3 complement(158582..161395) [2814 bp, 937 aa] {O...    39   0.023
Kpol_1001.23 s1001 complement(63130..64962) [1833 bp, 610 aa] {O...    39   0.023
Kpol_1055.64 s1055 (170524..173340) [2817 bp, 938 aa] {ON} (1705...    39   0.023
Kwal_26.7570 s26 (423448..424104) [657 bp, 218 aa] {ON} YMR116C ...    38   0.025
Suva_2.537 Chr2 complement(959258..960625) [1368 bp, 455 aa] {ON...    39   0.026
TBLA0B07430 Chr2 complement(1767976..1768574,1768681..1770475) [...    39   0.026
SAKL0D03740g Chr4 (303240..304676) [1437 bp, 478 aa] {ON} simila...    39   0.027
NDAI0G00150 Chr7 complement(18719..20887) [2169 bp, 722 aa] {ON}...    39   0.027
TDEL0E00950 Chr5 (197384..200206) [2823 bp, 940 aa] {ON} Anc_4.2...    39   0.027
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    39   0.027
ZYRO0F11110g Chr6 (908737..912342) [3606 bp, 1201 aa] {ON} highl...    39   0.028
Kpol_1072.17 s1072 complement(40550..41851) [1302 bp, 433 aa] {O...    39   0.028
Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {O...    39   0.028
Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON...    39   0.028
KLTH0H02772g Chr8 complement(248747..250009) [1263 bp, 420 aa] {...    39   0.028
KLLA0F11231g Chr6 complement(1034708..1036012) [1305 bp, 434 aa]...    39   0.029
Skud_13.248 Chr13 complement(425542..427389) [1848 bp, 615 aa] {...    39   0.029
ACR091W Chr3 (520609..521595) [987 bp, 328 aa] {ON} Syntenic hom...    38   0.029
NDAI0C05770 Chr3 complement(1328677..1329684) [1008 bp, 335 aa] ...    38   0.029
NDAI0J02490 Chr10 complement(613859..615748) [1890 bp, 629 aa] {...    39   0.029
CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa] ...    39   0.030
NDAI0A03310 Chr1 (750920..753373) [2454 bp, 817 aa] {ON} Anc_4.106     39   0.030
TBLA0B04390 Chr2 (1014987..1015997) [1011 bp, 336 aa] {ON} Anc_8...    38   0.031
CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} simila...    39   0.032
Kwal_14.884 s14 complement(95068..96255) [1188 bp, 395 aa] {ON} ...    38   0.033
TDEL0H02130 Chr8 (362711..364465) [1755 bp, 584 aa] {ON} Anc_7.2...    38   0.033
Suva_5.178 Chr5 (266333..267301) [969 bp, 322 aa] {ON} YFL009W (...    38   0.033
NCAS0H03530 Chr8 (671246..672400) [1155 bp, 384 aa] {ON} Anc_2.663     38   0.034
ADL322C Chr4 complement(128828..130333) [1506 bp, 501 aa] {ON} S...    38   0.034
TBLA0B09100 Chr2 complement(2156320..2156742,2157014..2157544) [...    38   0.034
NCAS0A07850 Chr1 complement(1561758..1563596) [1839 bp, 612 aa] ...    38   0.035
ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic ho...    38   0.035
Suva_4.427 Chr4 (751909..752856) [948 bp, 315 aa] {ON} YBR175W (...    38   0.036
KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} simi...    38   0.036
KAFR0I01880 Chr9 (386694..388469) [1776 bp, 591 aa] {ON} Anc_7.2...    38   0.039
AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON} S...    38   0.040
Kpol_1062.32 s1062 (69674..71074) [1401 bp, 466 aa] {ON} (69674....    38   0.041
YOR229W Chr15 (768409..769812) [1404 bp, 467 aa] {ON}  WTM2Trans...    38   0.041
SAKL0F10648g Chr6 (827399..831010) [3612 bp, 1203 aa] {ON} highl...    38   0.042
Smik_15.413 Chr15 (718053..719462) [1410 bp, 469 aa] {ON} YOR229...    38   0.042
Kwal_47.17465 s47 (415977..418379) [2403 bp, 800 aa] {ON} YBL008...    38   0.043
Kwal_56.24399 s56 (981153..982262) [1110 bp, 369 aa] {ON} [conti...    38   0.043
NCAS0B01430 Chr2 (233965..235317) [1353 bp, 450 aa] {ON}               38   0.044
YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}  ...    38   0.045
Skud_4.634 Chr4 complement(1131614..1132978) [1365 bp, 454 aa] {...    38   0.045
Smik_12.495 Chr12 complement(873068..875887) [2820 bp, 939 aa] {...    38   0.046
YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON} ...    38   0.047
YBR175W Chr2 (582408..583355) [948 bp, 315 aa] {ON}  SWD3Essenti...    37   0.047
Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {O...    38   0.048
Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON...    38   0.049
AGR168W Chr7 (1061516..1063993) [2478 bp, 825 aa] {ON} Syntenic ...    38   0.050
ADL218C Chr4 complement(319674..320885) [1212 bp, 403 aa] {ON} S...    37   0.050
NCAS0A02800 Chr1 (533712..535517) [1806 bp, 601 aa] {ON} Anc_4.3...    38   0.050
KLLA0C07425g Chr3 complement(647673..649007) [1335 bp, 444 aa] {...    38   0.051
KLLA0F27511g Chr6 (2546533..2548404) [1872 bp, 623 aa] {ON} simi...    38   0.053
YDR364C Chr4 complement(1202843..1204210) [1368 bp, 455 aa] {ON}...    37   0.053
Kwal_26.8700 s26 (902915..904060) [1146 bp, 381 aa] {ON} YOR229W...    37   0.053
KAFR0I00640 Chr9 (128872..129819) [948 bp, 315 aa] {ON} Anc_8.58...    37   0.054
Skud_15.437 Chr15 (771566..772951) [1386 bp, 461 aa] {ON} YOR272...    37   0.054
KAFR0A04110 Chr1 (826618..828000) [1383 bp, 460 aa] {ON} Anc_8.7...    37   0.055
KLTH0E15158g Chr5 (1346780..1348309) [1530 bp, 509 aa] {ON} simi...    38   0.055
Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129...    38   0.055
Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON...    38   0.056
KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} sim...    38   0.056
TPHA0B04250 Chr2 complement(995664..997187) [1524 bp, 507 aa] {O...    37   0.057
Suva_8.280 Chr8 (507390..508796) [1407 bp, 468 aa] {ON} YOR229W ...    37   0.057
NCAS0C03990 Chr3 complement(804313..806505) [2193 bp, 730 aa] {O...    38   0.057
Smik_15.454 Chr15 (782403..783788) [1386 bp, 461 aa] {ON} YOR272...    37   0.057
NCAS0A10500 Chr1 complement(2087347..2088783) [1437 bp, 478 aa] ...    37   0.057
AGL301C Chr7 complement(137221..138306) [1086 bp, 361 aa] {ON} S...    37   0.058
KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {O...    38   0.059
KNAG0F02420 Chr6 complement(453743..455668) [1926 bp, 641 aa] {O...    37   0.059
SAKL0G19668g Chr7 (1695030..1696214) [1185 bp, 394 aa] {ON} simi...    37   0.061
Skud_11.207 Chr11 complement(378222..379469) [1248 bp, 415 aa] {...    37   0.061
Smik_6.70 Chr6 (129582..131933) [2352 bp, 783 aa] {ON} YFL009W (...    37   0.063
CAGL0F07337g Chr6 complement(714870..716735) [1866 bp, 621 aa] {...    37   0.064
NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {O...    37   0.064
KLTH0D12276g Chr4 (998921..1000258) [1338 bp, 445 aa] {ON} highl...    37   0.065
NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {...    37   0.066
NDAI0D02490 Chr4 (575553..577499) [1947 bp, 648 aa] {ON} Anc_5.104     37   0.066
KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON...    37   0.067
ZYRO0F06314g Chr6 (526555..527850) [1296 bp, 431 aa] {ON} simila...    37   0.067
KAFR0A05800 Chr1 (1177423..1180245) [2823 bp, 940 aa] {ON} Anc_4...    37   0.069
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    37   0.071
NDAI0G05340 Chr7 (1301733..1303889) [2157 bp, 718 aa] {ON} Anc_1...    37   0.072
SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]...    37   0.073
TBLA0B03570 Chr2 complement(828308..829684) [1377 bp, 458 aa] {O...    37   0.074
Smik_15.414 Chr15 (720454..721767) [1314 bp, 437 aa] {ON} YOR230...    37   0.076
AGR242C Chr7 complement(1203146..1204405) [1260 bp, 419 aa] {ON}...    37   0.077
KLTH0D05368g Chr4 (479606..481438) [1833 bp, 610 aa] {ON} simila...    37   0.081
SAKL0A06534g Chr1 complement(584399..586162) [1764 bp, 587 aa] {...    37   0.086
KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} high...    37   0.087
TBLA0C02090 Chr3 complement(495831..498683) [2853 bp, 950 aa] {O...    37   0.095
Kwal_33.15591 s33 (1174119..1176263) [2145 bp, 714 aa] {ON} YKL2...    37   0.096
AER081C Chr5 complement(785301..788372) [3072 bp, 1023 aa] {ON} ...    37   0.096
TDEL0G01280 Chr7 complement(258957..259555,259626..260934) [1908...    37   0.099
KLLA0F04884g Chr6 complement(478044..481682) [3639 bp, 1212 aa] ...    37   0.099
KAFR0I00500 Chr9 complement(104685..106268) [1584 bp, 527 aa] {O...    37   0.100
NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON} Anc_7...    37   0.10 
NCAS0C01570 Chr3 (289762..291063) [1302 bp, 433 aa] {ON}               37   0.10 
Suva_10.525 Chr10 complement(900164..902983) [2820 bp, 939 aa] {...    37   0.10 
KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {...    37   0.10 
CAGL0L10890g Chr12 (1165380..1166753) [1374 bp, 457 aa] {ON} hig...    37   0.11 
KNAG0E02460 Chr5 complement(488247..490064) [1818 bp, 605 aa] {O...    37   0.11 
NDAI0E01330 Chr5 complement(266071..267363) [1293 bp, 430 aa] {O...    37   0.11 
NDAI0A01560 Chr1 (352038..353129) [1092 bp, 363 aa] {ON} Anc_5.6...    36   0.12 
KLLA0E18899g Chr5 (1680775..1683747) [2973 bp, 990 aa] {ON} simi...    37   0.12 
KAFR0F02590 Chr6 complement(504740..506842) [2103 bp, 700 aa] {O...    37   0.12 
Ecym_2282 Chr2 complement(552170..553879) [1710 bp, 569 aa] {ON}...    37   0.13 
NCAS0J01650 Chr10 complement(294247..297069) [2823 bp, 940 aa] {...    37   0.13 
SAKL0G15994g Chr7 complement(1374780..1377614) [2835 bp, 944 aa]...    37   0.13 
ABL043W Chr2 (314670..316490) [1821 bp, 606 aa] {ON} Syntenic ho...    37   0.13 
Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON} (178...    37   0.13 
Ecym_7373 Chr7 complement(776909..779269) [2361 bp, 786 aa] {ON}...    37   0.14 
YLR409C Chr12 complement(934414..937233) [2820 bp, 939 aa] {ON} ...    37   0.14 
TPHA0D00580 Chr4 (100671..102869) [2199 bp, 732 aa] {ON} Anc_8.6...    37   0.14 
ADR077C Chr4 complement(843169..846783) [3615 bp, 1204 aa] {ON} ...    37   0.14 
KAFR0G01890 Chr7 (400922..402274) [1353 bp, 450 aa] {ON}               36   0.14 
Skud_12.493 Chr12 complement(874622..877441) [2820 bp, 939 aa] {...    37   0.14 
TPHA0G00680 Chr7 complement(127929..129302) [1374 bp, 457 aa] {O...    36   0.14 
ZYRO0D00616g Chr4 complement(47163..48347) [1185 bp, 394 aa] {ON...    36   0.14 
Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar t...    37   0.14 
Ecym_8336 Chr8 (677880..679250) [1371 bp, 456 aa] {ON} similar t...    36   0.14 
TDEL0C00940 Chr3 (150797..152719) [1923 bp, 640 aa] {ON} Anc_8.6...    36   0.14 
KLTH0E10120g Chr5 (916575..919055) [2481 bp, 826 aa] {ON} highly...    36   0.14 
KLTH0H03608g Chr8 (327747..327764,327941..330550) [2628 bp, 875 ...    36   0.15 
TPHA0A04810 Chr1 complement(1090373..1092751) [2379 bp, 792 aa] ...    36   0.16 
YOR230W Chr15 (770800..772113) [1314 bp, 437 aa] {ON}  WTM1Trans...    36   0.16 
Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129...    36   0.16 
KLTH0E13552g Chr5 complement(1202406..1203356) [951 bp, 316 aa] ...    36   0.17 
ZYRO0G03168g Chr7 (241103..242923) [1821 bp, 606 aa] {ON} simila...    36   0.17 
KLLA0E24487g Chr5 complement(2175775..2176758) [984 bp, 327 aa] ...    36   0.17 
TDEL0D03660 Chr4 (671946..673298) [1353 bp, 450 aa] {ON} Anc_3.2...    36   0.18 
ZYRO0F09372g Chr6 (761606..762952) [1347 bp, 448 aa] {ON} highly...    36   0.18 
Skud_2.302 Chr2 (549799..550803) [1005 bp, 334 aa] {ON} YBR175W ...    36   0.18 
KLTH0C06358g Chr3 (556638..557741) [1104 bp, 367 aa] {ON} highly...    36   0.18 
TPHA0F03650 Chr6 (793481..795703) [2223 bp, 740 aa] {ON} Anc_1.5...    36   0.18 
ZYRO0C03190g Chr3 (245542..249363) [3822 bp, 1273 aa] {ON} simil...    36   0.19 
KLTH0B00924g Chr2 complement(79302..81446) [2145 bp, 714 aa] {ON...    36   0.20 
TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa...    35   0.20 
Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR17...    36   0.20 
TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON} Anc_8...    36   0.20 
NCAS0G04300 Chr7 (799388..801565) [2178 bp, 725 aa] {ON} Anc_1.5...    36   0.20 
NDAI0G03810 Chr7 complement(911595..915776) [4182 bp, 1393 aa] {...    36   0.21 
NCAS0B01440 Chr2 (236104..237390) [1287 bp, 428 aa] {ON}               35   0.22 
ZYRO0D16742g Chr4 complement(1385330..1387156) [1827 bp, 608 aa]...    36   0.22 
YBR103W Chr2 (447709..449316) [1608 bp, 535 aa] {ON}  SIF2WD40 r...    35   0.23 
KLTH0D10648g Chr4 (875331..875337,875409..876751) [1350 bp, 449 ...    35   0.23 
TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {O...    35   0.23 
NDAI0E00910 Chr5 complement(182574..183968) [1395 bp, 464 aa] {O...    35   0.24 
KLLA0B01958g Chr2 (170646..170663,170896..173550) [2673 bp, 890 ...    36   0.24 
TBLA0A03950 Chr1 (986923..989733) [2811 bp, 936 aa] {ON} Anc_8.3...    36   0.24 
AFL041C Chr6 complement(361724..362833) [1110 bp, 369 aa] {ON} S...    35   0.25 
Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa] ...    35   0.26 
TBLA0F02230 Chr6 (551746..555396) [3651 bp, 1216 aa] {ON} Anc_7....    35   0.26 
YLR129W Chr12 (399657..402488) [2832 bp, 943 aa] {ON}  DIP2Nucle...    35   0.26 
NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 ...    35   0.27 
TPHA0P00330 Chr16 (63488..65419) [1932 bp, 643 aa] {ON} Anc_8.67...    35   0.27 
TDEL0F04500 Chr6 (843307..846123) [2817 bp, 938 aa] {ON} Anc_8.3...    35   0.27 
AER337W Chr5 (1256750..1258087) [1338 bp, 445 aa] {ON} Syntenic ...    35   0.27 
KAFR0E00180 Chr5 complement(35535..37721) [2187 bp, 728 aa] {ON}...    35   0.27 
SAKL0E03058g Chr5 complement(251271..253112) [1842 bp, 613 aa] {...    35   0.28 
NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa...    35   0.28 
TPHA0D04500 Chr4 (978756..982382) [3627 bp, 1208 aa] {ON} Anc_7....    35   0.28 
TPHA0A05040 Chr1 (1137120..1138359,1138450..1139051) [1842 bp, 6...    35   0.28 
TBLA0I00360 Chr9 (56206..57300) [1095 bp, 364 aa] {ON} Anc_7.405...    35   0.29 
AGR207C Chr7 complement(1146704..1147666) [963 bp, 320 aa] {ON} ...    35   0.29 
Kwal_27.10785 s27 (495263..496366) [1104 bp, 367 aa] {ON} YER107...    35   0.29 
NCAS0B07840 Chr2 complement(1486900..1488669) [1770 bp, 589 aa] ...    35   0.30 
Smik_13.32 Chr13 (64435..65841) [1407 bp, 468 aa] {ON} YML102W (...    35   0.31 
Smik_2.315 Chr2 (568572..569519) [948 bp, 315 aa] {ON} YBR175W (...    35   0.31 
Kpol_1011.6 s1011 complement(17489..19777) [2289 bp, 762 aa] {ON...    35   0.31 
Suva_2.435 Chr2 complement(769135..770127) [993 bp, 330 aa] {ON}...    35   0.31 
Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}...    35   0.32 
Kwal_23.4118 s23 (579251..582070) [2820 bp, 939 aa] {ON} YLR409C...    35   0.33 
Ecym_8072 Chr8 (157039..160644) [3606 bp, 1201 aa] {ON} similar ...    35   0.33 
NCAS0A13940 Chr1 (2740150..2743767) [3618 bp, 1205 aa] {ON} Anc_...    35   0.34 
Skud_13.39 Chr13 (67722..69146) [1425 bp, 474 aa] {ON} YML102W (...    35   0.35 
ABL044C Chr2 complement(312376..313932) [1557 bp, 518 aa] {ON} S...    35   0.35 
KLTH0D14960g Chr4 complement(1223765..1226584) [2820 bp, 939 aa]...    35   0.36 
YER107C Chr5 complement(373448..374545) [1098 bp, 365 aa] {ON}  ...    35   0.36 
KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 a...    35   0.37 
ZYRO0F13288g Chr6 (1089259..1092207) [2949 bp, 982 aa] {ON} simi...    35   0.37 
Kpol_1013.37 s1013 complement(88637..88936,88986..88994,89037..9...    35   0.39 
TDEL0F02260 Chr6 (414020..415309) [1290 bp, 429 aa] {ON} Anc_4.1...    35   0.39 
KLLA0E20703g Chr5 complement(1841092..1842207) [1116 bp, 371 aa]...    35   0.40 
Ecym_2239 Chr2 complement(467139..470081) [2943 bp, 980 aa] {ON}...    35   0.41 
TDEL0E01960 Chr5 (369744..371102) [1359 bp, 452 aa] {ON} Anc_5.4...    35   0.44 
KNAG0F01840 Chr6 (348492..351227) [2736 bp, 911 aa] {ON} Anc_6.2...    35   0.45 
Suva_4.348 Chr4 (616802..618448) [1647 bp, 548 aa] {ON} YBR103W ...    35   0.47 
Smik_4.631 Chr4 complement(1128746..1130113) [1368 bp, 455 aa] {...    35   0.48 
Smik_5.200 Chr5 (297829..299004) [1176 bp, 391 aa] {ON} YFL009W ...    34   0.48 
NCAS0I02490 Chr9 complement(465916..467796) [1881 bp, 626 aa] {O...    35   0.48 
TPHA0D01130 Chr4 (236199..237554) [1356 bp, 451 aa] {ON} Anc_8.6...    34   0.50 
Ecym_7149 Chr7 (308042..309139) [1098 bp, 365 aa] {ON} similar t...    34   0.50 
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    35   0.51 
Suva_13.270 Chr13 (435573..437114) [1542 bp, 513 aa] {ON} YMR093...    34   0.54 
NDAI0A02610 Chr1 (585697..588000) [2304 bp, 767 aa] {ON} Anc_7.231     35   0.54 
SAKL0A10406g Chr1 (910452..912587) [2136 bp, 711 aa] {ON} simila...    34   0.55 
TPHA0G02840 Chr7 (604491..605033) [543 bp, 180 aa] {ON} Anc_2.43...    33   0.55 
KLLA0B02827g Chr2 (254447..257275) [2829 bp, 942 aa] {ON} highly...    35   0.56 
Kpol_1058.31 s1058 (85899..87926) [2028 bp, 675 aa] {ON} (85899....    34   0.57 
Ecym_6228 Chr6 (425765..427102) [1338 bp, 445 aa] {ON} similar t...    34   0.57 
KLTH0F02948g Chr6 (254134..255333) [1200 bp, 399 aa] {ON} weakly...    34   0.57 
CAGL0J03960g Chr10 complement(375780..377087) [1308 bp, 435 aa] ...    34   0.58 
TDEL0C04860 Chr3 (881043..882584) [1542 bp, 513 aa] {ON} Anc_3.3...    34   0.59 
Kpol_1045.33 s1045 (77282..78367) [1086 bp, 361 aa] {ON} (77284....    34   0.61 
KLTH0E08096g Chr5 complement(743809..745041) [1233 bp, 410 aa] {...    34   0.61 
KNAG0A02510 Chr1 complement(253245..255794) [2550 bp, 849 aa] {O...    34   0.63 
Smik_13.276 Chr13 complement(435512..437359) [1848 bp, 615 aa] {...    34   0.67 
KNAG0D01690 Chr4 (286791..288755) [1965 bp, 654 aa] {ON} Anc_7.2...    34   0.67 
Kpol_1065.30 s1065 complement(61425..62993) [1569 bp, 522 aa] {O...    34   0.69 
NCAS0A00740 Chr1 (143564..144946) [1383 bp, 460 aa] {ON} Anc_1.1...    34   0.70 
CAGL0C01441g Chr3 complement(156930..159947) [3018 bp, 1005 aa] ...    34   0.71 
ACR166W Chr3 (647933..649102) [1170 bp, 389 aa] {ON} Syntenic ho...    34   0.72 
TDEL0C02650 Chr3 complement(460884..461978) [1095 bp, 364 aa] {O...    34   0.75 
Suva_16.171 Chr16 complement(299070..300455) [1386 bp, 461 aa] {...    34   0.77 
Skud_1.64 Chr1 (130376..131662) [1287 bp, 428 aa] {ON} YAR003W (...    34   0.78 
KNAG0C04320 Chr3 complement(847171..850224) [3054 bp, 1017 aa] {...    34   0.80 
Suva_7.278 Chr7 complement(482297..483559) [1263 bp, 420 aa] {ON...    34   0.81 
YMR093W Chr13 (454015..455556) [1542 bp, 513 aa] {ON}  UTP15Nucl...    34   0.81 
TPHA0E00770 Chr5 (154048..155115) [1068 bp, 355 aa] {ON} Anc_7.4...    33   0.82 
KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {O...    34   0.83 
ZYRO0E07392g Chr5 complement(564166..566841,567011..567028) [269...    34   0.87 
YOR212W Chr15 (742910..744181) [1272 bp, 423 aa] {ON}  STE4G pro...    33   0.87 
Ecym_6098 Chr6 (185368..185901,186107..186529) [957 bp, 318 aa] ...    33   0.92 
SAKL0B02244g Chr2 (212226..214547) [2322 bp, 773 aa] {ON} simila...    34   0.92 
Skud_15.395 Chr15 (707395..708789) [1395 bp, 464 aa] {ON} YOR229...    33   0.94 
CAGL0L02629g Chr12 complement(309320..311707) [2388 bp, 795 aa] ...    34   0.96 
Kpol_467.20 s467 complement(43262..43506,43751..45251) [1746 bp,...    33   0.96 
Kpol_297.7 s297 (10035..10568,10902..11324) [957 bp, 318 aa] {ON...    33   0.98 
NCAS0A07860 Chr1 (1563830..1565362) [1533 bp, 510 aa] {ON} Anc_2...    33   0.99 
KAFR0H02550 Chr8 complement(487226..488521) [1296 bp, 431 aa] {O...    33   1.00 
ZYRO0G20152g Chr7 complement(1669233..1669655,1669872..1670408) ...    33   1.0  
Smik_5.253 Chr5 complement(382390..383487) [1098 bp, 365 aa] {ON...    33   1.0  
KAFR0F03340 Chr6 (656751..657980) [1230 bp, 409 aa] {ON} Anc_4.1...    33   1.0  
SAKL0F12782g Chr6 complement(999031..1000134) [1104 bp, 367 aa] ...    33   1.0  
CAGL0K00275g Chr11 complement(26129..28276) [2148 bp, 715 aa] {O...    33   1.0  
SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} simi...    33   1.1  
KLLA0D15873g Chr4 (1334131..1335426) [1296 bp, 431 aa] {ON} simi...    33   1.2  
Smik_11.10 Chr11 complement(16139..18292) [2154 bp, 717 aa] {ON}...    33   1.2  
Kwal_27.12239 s27 complement(1143763..1144713) [951 bp, 316 aa] ...    33   1.2  
TDEL0E05480 Chr5 complement(1002913..1005540,1005640..1005657) [...    33   1.2  
Ecym_8317 Chr8 (648256..649527) [1272 bp, 423 aa] {ON} similar t...    33   1.2  
AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON} S...    33   1.2  
ADL082C Chr4 complement(538945..540654) [1710 bp, 569 aa] {ON} S...    33   1.2  
TBLA0A06060 Chr1 (1493832..1493849,1494107..1496755) [2667 bp, 8...    33   1.3  
Kpol_526.37 s526 complement(88726..89769) [1044 bp, 347 aa] {ON}...    33   1.3  
Skud_6.63 Chr6 (118478..120823) [2346 bp, 781 aa] {ON} YFL009W (...    33   1.3  
YFL009W Chr6 (116145..118484) [2340 bp, 779 aa] {ON}  CDC4F-box ...    33   1.3  
SAKL0G07040g Chr7 (577213..578250) [1038 bp, 345 aa] {ON} simila...    33   1.3  
TBLA0A09610 Chr1 (2369818..2370978) [1161 bp, 386 aa] {ON} Anc_5...    33   1.4  
Ecym_4644 Chr4 (1256560..1257447) [888 bp, 295 aa] {ON} similar ...    33   1.4  
Kpol_467.21 s467 (46346..48160) [1815 bp, 604 aa] {ON} (46346..4...    33   1.4  
Kwal_YGOB_27.12717 s27 (1347453..1348746,1348819..1349414) [1890...    33   1.4  
KAFR0A00510 Chr1 (93452..93988,94240..94662) [960 bp, 319 aa] {O...    33   1.4  
TPHA0F02890 Chr6 complement(640553..641440) [888 bp, 295 aa] {ON...    33   1.5  
NCAS0A09610 Chr1 complement(1920171..1922258) [2088 bp, 695 aa] ...    33   1.5  
NCAS0F01450 Chr6 complement(287070..289796) [2727 bp, 908 aa] {O...    33   1.5  
KNAG0F00620 Chr6 (105380..106768) [1389 bp, 462 aa] {ON} Anc_1.1...    33   1.5  
KLTH0B07040g Chr2 (567756..569276) [1521 bp, 506 aa] {ON} simila...    33   1.5  
Kwal_23.5035 s23 (975572..977806) [2235 bp, 744 aa] {ON} YFL009W...    33   1.6  
Ecym_7402 Chr7 complement(827224..829044) [1821 bp, 606 aa] {ON}...    33   1.7  
TPHA0J01890 Chr10 (430218..432287) [2070 bp, 689 aa] {ON} Anc_6....    33   1.7  
KLTH0E09372g Chr5 complement(850371..853364) [2994 bp, 997 aa] {...    33   1.7  
Smik_4.518 Chr4 complement(935380..936372) [993 bp, 330 aa] {ON}...    33   1.7  
Ecym_4343 Chr4 (733111..734862) [1752 bp, 583 aa] {ON} similar t...    33   1.7  
CAGL0M08646g Chr13 (861488..862501) [1014 bp, 337 aa] {ON} simil...    32   1.8  
TDEL0B07580 Chr2 (1329080..1330252) [1173 bp, 390 aa] {ON} Anc_2...    33   1.8  
TDEL0A02070 Chr1 (372046..372582,372798..373220) [960 bp, 319 aa...    32   1.8  
SAKL0H07656g Chr8 complement(659189..660469) [1281 bp, 426 aa] {...    33   1.8  
NCAS0A14470 Chr1 complement(2848835..2849923) [1089 bp, 362 aa] ...    33   1.8  
KNAG0G01080 Chr7 (235280..237520) [2241 bp, 746 aa] {ON}  YER066W      33   1.9  
KNAG0E02470 Chr5 (490378..491907) [1530 bp, 509 aa] {ON} Anc_2.4...    33   2.0  
Suva_11.7 Chr11 complement(15456..17615) [2160 bp, 719 aa] {ON} ...    33   2.0  
TPHA0J02540 Chr10 complement(561110..563710) [2601 bp, 866 aa] {...    33   2.0  
KNAG0G00130 Chr7 complement(8702..10888) [2187 bp, 728 aa] {ON} ...    33   2.0  
NDAI0I00880 Chr9 complement(203097..205763) [2667 bp, 888 aa] {O...    33   2.0  
Ecym_6167 Chr6 complement(309181..310437) [1257 bp, 418 aa] {ON}...    32   2.0  
ZYRO0G03146g Chr7 complement(238354..239886) [1533 bp, 510 aa] {...    33   2.0  
CAGL0L06952g Chr12 complement(782790..783833) [1044 bp, 347 aa] ...    32   2.0  
NDAI0H02250 Chr8 (546983..548821) [1839 bp, 612 aa] {ON} Anc_2.4...    33   2.1  
Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093...    32   2.1  
NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {O...    33   2.1  
Skud_13.249 Chr13 (427918..429459) [1542 bp, 513 aa] {ON} YMR093...    32   2.1  
KNAG0C03490 Chr3 (684848..685936) [1089 bp, 362 aa] {ON} Anc_7.4...    32   2.2  
Kpol_1002.101 s1002 complement(252330..254240) [1911 bp, 636 aa]...    32   2.2  
NDAI0E01500 Chr5 complement(295871..297157) [1287 bp, 428 aa] {O...    32   2.2  
YKL213C Chr11 complement(31960..34107) [2148 bp, 715 aa] {ON}  D...    32   2.2  
Skud_5.232 Chr5 complement(369506..370603) [1098 bp, 365 aa] {ON...    32   2.3  
KNAG0B06260 Chr2 complement(1228060..1230876) [2817 bp, 938 aa] ...    32   2.3  
KAFR0C03190 Chr3 complement(639680..641698) [2019 bp, 672 aa] {O...    32   2.3  
TDEL0A02450 Chr1 complement(437732..439264) [1533 bp, 510 aa] {O...    32   2.4  
CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 ...    32   2.4  
SAKL0F08404g Chr6 complement(640436..642367) [1932 bp, 643 aa] {...    32   2.4  
TDEL0F00270 Chr6 complement(40832..42949) [2118 bp, 705 aa] {ON}...    32   2.4  
TBLA0A04150 Chr1 (1027635..1029005) [1371 bp, 456 aa] {ON} Anc_8...    32   2.4  
KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} simi...    32   2.5  
Suva_6.51 Chr6 (88465..90756) [2292 bp, 763 aa] {ON} YFL009W (REAL)    32   2.5  
YGL137W Chr7 (249869..249886,250087..252738) [2670 bp, 889 aa] {...    32   2.6  
Suva_5.228 Chr5 complement(347755..348852) [1098 bp, 365 aa] {ON...    32   2.6  
TDEL0C03040 Chr3 (542405..545422) [3018 bp, 1005 aa] {ON} Anc_7....    32   2.6  
CAGL0G03399g Chr7 complement(325879..326988) [1110 bp, 369 aa] {...    32   2.6  
TPHA0G03110 Chr7 (661602..663428) [1827 bp, 608 aa] {ON} Anc_2.4...    32   2.7  
TBLA0F02400 Chr6 complement(590293..591189) [897 bp, 298 aa] {ON...    32   2.7  
KLLA0E18877g Chr5 complement(1676876..1680310) [3435 bp, 1144 aa...    32   2.9  
Smik_7.286 Chr7 complement(482658..483911) [1254 bp, 417 aa] {ON...    32   3.0  
ADR176W Chr4 (1012411..1013796) [1386 bp, 461 aa] {ON} Syntenic ...    32   3.0  
KLLA0C07513g Chr3 complement(656060..657379) [1320 bp, 439 aa] {...    32   3.0  
KNAG0A03070 Chr1 complement(378279..379604) [1326 bp, 441 aa] {O...    32   3.0  
ZYRO0B13838g Chr2 (1121025..1123079) [2055 bp, 684 aa] {ON} some...    32   3.1  
KLLA0C16643g Chr3 complement(1457590..1458498) [909 bp, 302 aa] ...    32   3.1  
Skud_4.530 Chr4 complement(945231..946247) [1017 bp, 338 aa] {ON...    32   3.2  
KLLA0F13772g Chr6 (1276532..1278094) [1563 bp, 520 aa] {ON} high...    32   3.2  
TPHA0N01800 Chr14 complement(386979..387968) [990 bp, 329 aa] {O...    32   3.2  
KNAG0G02820 Chr7 (623677..625050) [1374 bp, 457 aa] {ON} Anc_8.7...    32   3.3  
Kpol_2001.68 s2001 complement(187786..188673) [888 bp, 295 aa] {...    32   3.3  
YDR267C Chr4 complement(1002510..1003502) [993 bp, 330 aa] {ON} ...    32   3.4  
KNAG0E02310 Chr5 (463866..464402,464772..465194) [960 bp, 319 aa...    32   3.4  
ZYRO0B03652g Chr2 complement(301728..302804) [1077 bp, 358 aa] {...    32   3.4  
NCAS0B01910 Chr2 (312479..313456) [978 bp, 325 aa] {ON} Anc_8.585      32   3.6  
Smik_2.423 Chr2 complement(750642..753278) [2637 bp, 878 aa] {ON...    32   3.6  
ACR192C Chr3 complement(684497..687487) [2991 bp, 996 aa] {ON} S...    32   3.6  
ZYRO0F03784g Chr6 (314914..317247) [2334 bp, 777 aa] {ON} simila...    32   3.6  
TBLA0I02570 Chr9 (597481..600027) [2547 bp, 848 aa] {ON} Anc_8.7...    32   3.8  
Kwal_33.14449 s33 complement(675978..677504) [1527 bp, 508 aa] {...    32   3.9  
Suva_16.126 Chr16 complement(209255..212296) [3042 bp, 1013 aa] ...    32   3.9  
KLTH0G09526g Chr7 complement(794931..800147) [5217 bp, 1738 aa] ...    32   3.9  
KLLA0E11331g Chr5 complement(994770..996308) [1539 bp, 512 aa] {...    32   4.3  
NDAI0H02240 Chr8 complement(545073..546617) [1545 bp, 514 aa] {O...    32   4.3  
CAGL0B00748g Chr2 (65727..68165) [2439 bp, 812 aa] {ON} similar ...    32   4.3  
KNAG0C06240 Chr3 complement(1212466..1213533) [1068 bp, 355 aa] ...    31   4.3  
Skud_2.229 Chr2 (415869..417506) [1638 bp, 545 aa] {ON} YBR103W ...    32   4.4  
NDAI0A00340 Chr1 (50320..53166) [2847 bp, 948 aa] {ON} Anc_1.34 ...    32   4.5  
Skud_15.396 Chr15 (709746..711059) [1314 bp, 437 aa] {ON} YOR230...    31   4.6  
TDEL0F02720 Chr6 complement(498279..500363) [2085 bp, 694 aa] {O...    32   4.9  
Kpol_1072.41 s1072 complement(90370..91632) [1263 bp, 420 aa] {O...    31   5.0  
Skud_2.5 Chr2 complement(8730..11846) [3117 bp, 1038 aa] {ON} YB...    32   5.0  
TBLA0A05690 Chr1 (1412275..1413546) [1272 bp, 423 aa] {ON} Anc_1...    31   5.1  
CAGL0K12188g Chr11 (1192017..1193624) [1608 bp, 535 aa] {ON} sim...    31   5.1  
KAFR0D01700 Chr4 complement(339178..340785) [1608 bp, 535 aa] {O...    31   5.1  
NCAS0J01100 Chr10 (187994..189307) [1314 bp, 437 aa] {ON} Anc_4....    31   5.2  
Kwal_33.13148 s33 (94593..96614) [2022 bp, 673 aa] {ON} YCL039W ...    31   5.2  
TBLA0B04070 Chr2 complement(930877..932130) [1254 bp, 417 aa] {O...    31   5.2  
NDAI0A07830 Chr1 (1802204..1804156) [1953 bp, 650 aa] {ON} Anc_3...    31   5.3  
Ecym_8134 Chr8 (277019..283225) [6207 bp, 2068 aa] {ON} similar ...    32   5.4  
Ecym_7078 Chr7 complement(156495..157436) [942 bp, 313 aa] {ON} ...    31   5.5  
Smik_7.135 Chr7 (244035..244445,244446..246698) [2664 bp, 887 aa...    31   5.6  
NCAS0B01660 Chr2 complement(270046..271320) [1275 bp, 424 aa] {O...    31   5.6  
CAGL0J06512g Chr10 complement(622640..624277) [1638 bp, 545 aa] ...    31   6.0  
Suva_7.127 Chr7 (246249..246659,246660..248924) [2676 bp, 891 aa...    31   6.1  
NCAS0E03000 Chr5 (595862..598918) [3057 bp, 1018 aa] {ON} Anc_7....    31   6.2  
ACR194C Chr3 complement(690186..691727) [1542 bp, 513 aa] {ON} S...    31   6.4  
Ecym_7403 Chr7 (829923..831476) [1554 bp, 517 aa] {ON} similar t...    31   6.4  
KLLA0D08371g Chr4 (710885..712411) [1527 bp, 508 aa] {ON} simila...    31   6.4  
YBL104C Chr2 complement(18177..21293) [3117 bp, 1038 aa] {ON}  S...    31   6.4  
KAFR0C04130 Chr3 (825105..827501) [2397 bp, 798 aa] {ON} Anc_2.6...    31   6.6  
ZYRO0B12980g Chr2 complement(1045283..1048102) [2820 bp, 939 aa]...    31   6.7  
KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} simila...    31   6.8  
TPHA0I00460 Chr9 (89882..91564) [1683 bp, 560 aa] {ON} Anc_8.817...    31   6.9  
Suva_13.43 Chr13 (68221..68556,68574..69404) [1167 bp, 388 aa] {...    31   7.5  
KLLA0B04543g Chr2 (407088..409415) [2328 bp, 775 aa] {ON} simila...    31   7.6  
KAFR0A06990 Chr1 complement(1405904..1408543,1408655..1408672) [...    31   7.6  
NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {O...    31   7.7  
Kpol_1023.88 s1023 complement(208569..210197) [1629 bp, 542 aa] ...    31   7.8  
Ecym_8155 Chr8 complement(324050..325591) [1542 bp, 513 aa] {ON}...    31   7.9  
TBLA0B08930 Chr2 complement(2117704..2119536) [1833 bp, 610 aa] ...    30   8.5  
NDAI0E04600 Chr5 (1039124..1042228) [3105 bp, 1034 aa] {ON} Anc_...    31   8.6  
TDEL0A05970 Chr1 (1047306..1048733) [1428 bp, 475 aa] {ON} Anc_8...    30   9.1  
Kpol_2000.39 s2000 complement(76168..77499) [1332 bp, 443 aa] {O...    30   9.6  
CAGL0J01287g Chr10 (120215..122047) [1833 bp, 610 aa] {ON} simil...    30   9.6  
NCAS0G00690 Chr7 (116505..119162) [2658 bp, 885 aa] {ON} Anc_5.6...    30   9.7  

>KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 408

 Score =  849 bits (2193), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/408 (100%), Positives = 408/408 (100%)

Query: 1   MTEVEEPEQPTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQL 60
           MTEVEEPEQPTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQL
Sbjct: 1   MTEVEEPEQPTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQL 60

Query: 61  LRQELLIGTLTTDNEPNYLKIAAIDLPENVTSSKPSVSDDAKENELSHRQSKIKIVRKFK 120
           LRQELLIGTLTTDNEPNYLKIAAIDLPENVTSSKPSVSDDAKENELSHRQSKIKIVRKFK
Sbjct: 61  LRQELLIGTLTTDNEPNYLKIAAIDLPENVTSSKPSVSDDAKENELSHRQSKIKIVRKFK 120

Query: 121 HEQEVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPT 180
           HEQEVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPT
Sbjct: 121 HEQEVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPT 180

Query: 181 VSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTL 240
           VSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTL
Sbjct: 181 VSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTL 240

Query: 241 IIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGH 300
           IIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGH
Sbjct: 241 IIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGH 300

Query: 301 EDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSP 360
           EDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSP
Sbjct: 301 EDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSP 360

Query: 361 VNEFSHNSNVPWLMCSVEEENVLQIWKPANKIVRPPQPPADFDITTLE 408
           VNEFSHNSNVPWLMCSVEEENVLQIWKPANKIVRPPQPPADFDITTLE
Sbjct: 361 VNEFSHNSNVPWLMCSVEEENVLQIWKPANKIVRPPQPPADFDITTLE 408

>SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 398

 Score =  480 bits (1236), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 229/407 (56%), Positives = 302/407 (74%), Gaps = 13/407 (3%)

Query: 4   VEEPEQPTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLRQ 63
           +EE  +  +I EEY+LW +NVP+MYDFVSET+LTWPSLT+QWLP              +Q
Sbjct: 3   IEEENKLLSIEEEYELWKTNVPLMYDFVSETKLTWPSLTIQWLPGNSSST--------KQ 54

Query: 64  ELLIGTLTTDNEPNYLKIAAIDLPENVTSSKPSVSDDAKENELSHR--QSKIKIVRKFKH 121
           E+++GT T+  + NYLKIA+I+LPE++  ++ S + ++ E     R  QS+IKI +K KH
Sbjct: 55  EMILGTHTSGEDDNYLKIASIELPEDILGAEFSETPESTEETEQQRNVQSRIKITKKIKH 114

Query: 122 EQEVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTV 181
           E+E+TRAR+MPQ PN IAT+NG G V++FDR+ K+K+   ++  ++HK+NGYGL+FNP  
Sbjct: 115 EEEITRARFMPQDPNFIATINGVGKVFLFDRS-KDKNEALVSEHAFHKDNGYGLSFNPRT 173

Query: 182 SGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLI 241
            G+LLS SDDGT+ALW+V  T N SPS+    H DIVNDC WHEF  +LFG+VSED TL 
Sbjct: 174 KGELLSCSDDGTIALWNVMGT-NTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQ 232

Query: 242 IHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHE 301
           IHD  ++  + +L++SS FNTL FSK S+NL AAAGTDS VYLYDLR     LH+M+GHE
Sbjct: 233 IHDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHE 292

Query: 302 DSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPV 361
           DSVTSLEFSPH+DG+L SSGSDRR+++WDL  IG+EQ  +DA DGVPEL MMH GH+S V
Sbjct: 293 DSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAV 352

Query: 362 NEFSHNSNVPWLMCSVEEENVLQIWKPANKIVRPPQPPADFDITTLE 408
           N+FS N N+PWLM SVEE+N++ +WK + K+  P     D+DI +LE
Sbjct: 353 NDFSFNWNIPWLMASVEEDNIVHVWKVSKKLTSPGL-IQDYDIRSLE 398

>KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} similar
           to uniprot|P39984 Saccharomyces cerevisiae YEL056W
          Length = 398

 Score =  474 bits (1221), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 237/407 (58%), Positives = 304/407 (74%), Gaps = 19/407 (4%)

Query: 7   PEQPTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLRQELL 66
           PE   +++EEYDLW SNVP+MYDFVSET+L WPSLT+QWLP+  +  E        QEL+
Sbjct: 6   PENEVSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDRSNE--------QELI 57

Query: 67  IGTLTTDNEPNYLKIAAIDLPENVTS----SKPSVSDDAKENELSHR-QSKIKIVRKFKH 121
           +GT T+  E NYLKIA++ LP+ V S    S PS +DD+KE+   H+ QSKIKIVRKF+H
Sbjct: 58  LGTHTSGTEQNYLKIASVHLPDEVVSDVKCSAPS-TDDSKES--GHQPQSKIKIVRKFEH 114

Query: 122 EQEVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTV 181
             EVTRARY P +PN+IAT++G+G V+++DR+ K+ D    A FS+HKENGYGL F+   
Sbjct: 115 RDEVTRARYAPFNPNLIATISGSGKVFLYDRS-KDSDSALTAEFSFHKENGYGLNFSVIS 173

Query: 182 SGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLI 241
            G+LLS SDDG++A+WDV S  N +P +    H +IVN+CKWHE    LFG+VS+D+TLI
Sbjct: 174 PGELLSCSDDGSIAIWDVCSGKN-TPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLI 232

Query: 242 IHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHE 301
           IHD   D+ + K+  S  +NTLAFSK S NL AAAGTDS V LYDLR+ + P+HSM+GH 
Sbjct: 233 IHDKRIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHH 292

Query: 302 DSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPV 361
           DSVTSLEF+PH+DG+L S  SDRR+++WDLF IGAEQQ +DA DGVPEL MMH GH+SPV
Sbjct: 293 DSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPV 352

Query: 362 NEFSHNSNVPWLMCSVEEENVLQIWKPANKIVRPPQPPADFDITTLE 408
           N+FS + N+PWLM SVEEENV+QIWK + K+   P  P D++I +LE
Sbjct: 353 NDFSCSPNIPWLMASVEEENVVQIWKASKKLTS-PYIPRDYNIRSLE 398

>NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}
           Anc_6.9 YEL056W
          Length = 411

 Score =  462 bits (1188), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 223/399 (55%), Positives = 298/399 (74%), Gaps = 11/399 (2%)

Query: 3   EVEEPEQPTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLR 62
           E E+P +  +I+EEY+LW SNVP+MYDFVSETRLTWPSL+++WLP     +E   Q   R
Sbjct: 14  EEEDPNKELSIDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLP-----QEKSAQAPNR 68

Query: 63  QELLIGTLTTDNEPNYLKIAAIDLPENVTSSKPSVSDDAKENELSHRQSKIKIVRKFKHE 122
           QEL+IGT T+  E NYLKIAAIDLP ++  S   + D  K    +  +S IKI++KFKHE
Sbjct: 69  QELIIGTHTSGEEDNYLKIAAIDLPNDIIPSTEKLEDQQKGETTT--KSNIKIIKKFKHE 126

Query: 123 QEVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVS 182
           +E+TRARYMPQ+ N++AT+NG+G V+++DR+ K+K  G +++F YHKENGYGL+FN   +
Sbjct: 127 EEITRARYMPQNSNLVATINGSGKVFLYDRS-KDKHSGLVSTFEYHKENGYGLSFNCNDA 185

Query: 183 GQLLSASDDGTVALWDVTSTANKSPSQTFD-VHTDIVNDCKWHEFQSSLFGTVSEDNTLI 241
           G+LLS SDDGT+ALW+V ++ N SP   +  VH+DIVNDCKW  F  ++FG+VSED+TL 
Sbjct: 186 GKLLSGSDDGTIALWNVNNS-NSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQ 244

Query: 242 IHDTN-SDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGH 300
           +HD    D    +  V + FNTLAFSK S+ L AAAGTDS+VYL+D R + +PLHSMAGH
Sbjct: 245 LHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGH 304

Query: 301 EDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSP 360
           + +VT++EFSP QDG+L +SG DRR I+WD+ +IG EQ PDDA DG PE+ M+H GHRS 
Sbjct: 305 DGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSA 364

Query: 361 VNEFSHNSNVPWLMCSVEEENVLQIWKPANKIVRPPQPP 399
           +N+FS N N+PWLM S EEEN++Q+WK ++K+ R    P
Sbjct: 365 INDFSMNPNIPWLMASSEEENIIQVWKCSHKLPRVGGTP 403

>Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON}
           similar to Ashbya gossypii ACR017W
          Length = 397

 Score =  459 bits (1181), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 228/393 (58%), Positives = 287/393 (73%), Gaps = 17/393 (4%)

Query: 3   EVEEPEQPTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLR 62
           E+E  E P T+++EY+LW SNV +MYDFVSET+LTWPSL++QWLP+      VD    L+
Sbjct: 6   EIEHDESPLTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPS------VDANVPLK 59

Query: 63  Q-ELLIGTLTTDNEPNYLKIAAIDLPENVTSSKPSVSDDAKENELSHRQSKIKIVRKFKH 121
           Q E+++GT T+ +E NYLKIAAIDLP  V      V    ++N     +S IK+ +KF+H
Sbjct: 60  QQEMILGTHTSGDENNYLKIAAIDLPYEV------VGLPDEDNSSEPVKSMIKVTKKFEH 113

Query: 122 EQEVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTV 181
           E EV RARYMP++  IIAT+NG G ++I+DR+ K K  G   + SYHK+NGYGLAFNP +
Sbjct: 114 EDEVIRARYMPKNDKIIATINGKGKIFIYDRS-KSKSEGLCKTLSYHKDNGYGLAFNPQI 172

Query: 182 SGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLI 241
            G+LLSASDD TVALWD+ ST    P      HTDIVND KWHEF  ++FGTVSED TL 
Sbjct: 173 EGELLSASDDTTVALWDINST--DRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQ 230

Query: 242 IHDTNS-DRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGH 300
           +HD  S   + Q L V    N LAFSK S+NL+AAAGTD+ VYLYDLRRL +PLH+MAGH
Sbjct: 231 VHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGH 290

Query: 301 EDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSP 360
           +D+VTS+EFS H+DG+L SSGSDRR+ +WDL  IGAEQ  +DA DGVPEL MMH GHRS 
Sbjct: 291 QDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSA 350

Query: 361 VNEFSHNSNVPWLMCSVEEENVLQIWKPANKIV 393
           +N+FS N  VPWL+ S EE+NV+Q+WK + K+V
Sbjct: 351 INDFSFNPQVPWLIASAEEDNVVQVWKISKKLV 383

>TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9
           YEL056W
          Length = 392

 Score =  456 bits (1174), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 218/391 (55%), Positives = 281/391 (71%), Gaps = 16/391 (4%)

Query: 5   EEPEQPTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLRQE 64
           E+ ++P +I+EEY+LW SNVP+MYDFVSET LTWP+LT++WLP              RQE
Sbjct: 4   EQVDKPLSIDEEYELWRSNVPLMYDFVSETNLTWPTLTLEWLPGNSHSN--------RQE 55

Query: 65  LLIGTLTTDNEPNYLKIAAIDLPENVTSSKPSVSDDAKENELSHRQSKIKIVRKFKHEQE 124
           L++GT T++ EPNYLKIAAIDLP+ +   K     D         +S IKI++KFKHEQE
Sbjct: 56  LILGTHTSEEEPNYLKIAAIDLPDEIVPGKEDRERDG------FTKSNIKIIKKFKHEQE 109

Query: 125 VTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQ 184
           VTRARYMPQ  N+IAT+NG+G V+++DR+ K+ D G ++S  +H++NGYGL+FNP   G+
Sbjct: 110 VTRARYMPQDSNLIATINGSGTVFLYDRS-KDGDEGLLSSLGFHEDNGYGLSFNPVDKGK 168

Query: 185 LLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHD 244
           LLS SDD  +ALWD+T+ + K  S     H D VNDCKWHE   + FG+VSED TL +HD
Sbjct: 169 LLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHD 228

Query: 245 TN-SDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDS 303
               D    K+   +AFNT+AFSK S NL AAAGTDS +YLYD RR    LH+M+GHE +
Sbjct: 229 QRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESN 288

Query: 304 VTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNE 363
           VT+LEF   +DG++ SSG DRR+IMWDL  IGAEQ PDDA DG PE+ M+H GHRSPVN+
Sbjct: 289 VTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVND 348

Query: 364 FSHNSNVPWLMCSVEEENVLQIWKPANKIVR 394
           FS N N+PWLM S EEEN++Q+WK ++K+ R
Sbjct: 349 FSMNPNIPWLMASAEEENIVQVWKCSSKLPR 379

>ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 393

 Score =  456 bits (1173), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 221/390 (56%), Positives = 282/390 (72%), Gaps = 18/390 (4%)

Query: 7   PEQPTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLRQELL 66
           PE+P +I+EEYDLW SNVP+MYDFVSET LTWPSLT++WLP              RQE++
Sbjct: 7   PEKPLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSRSSN--------RQEMI 58

Query: 67  IGTLTTDNEPNYLKIAAIDLPENVTSSKPSVSDDAKENELSHRQSKIKIVRKFKHEQEVT 126
           +GT T+D E NYLKIAAI LP+ V      V D   + E    +S +KI++KF+HE EVT
Sbjct: 59  LGTHTSDEEQNYLKIAAIYLPDEV------VPDAEPKEEEEVLKSNVKIIKKFEHENEVT 112

Query: 127 RARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQLL 186
           RARYMPQ  N+IAT++G G +Y+++R   E + G +++F +H ENGYGL+FNP   G+LL
Sbjct: 113 RARYMPQDDNLIATISGVGTIYLYNR-ANEVESGLLSTFQFHNENGYGLSFNPNEKGKLL 171

Query: 187 SASDDGTVALWDVTSTANKSPSQTF-DVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDT 245
           S SDD  + LWDVT  + + P  TF D H+DIVNDCKWH F  ++FG+VSED+TL +HD 
Sbjct: 172 SGSDDSNIVLWDVTGKS-QEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQ 230

Query: 246 N-SDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSV 304
              D A++K+     +NTLAFS  S NL AAAGTDS VYLYD RR  KPLH M GHED+V
Sbjct: 231 RIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAV 290

Query: 305 TSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEF 364
           TSLEF P +DG+L S+GSDRR I+WDL  IGAEQ PDDA DG PE+ M+H GHRS +N+F
Sbjct: 291 TSLEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDF 350

Query: 365 SHNSNVPWLMCSVEEENVLQIWKPANKIVR 394
           S N N+PWL  + EEEN++Q+WKP++K+ R
Sbjct: 351 SMNPNIPWLTATAEEENIVQVWKPSSKLPR 380

>NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9
          Length = 438

 Score =  456 bits (1173), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 225/393 (57%), Positives = 292/393 (74%), Gaps = 19/393 (4%)

Query: 12  TINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLRQELLIGTLT 71
           TI+EEYDLW SNVP+MYDFVSET+LTWP+LTV+WLP+      V      RQEL++GT T
Sbjct: 38  TIDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSN----RQELILGTHT 93

Query: 72  TDNEPNYLKIAAIDLPENVTSSKPSVSDDAKEN--------ELSHRQSKIKIVRKFKHEQ 123
           +  E NYLKIAAIDLP+ V   +PS +    +         +    +S IKIV+KFKHE+
Sbjct: 94  SGEEDNYLKIAAIDLPDEVV--QPSTNSLKAQREDDEDEDDQKQKPRSNIKIVKKFKHEE 151

Query: 124 EVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSG 183
           E+TRAR+MPQ+ +IIAT+NG+G V+I++++  +K    I++  +HKENGYGL+FNP   G
Sbjct: 152 EITRARFMPQNTDIIATINGSGTVFIYNQS-NDKQSALISTLRFHKENGYGLSFNPNDKG 210

Query: 184 QLLSASDDGTVALWDV--TSTANKSPSQTFD-VHTDIVNDCKWHEFQSSLFGTVSEDNTL 240
           +LLS SDDGT+ALWD+   ST  K P + +D VH DIVNDCKW+EF S++F +VSED+TL
Sbjct: 211 KLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTL 270

Query: 241 IIHDTN-SDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAG 299
            +HD    +  I  +  +  FNTLAFSK S+ L+AAAGTDS VYLYD R L  PL+SM G
Sbjct: 271 QLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNG 330

Query: 300 HEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRS 359
           HEDS+T+LEFSPH DG+L SSG+DRR+IMWD+ +IGAEQ PDDA DG PE+ M+H GHRS
Sbjct: 331 HEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRS 390

Query: 360 PVNEFSHNSNVPWLMCSVEEENVLQIWKPANKI 392
            VN+FS N N+PWLM S EEEN++Q+WK ++K+
Sbjct: 391 AVNDFSINPNIPWLMASAEEENIIQVWKCSHKL 423

>ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL056W (HAT2)
          Length = 423

 Score =  448 bits (1153), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 223/400 (55%), Positives = 277/400 (69%), Gaps = 18/400 (4%)

Query: 9   QPTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLRQELLIG 68
           Q  T+ EEY+LW SNVP+MY+FVSET+LTWPSLT+QWLP++ Q  E        Q L+ G
Sbjct: 40  QSLTVEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPSDGQSPE--------QSLIFG 91

Query: 69  TLTTDNEPNYLKIAAIDLPENVTSSKPSVSDDAKENELSHRQSKIKIVRKFKHEQEVTRA 128
           T T   E NYLK+A I+LP  +        D   E + ++  S   I  KF H +EV RA
Sbjct: 92  THTAGEEVNYLKVATINLPAGIAGL-----DQGDEEDEANDHSSFAIANKFPHIEEVIRA 146

Query: 129 RYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQLLSA 188
           RYMP + NIIAT+NG G + IFDR ++E     +++ ++HKENGYGLAFNP +SG+LLS 
Sbjct: 147 RYMPANSNIIATINGKGTISIFDRTLEES-KAQVSTLAFHKENGYGLAFNPHISGELLSG 205

Query: 189 SDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSD 248
           SDD TVALWD+   A K P      H DIVND KWHEF+S++FGTVSED TL +HD    
Sbjct: 206 SDDTTVALWDIE--AAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVR 263

Query: 249 -RAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSL 307
              ++KL  +S FNTL+FSK S NLLAAAG DS +YLYD+R +  PLH M+GH+DSVT++
Sbjct: 264 LEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTV 323

Query: 308 EFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHN 367
           EFSPH DG++ SSGSDRR I+WDL  IGAEQ  DDA DG PEL MMH GHRSPVNEFS N
Sbjct: 324 EFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFN 383

Query: 368 SNVPWLMCSVEEENVLQIWKPANKIVRPPQPPADFDITTL 407
             +PWL+ S EE+NV+Q WK + K+V    PPA  D + L
Sbjct: 384 PQIPWLLASTEEDNVIQAWKVSMKLVN-ASPPAISDPSLL 422

>Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON}
           (183046..184224) [1179 nt, 393 aa]
          Length = 392

 Score =  446 bits (1148), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 214/401 (53%), Positives = 286/401 (71%), Gaps = 19/401 (4%)

Query: 1   MTEVEEPEQPTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQL 60
           M    E E+P T+++EY+LW +NVP+MYDFVSETRLTWPSLT QWLP          ++ 
Sbjct: 1   MEAQREQEEPLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPG--------SEED 52

Query: 61  LRQELLIGTLTTDNEPNYLKIAAIDLPENVTSSKPSVSDDAKENELSHRQSKIKIVRKFK 120
            RQ +++GT T+  E +YLK+AA+DLP+ V + +   +DD +       +S IKIV+KF+
Sbjct: 53  TRQYMILGTHTSGEEVDYLKVAALDLPDEVVTGE--ANDDNRRT-----KSNIKIVKKFE 105

Query: 121 HEQEVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPT 180
           H+ E+ RARYMP+  NIIAT+NG G V I+DR+ K +  G   +  YHKENGYGL+FNP 
Sbjct: 106 HDGEINRARYMPKDSNIIATINGEGNVSIYDRS-KSRSDGLRTTLKYHKENGYGLSFNPN 164

Query: 181 VSGQLLSASDDGTVALWDVTSTANKSPSQTFD-VHTDIVNDCKWHEFQSSLFGTVSEDNT 239
           VS +L+S SDD T+ALWD+ S  +KSP   +D +H+DIVNDC WH F  +LFG+VSED+T
Sbjct: 165 VSNELISGSDDFTIALWDIDS-GSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDST 223

Query: 240 LIIHDTNS-DRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMA 298
           L +HD  S  + I  +   +AFNTLAFSK S NL AAAG D+N+YLYD R+  KPLH MA
Sbjct: 224 LKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMA 283

Query: 299 GHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHR 358
           GHED++T L+F P +DG+L S G+DRR+I+WDL  IGAEQQPD+A DG PE+ M+H GHR
Sbjct: 284 GHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHR 343

Query: 359 SPVNEFSHNSNVPWLMCSVEEENVLQIWKPANKIVRPPQPP 399
           S +N+F+ +  +PWL  SVEE+NV+Q+WK +  + R    P
Sbjct: 344 SAINDFTLHPTIPWLSASVEEDNVVQVWKCSKNLSRVGGTP 384

>KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {ON}
           Anc_6.9 YEL056W
          Length = 414

 Score =  445 bits (1144), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 216/397 (54%), Positives = 286/397 (72%), Gaps = 14/397 (3%)

Query: 9   QPTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLRQELLIG 68
           +P   +EEYDLW SNVPMMYDFVSETRL WPSLTVQWLP    P  V      RQEL++G
Sbjct: 29  RPLDPSEEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLP-HSAPNPV-----TRQELILG 82

Query: 69  TLTTDNEPNYLKIAAIDLPENVTSSKPSVSDDAKENELSHRQSKIKIVRKFKHEQEVTRA 128
           T T+D E NYLKIA +DLP  VT +      +  E++    +S I++ RKFKH+ EVTRA
Sbjct: 83  THTSDEEQNYLKIAVVDLPTEVTDTS-----NLTESDEEQVRSNIRVTRKFKHDSEVTRA 137

Query: 129 RYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQLLSA 188
           RYMPQ PNI+AT++G G VYI+DR+  E+D  +I +  YH +NGYGLAFNP + G LLS 
Sbjct: 138 RYMPQDPNILATISGTGTVYIYDRS-NERDTASI-TLQYHTDNGYGLAFNPLIKGHLLSG 195

Query: 189 SDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSD 248
           SDD  VALWDVTS  N+   +  ++H+DIVNDC+WH FQ SLFGTVSED++L IHDT   
Sbjct: 196 SDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRES 255

Query: 249 RAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLE 308
           + +  ++ +  FNTL+FS  SENLLA  G +S VYLYD R +++PLH M+GH D+VTSL+
Sbjct: 256 KPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLD 315

Query: 309 FSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNS 368
           FS   DG++ S+G+D+R+I+WD+ +IGAEQ  +DA D   E+ M+H GHRSP+N+F+ N 
Sbjct: 316 FSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINP 375

Query: 369 NVPWLMCSVEEENVLQIWKPANKIVR-PPQPPADFDI 404
           ++PWL+ S EEEN++Q+WK ++K+ R    PP   D+
Sbjct: 376 SIPWLVASAEEENIVQLWKCSHKLPRISGTPPVRVDM 412

>Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score =  444 bits (1142), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 221/401 (55%), Positives = 291/401 (72%), Gaps = 13/401 (3%)

Query: 4   VEEPEQPTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLRQ 63
           +E  E+P +++EEYDLW SNVP+MYDFVSETRLTWPSLTVQWLPT +Q  E      ++Q
Sbjct: 1   METQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPE---GGFIKQ 57

Query: 64  ELLIGTLTTDNEPNYLKIAAIDLPENVTSSKPSVSDDAKENELSHR--QSKIKIVRKFKH 121
           EL+IGT T+  E NYLK A I+LP+ + +++    +  +++E+S    +S IKI  K+KH
Sbjct: 58  ELIIGTHTSGEEENYLKFAEINLPKEILNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKH 117

Query: 122 EQEVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTV 181
           E+E+TRARYMPQ+P  +AT+NG G V+I+ R+      G  ++  +H+ENGY L+F+P V
Sbjct: 118 EEEITRARYMPQNPGTVATINGQGTVFIYSRS-----EGLQSTLKFHEENGYALSFSPLV 172

Query: 182 SGQLLSASDDGTVALWDVTSTANKS-PSQTF-DVHTDIVNDCKWHEFQSSLFGTVSEDNT 239
            G LLS SDD TVALWDV   ++ + P +T+ D+H+DIVND KWH F   LFGTVSED+ 
Sbjct: 173 EGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSL 232

Query: 240 LIIHDTNSDRAIQKLS-VSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMA 298
           L I+D   +      +     FNTLAFS  S NLLAAAGTDS+VYLYDLR +++PLH M+
Sbjct: 233 LKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMS 292

Query: 299 GHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHR 358
           GHED+VT+LEFSPH DG++ SSGSD R+IMWDL  IGAEQ PDDA DGVPEL M+H GH+
Sbjct: 293 GHEDAVTNLEFSPHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHK 352

Query: 359 SPVNEFSHNSNVPWLMCSVEEENVLQIWKPANKIVRPPQPP 399
           S VN+F  N+ +PWL+ S EEEN+LQ+WK ++ +     PP
Sbjct: 353 SAVNDFDLNAQIPWLVASTEEENILQVWKCSHSLPVVGGPP 393

>Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score =  439 bits (1128), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 217/395 (54%), Positives = 289/395 (73%), Gaps = 15/395 (3%)

Query: 4   VEEPEQPTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQ-PREVDGQQLLR 62
           +E  E+P +++EEYDLW SNVP+MYDFVSETRLTWPSLTVQWLPT +Q P+       ++
Sbjct: 1   MEGQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPK----GGFIK 56

Query: 63  QELLIGTLTTDNEPNYLKIAAIDLPENVTSSK--PSVSDDAKENELSHRQSKIKIVRKFK 120
           QEL+IGT T+  E NYLK A I+LP+ V +++     ++   E  L   +S I+I  K++
Sbjct: 57  QELIIGTHTSGEEENYLKFAEINLPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYE 116

Query: 121 HEQEVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPT 180
           HE+E+TRARYMPQ PN++AT+NG G V+++ R+      G  ++  +HK+NGY L+F+P 
Sbjct: 117 HEEEITRARYMPQDPNMVATINGQGTVFLYSRS-----DGLQSTLKFHKDNGYALSFSPL 171

Query: 181 VSGQLLSASDDGTVALWDVTSTANKS-PSQTFD-VHTDIVNDCKWHEFQSSLFGTVSEDN 238
           + G LLS SDD +VALWDV+  ++ + P +T+D +H+DIVND KWH F   LFGTVSED+
Sbjct: 172 IKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDS 231

Query: 239 TLIIHDTNSDRA-IQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSM 297
            L I+D  ++   I        FNTLAFS  S N+LAAAG DS+VYLYDLR +++PLH M
Sbjct: 232 LLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHM 291

Query: 298 AGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGH 357
           +GHED+VT+LEFSPH DG++ SSGSD R+IMWDL  IGAEQ PDDA DGVPEL M+H GH
Sbjct: 292 SGHEDAVTNLEFSPHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGH 351

Query: 358 RSPVNEFSHNSNVPWLMCSVEEENVLQIWKPANKI 392
           RS VN+F  N+ VPWL+ S EEEN+LQ+WK ++ +
Sbjct: 352 RSAVNDFDLNAQVPWLIASTEEENILQVWKCSHSL 386

>YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit of
           the Hat1p-Hat2p histone acetyltransferase complex;
           required for high affinity binding of the complex to
           free histone H4, thereby enhancing Hat1p activity;
           similar to human RbAp46 and 48; has a role in telomeric
           silencing
          Length = 401

 Score =  437 bits (1125), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 219/401 (54%), Positives = 290/401 (72%), Gaps = 13/401 (3%)

Query: 4   VEEPEQPTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLRQ 63
           +E  E+P +++EEYDLW SNVP+MYDFVSETRLTWPSLTVQWLPT +Q  E+DG   ++Q
Sbjct: 1   MENQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQ--ELDGG-FIKQ 57

Query: 64  ELLIGTLTTDNEPNYLKIAAIDLPENVTSSKPSVSDDAKE--NELSHRQSKIKIVRKFKH 121
           EL+IGT T+  E NYLK A I+LP+ + S++    +  +E  + L   +S I+I  K++H
Sbjct: 58  ELIIGTHTSGEEENYLKFAEINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEH 117

Query: 122 EQEVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTV 181
           E+E+TRARYMPQ PNI+AT+NG G V+++ R+      G  ++  +HK+NGY L+F+  V
Sbjct: 118 EEEITRARYMPQDPNIVATINGQGTVFLYSRS-----EGLQSTLKFHKDNGYALSFSTLV 172

Query: 182 SGQLLSASDDGTVALWDVTSTANKS-PSQTF-DVHTDIVNDCKWHEFQSSLFGTVSEDNT 239
            G+LLS SDD TVALW+V S  + + P +T+ D+H+DI+ND KWH F   LFGTVSED+ 
Sbjct: 173 KGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSL 232

Query: 240 LIIHDTNSDRA-IQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMA 298
           L I+D  ++   I  +     FNTLAFS  S NLLAAAG DS VYLYDLR +++PLH M+
Sbjct: 233 LKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMS 292

Query: 299 GHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHR 358
           GHED+V +LEFS H DG++ SSGSD R++MWDL  IGAEQ PDDA DGVPEL M+H GHR
Sbjct: 293 GHEDAVNNLEFSTHVDGVVVSSGSDNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHR 352

Query: 359 SPVNEFSHNSNVPWLMCSVEEENVLQIWKPANKIVRPPQPP 399
           S VN+F  N  +PWL+ S EEEN+LQ+WK ++ +     PP
Sbjct: 353 SSVNDFDLNPQIPWLVASAEEENILQVWKCSHSLPIVGGPP 393

>Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)
          Length = 427

 Score =  438 bits (1127), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 220/402 (54%), Positives = 294/402 (73%), Gaps = 15/402 (3%)

Query: 4   VEEPEQPTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLRQ 63
           +E  E+  +++EEYDLW SNVP+MYDFVSETRLTWPSL+VQWLPT +Q  E +G   +RQ
Sbjct: 27  METQEKALSVDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQ--EAEGG-FIRQ 83

Query: 64  ELLIGTLTTDNEPNYLKIAAIDLPENVTSSKPSVSDDAKENE---LSHRQSKIKIVRKFK 120
           EL+IGT T+  E NYLK A I++P+ + +++    ++A+E++   L+  +S I+I  K+ 
Sbjct: 84  ELIIGTHTSGEEENYLKFAEINIPKEILNNQDP-QEEAEEDDKATLNAPKSNIRITAKYV 142

Query: 121 HEQEVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPT 180
           HE+E+TRARYMPQ+P+ +ATLNG G V+++ R+      G  ++  +HK+NGY L+FN  
Sbjct: 143 HEEEITRARYMPQNPDFVATLNGQGTVFLYSRS-----GGLQSTLKFHKDNGYALSFNAL 197

Query: 181 VSGQLLSASDDGTVALWDVTSTANK-SPSQTF-DVHTDIVNDCKWHEFQSSLFGTVSEDN 238
           V GQLLS SDD TVALW+V S +   SP +T+ D+H+DIVND KWH F   LFGTVSED+
Sbjct: 198 VEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDS 257

Query: 239 TLIIHDTNS-DRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSM 297
            L I+D  + +  I  +     FNTLAFS  S NLLAAAG DS+VYLYDLR +++PLH M
Sbjct: 258 LLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHM 317

Query: 298 AGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGH 357
           +GHED+VT++EFS H DG++ SSGSD R+IMWDL  IGAEQ PDDA DGVPEL M+H GH
Sbjct: 318 SGHEDAVTNIEFSTHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGH 377

Query: 358 RSPVNEFSHNSNVPWLMCSVEEENVLQIWKPANKIVRPPQPP 399
           RS VN+F  N+ +PWL+ S EEEN+LQ+WK ++ +     PP
Sbjct: 378 RSSVNDFDLNAQIPWLVASSEEENILQVWKCSHNLPIVGGPP 419

>Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON}
           YEL056W (HAT2) - subunit of a cytoplasmic histone
           acetyltransferase [contig 186] FULL
          Length = 396

 Score =  435 bits (1119), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 219/403 (54%), Positives = 294/403 (72%), Gaps = 11/403 (2%)

Query: 6   EPEQPTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLRQEL 65
           EPE+  +I++EYDLW SNVP+MYDFVSETRL WPSLT+QWLP     R  D  +   QEL
Sbjct: 5   EPERELSIDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLP-----RAEDSTE---QEL 56

Query: 66  LIGTLTTDNEPNYLKIAAIDLPENVTSSKPSVSDDAKENELSHRQSKIKIVRKFKHEQEV 125
           L+GT T+D+E NYLKIA I+LP+ + S++  V  +          SKIKI++KFKHE EV
Sbjct: 57  LVGTHTSDSEQNYLKIAEINLPQEILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEV 116

Query: 126 TRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQL 185
           TRARY P   N+IAT++G G V+++DR  K+ ++     ++YHKENGYGL F+    G+L
Sbjct: 117 TRARYAPFDSNLIATISGTGTVFLYDRT-KDDENALRGKYAYHKENGYGLNFSVASPGEL 175

Query: 186 LSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDT 245
           +S SDDG++A+WD+ S     P+    +H+DIVN+CKWHE   +++G+VSED+ L+IHD 
Sbjct: 176 ISCSDDGSIAIWDIKS-GKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDK 234

Query: 246 NSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVT 305
            S++ +QKL     FNT+AFSK S NL AAAGTD+ VYL+D R+  + LHSM+GH+++VT
Sbjct: 235 RSEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVT 294

Query: 306 SLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFS 365
           SLEF+ H+DG+L S GSDRR+++WDLF IG EQQ +DA DG PEL MMH GH+S +N+FS
Sbjct: 295 SLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFS 354

Query: 366 HNSNVPWLMCSVEEENVLQIWKPANKIVRPPQPPADFDITTLE 408
            + NVPWLM SVEEEN++QIWKP+ K+  P  P   +DI +LE
Sbjct: 355 FSPNVPWLMASVEEENIVQIWKPSRKLTNPYFPQG-YDIRSLE 396

>TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON}
           Anc_6.9 YEL056W
          Length = 391

 Score =  432 bits (1112), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 212/410 (51%), Positives = 291/410 (70%), Gaps = 21/410 (5%)

Query: 1   MTEVEEPEQPTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQL 60
           M +VE+ E+P T+++EYDLW SNVP++YDFVSETRLTWPSLT+QWLP +        +  
Sbjct: 1   MEKVEQQEEPLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGD--------KTS 52

Query: 61  LRQELLIGTLTTDNEPNYLKIAAIDLPENVTSSKPSVSDDAKENELSHRQSKIKIVRKFK 120
            RQ L++GTLT+  E +YLKIAA+DLP+ +   K S  D          +S +K+V+KF 
Sbjct: 53  TRQHLILGTLTSGAETDYLKIAALDLPDEIIIGKKS--DKV-------VKSNLKVVKKFA 103

Query: 121 HEQEVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPT 180
           H+ E+ RARYMPQ+ NIIAT+NG G ++I+D + ++K    +++  YHK+N YGLAFNP 
Sbjct: 104 HDGEINRARYMPQNTNIIATVNGEGTIFIYDCS-RDKQSALLSTLKYHKDNAYGLAFNPN 162

Query: 181 VSGQLLSASDDGTVALWDVTSTANKSPSQTFDV-HTDIVNDCKWHEFQSSLFGTVSEDNT 239
             G+L+S SDD T+ALWD T+   K P Q +   H+DIVNDC+WH F +++FG+VSED+T
Sbjct: 163 AEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDST 222

Query: 240 LIIHDT-NSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMA 298
           L + D  N  ++  K+S    +N++AFS  SENL AAAGT +N+YLYD+R   K LHSM 
Sbjct: 223 LQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMT 282

Query: 299 GHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHR 358
           GHE+ VTSLEFS  +DG+L S  SDRR+IMWDLF IGAEQQPD+A DG+PE+ M+H G R
Sbjct: 283 GHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSR 342

Query: 359 SPVNEFSHNSNVPWLMCSVEEENVLQIWKPANKIVRPPQPPADFDITTLE 408
           S +N+ S + ++PWL  SVEE N++Q+WK ++K+ R    P +  I+ LE
Sbjct: 343 SAINDISTHPSIPWLNASVEENNIVQVWKCSSKLPRISGTP-EVSISDLE 391

>KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9
           YEL056W
          Length = 391

 Score =  415 bits (1066), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 209/393 (53%), Positives = 283/393 (72%), Gaps = 22/393 (5%)

Query: 5   EEPEQPTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLRQE 64
           +E E+  +I+EEY LW SNVP+MYDFVSET+LTWPSLTV+WLP + Q        L +QE
Sbjct: 4   QEEERELSIDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQ------APLTQQE 57

Query: 65  LLIGTLTTDNEPNYLKIAAIDLPENVTSSKPSVSDDAKENELSHRQSKIKIVRKFKHEQE 124
           ++IGT T+D EPNY+KIA+I+LP  V     +VSD       +  +S ++I +KFK E+E
Sbjct: 58  MIIGTHTSDQEPNYVKIASIELPNEVIDPH-NVSD-------APVKSNVRITKKFKLEKE 109

Query: 125 VTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQ 184
           +TR+RYM Q PNII+T++G G V IFDRN  +     + ++SYHK+NGYGL+FNP   GQ
Sbjct: 110 ITRSRYMVQDPNIISTIDGNGTVSIFDRNSSD---SPVKTYSYHKDNGYGLSFNPISKGQ 166

Query: 185 LLSASDDGTVALWDVTSTANKSPSQTFDVHTD--IVNDCKWHEFQSSLFGTVSED-NTLI 241
           LLSA+DDG +A++D+ + + + P +T+   TD  I+ND KWH F ++LFGTVSE+ NTL 
Sbjct: 167 LLSAADDGYIAMYDINAES-EDPVETWQ-STDNCIINDIKWHHFDATLFGTVSEEKNTLS 224

Query: 242 IHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHE 301
           I+D  +   +  + +   FN+LAFSK S+NL +AAGTD NVYLYDLR  +K LHSM+GHE
Sbjct: 225 IYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHE 284

Query: 302 DSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPV 361
             VT+LEF    DG+L SS  DRRII+WDL  IG+EQ  +DA D  PEL M+H GHRS V
Sbjct: 285 GPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSV 344

Query: 362 NEFSHNSNVPWLMCSVEEENVLQIWKPANKIVR 394
           N+FS NS++PWL+ S EEEN++Q+WK ++++ R
Sbjct: 345 NDFSLNSSIPWLIASTEEENIIQVWKSSSRLPR 377

>CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056w HAT2
          Length = 419

 Score =  405 bits (1041), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 205/400 (51%), Positives = 279/400 (69%), Gaps = 12/400 (3%)

Query: 9   QPTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLRQELLIG 68
           +P T++EEY+LW SNVPM+YDFVSETRLTWP+LTV+WLP   Q   V  +   RQ+L++G
Sbjct: 26  EPMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLP---QKNLVAART--RQQLILG 80

Query: 69  TLTTDNEPNYLKIAAIDLPENVT-SSKPSVSDDAKENELSHRQSKIKIVRKFKHEQEVTR 127
           T T+  E NYLKI A+DLP  VT +SK     D ++ ++    S +KIV+KF H+ E+TR
Sbjct: 81  THTSGEEQNYLKIGAVDLPVEVTENSKKDREIDEEDEDMV--LSNVKIVKKFPHDGEITR 138

Query: 128 ARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQLLS 187
           ARYMPQ  NIIAT+NG G ++I+DR+ K      +++  YH ENGYGLAFN      LLS
Sbjct: 139 ARYMPQDDNIIATINGEGKIFIYDRS-KNGVEALLSTLEYHTENGYGLAFNANEKYSLLS 197

Query: 188 ASDDGTVALWDVTS-TANKSPSQTF-DVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDT 245
            SDD  +ALWD+++   N  P+ TF D HTDI+ND KWH  ++ +FG+VSED+T+ + D 
Sbjct: 198 GSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDK 257

Query: 246 NSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVT 305
            S + I  ++    +NTLAFS  S NL AAAGTD+ VYLYD+R +  PL++M GHED+VT
Sbjct: 258 RSSQIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVT 317

Query: 306 SLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFS 365
           ++EF P+ DG+L SSGSDRR I+WDL  IGAEQ  D+  DG PE+ M+H GH++ +N+ +
Sbjct: 318 AIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIA 377

Query: 366 HNSNVPWLMCSVEEENVLQIWKPANKIVR-PPQPPADFDI 404
            N N+ WL+ S EE+N++QIWK ++ I R   +P  D  I
Sbjct: 378 VNPNINWLVASAEEDNIVQIWKCSSNIPRIGGEPEVDLSI 417

>TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa]
           {ON} Anc_6.9 YEL056W
          Length = 407

 Score =  388 bits (996), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 200/401 (49%), Positives = 267/401 (66%), Gaps = 22/401 (5%)

Query: 4   VEEPEQPTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLRQ 63
           ++E E+P T ++EY+LW SNVP++YDFVSET+L WPSLTV+WLP+     E        Q
Sbjct: 13  IKEEEEPLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPS----NETTNLPSNEQ 68

Query: 64  ELLIGTLTTDNEPNYLKIAAIDLPENVTSSKPSVSDDAKENELSHRQSKIKIVRKFKHEQ 123
            LL+GT T+  E NYLKIA I LP+ + + K       ++N   H +S I+I++KFKHE 
Sbjct: 69  RLLLGTHTSGEEQNYLKIAEITLPDQIINEK------TEDNSDKHVKSNIRIIKKFKHEL 122

Query: 124 EVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIAS-FSYHKENGYGLAFNPTVS 182
           EVTRA YMPQ   IIAT+NG G V+I+D +I E     I S  S+HKENGYGLAFNP   
Sbjct: 123 EVTRAHYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDK 182

Query: 183 GQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLII 242
           G+LLS+SDDG+VA W++  +    P  T    T I+ND +W++F  +LFG V+E + L +
Sbjct: 183 GKLLSSSDDGSVAYWNIQKSI---PLLTLQ-ETSIINDVRWNQFNQNLFGYVTESSCLNL 238

Query: 243 HDT---NSDRAI---QKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHS 296
            D    N+D  I     +   SAFN +AFS  SE L+AA+G DS +YLYD R L +PLH 
Sbjct: 239 KDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHY 298

Query: 297 MAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDG-VPELFMMHG 355
           M GHEDSVTSL+F    DG++ S GSD+R+ +WDL  IG EQ  D+  DG VPEL M+H 
Sbjct: 299 MRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHA 358

Query: 356 GHRSPVNEFSHNSNVPWLMCSVEEENVLQIWKPANKIVRPP 396
           GHRSP+N+FS ++N+ WL  S+EE+N++Q+WK  N +   P
Sbjct: 359 GHRSPINDFSMSNNLNWLCASIEEDNIVQVWKMNNSLREDP 399

>Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa]
           {ON} complement(104336..105589) [1254 nt, 418 aa]
          Length = 417

 Score =  164 bits (414), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 128/437 (29%), Positives = 208/437 (47%), Gaps = 67/437 (15%)

Query: 1   MTEV---EEP-EQPTTINEE----YDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQP 52
           M EV   E+P EQ + I +E    Y  W  N  ++Y++++     WPSLT Q+ P ++  
Sbjct: 1   MIEVIMDEQPFEQSSAIPKERQDRYTTWKKNTKLLYEYLNTNSNKWPSLTCQFFP-DVNT 59

Query: 53  REVDGQQLLR----------QELLIGTLTTDNEPNYLKIAAIDLPENVTSSKPSVSDDAK 102
           +    + LL           + L I  ++T    ++  +   DL E     KP    D  
Sbjct: 60  KNDSHRILLSSFTSSLVPEDESLYITRISTLKHLSWASLNNFDLDE--MEFKP----DNS 113

Query: 103 ENELSHRQSKIKIVRKFKHEQEVTRARYMPQSPNIIATLNGAGIVYIFDRN-----IKEK 157
             +L  +    ++V +F +  +  RARY+PQ+P++IA  +  G VYIFDR      +  +
Sbjct: 114 NIKLPPKNLTTELVIRFPN-GDCNRARYLPQNPDLIAAASSDGSVYIFDRTKHGTAMHSR 172

Query: 158 DHGAIASF-----------SYHKEN-GYGLAFNPTVSGQLLSASDDGTVALWDVTSTAN- 204
             G   S+           S + EN    + +N    G L+ A  DG V  WD+T     
Sbjct: 173 QSGFTQSYQAKLAVNNNSQSLNGENEALTIDWNHQKEGHLVVAYSDGHVKAWDITKYKRS 232

Query: 205 ----KSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVS--- 257
               K+P   + +     ND  W    +SLF   SEDN L + DT  +  I  +S S   
Sbjct: 233 DPVIKAPEYNYKLDESGCNDAVWMPEHNSLFAACSEDNRLSLFDTRDESNIIDISTSVHK 292

Query: 258 SAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLL 317
              N   F+ R+  LLA+  +  N+ L+D+R+ + P++ +  H  S++++E++P+   +L
Sbjct: 293 GGINACRFNPRNSLLLASGDSIGNICLWDIRKKETPIN-ILDHGSSISTIEWNPNLSTVL 351

Query: 318 TSSGSDRRII-MWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPWLMCS 376
            S+G D  ++ +WD               G  +   +HGGH   VN+ S N + PWLMCS
Sbjct: 352 ASAGQDDGLVKLWDA--------------GSDKPVFIHGGHMLGVNDISWNMHDPWLMCS 397

Query: 377 VEEENVLQIWKPANKIV 393
           V ++N +QIWKPA+ +V
Sbjct: 398 VSKDNSIQIWKPAHNLV 414

>TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score =  157 bits (398), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 118/435 (27%), Positives = 210/435 (48%), Gaps = 68/435 (15%)

Query: 6   EPEQPTTIN----EEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLL 61
           E E  T+I+    + Y  W  N  ++YD+++     WPSLT Q+ P   +  +       
Sbjct: 2   EIENSTSISNDLQQRYSHWKKNTKLLYDYLNTNSNKWPSLTCQFFPDIDKSNDT------ 55

Query: 62  RQELLIGTLTTDNEPN--YLKIAAIDLPENVT-SSKPSVSDDAKENELSHR-----QSKI 113
              LL+ T T+   P+   + I+ I    ++  SS  +   D  E +  +R     ++ I
Sbjct: 56  -HRLLLSTFTSSQIPDDESIYISHISTLNHLDWSSLNNFDMDEMEFKPDNRIKFPSKNLI 114

Query: 114 KIVRKFKHEQEVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHK---- 169
             +     E +  +ARYMPQ+P+II   +  G +YIFDR  +        S  +      
Sbjct: 115 TDISITFPEGDCNKARYMPQNPDIIGCASSNGCIYIFDRTKRGSKLSTTTSARFSSGSKA 174

Query: 170 -------------ENG--------YGLAFNPTVSGQLLSASDDGTVALWDVT---STANK 205
                        E+G          +A+NP   GQLLS   +G + LWD     S+ N+
Sbjct: 175 YEAKLAKQRKFVIEDGTKNDEFECLSIAWNPQQEGQLLSCESNGNIHLWDFQKEFSSKNR 234

Query: 206 SPSQT-FDVHTDIV--NDCKWHEFQSSLFGTVSEDNTLIIHDTNSD---RAIQKLSVSSA 259
             + T +D + D +  N+  W    +S+F T  E+N + + DT  +    +I++ + +  
Sbjct: 235 EINNTIWDTNFDDLGCNEVTWMNGHNSIFATCGENNKMAVFDTRKEGIVNSIEQGNHNGG 294

Query: 260 FNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTS 319
            N+  F+  +  LLA+  ++  + L+D+R+L KP+ ++  H  S++++E+SP  + ++ S
Sbjct: 295 INSCKFNYENAMLLASGDSNGIINLWDIRKLNKPIRNLY-HGSSISTIEWSPLMNEMIAS 353

Query: 320 SGSDRRII-MWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPWLMCSVE 378
            G +  ++ +WD+ N   E++P            +HGGH   +N+ S + + PWL+CSV 
Sbjct: 354 GGQEDGLVKLWDISN---EEEP----------IFIHGGHMLGINDLSWDLHDPWLLCSVG 400

Query: 379 EENVLQIWKPANKIV 393
            +N +QIWKPA  +V
Sbjct: 401 SDNSIQIWKPAKHLV 415

>AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR195C
           (MSI1)
          Length = 417

 Score =  156 bits (394), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 119/426 (27%), Positives = 203/426 (47%), Gaps = 55/426 (12%)

Query: 5   EEPEQPTTINEE----YDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQL 60
           E P+  + I++E    Y  W  N  ++YD+++     WPSLT Q++P    P +      
Sbjct: 9   EVPQVSSEISDELQQRYTNWKKNTKLLYDYLNTNSTKWPSLTCQFMPDLEVPTD------ 62

Query: 61  LRQELLIGTLTTDNEPN--YLKIAAIDLPENVT-SSKPSVSDDAKENELSHR-----QSK 112
            +  LL+ + T+   P    + I+ +    +V  SS  +   D  E ++ ++     ++ 
Sbjct: 63  -KHRLLLSSFTSSQLPEDEAVYISELSTMRHVPWSSLNNFDMDEMEFKVDNQAKLPNKNL 121

Query: 113 IKIVRKFKHEQEVTRARYMPQSPNIIATLNGAGIVYIFDRNI----KEKDHGAIASFSYH 168
           ++ VR      +  RA YMPQ+P+II  +   G V IFDR      + K  G+ AS+   
Sbjct: 122 VETVRIQFPSGDCNRACYMPQNPDIIGAIASTGAVNIFDRTKHGTNRPKLLGSAASYEIQ 181

Query: 169 -----------KENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQT---FDVH 214
                            LA+N   +G + S+  +G + +WD+T      P+ +     + 
Sbjct: 182 LNEPESLGDADSAEALSLAWNWQKAGIIASSYSNGLIKVWDITRYQKSQPTISNPELRIL 241

Query: 215 TDIV--NDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVS---SAFNTLAFSKRS 269
            D    ND  W    SS+     E NT+ + DT +  A +    S      N L F+  +
Sbjct: 242 QDKAGTNDVSWMVHHSSILAACGESNTIGLLDTRAPDAFKPTKASPHTGGINALQFNYAN 301

Query: 270 ENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSG-SDRRIIM 328
           + LL AA ++  + L+D R   KPL S+  H DSV++L+++P+   ++ ++G  D  I +
Sbjct: 302 DMLLCAADSNGGIALWDCRAFSKPL-SVFNHGDSVSALQWNPNLPTIVATAGQGDGLIKI 360

Query: 329 WDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENVLQIWKP 388
           WD       ++P+D+      L  +HGGH   VN+ + N + PWLMCSV  +N + +WKP
Sbjct: 361 WD-----TSREPEDS------LLFVHGGHMLGVNDIAWNYHDPWLMCSVANDNSVHVWKP 409

Query: 389 ANKIVR 394
           A  +V+
Sbjct: 410 AANLVQ 415

>Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to
           Ashbya gossypii AEL250C
          Length = 414

 Score =  152 bits (384), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 113/414 (27%), Positives = 195/414 (47%), Gaps = 52/414 (12%)

Query: 10  PTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLRQELLIGT 69
           P  + + Y  W  N  ++Y++++     WPSLT Q++P      +       +  +L+ +
Sbjct: 18  PEPLQQRYTNWKKNTRLLYEYLNTNSTKWPSLTCQFMPDMDIASD-------KHRILLSS 70

Query: 70  LTTDNEPN--YLKIAAIDLPENVTSSKPSVSDDAKENELSHRQSKIKIVRKFKH------ 121
            T+   P    + I+ I   +++  S  S+++   E       +++K+ +          
Sbjct: 71  FTSAQLPEDEAIYISEISTMKHIAWS--SLNNFHMEEMEFKVDNQVKLSKNLTETIKIQF 128

Query: 122 -EQEVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIA--SFSYHKE-------- 170
            E +  RARYMPQ+P++IA+ +  G VYIFDR     +   I   +F Y  E        
Sbjct: 129 PEGDCNRARYMPQNPDVIASASSLGSVYIFDRTKHGSNRPKILGNTFKYDMELKEVESGC 188

Query: 171 --NGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQT-----FDVHTDIVNDCKW 223
                 LA+N   SG L ++  DG V +WD+T      P  T     + V  +  N+  W
Sbjct: 189 NYEASSLAWNYQRSGILAASYSDGDVKIWDITKYNKAQPQLTVPDLRWQVDKEGANEVSW 248

Query: 224 HEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSS---AFNTLAFSKRSENLLAAAGTDS 280
               SS+     E N L I DT +         S      N + F+  ++ LL +A ++ 
Sbjct: 249 MVHHSSILAVCGEGNGLTILDTRTPTTFSTKRHSCHTGGINAVQFNYDNDFLLCSADSEG 308

Query: 281 NVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSG-SDRRIIMWDLFNIGAEQQ 339
            + + D+R+L+ P+ + + H D+V++++++P    ++ S+G +D  + +WDL       Q
Sbjct: 309 TLNICDIRQLEHPVKTWS-HLDAVSTIQWNPKFPTVIASAGQNDGLVKIWDL------AQ 361

Query: 340 PDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENVLQIWKPANKIV 393
            DD       L  +HGGH   VN+ + N + PW+MCSV  +N + IWKPA  IV
Sbjct: 362 EDDP------LVFIHGGHMLGVNDIAWNHHDPWVMCSVSNDNSVHIWKPAANIV 409

>NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON}
           Anc_8.548
          Length = 419

 Score =  151 bits (381), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 117/433 (27%), Positives = 196/433 (45%), Gaps = 58/433 (13%)

Query: 2   TEVEEPEQPTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPT--------EMQPR 53
           T  E+   P  + + Y  W  N  ++YD+++     WPSLT Q+ P          +   
Sbjct: 6   TAQEQSTIPNDLQQRYSNWKKNTKLLYDYLNTNATKWPSLTCQFFPDLDTTSDTHRILIS 65

Query: 54  EVDGQQLLRQELL-IGTLTTDNEPNYLKIAAIDLPENVTSSKPSVSDDAKENELSHRQSK 112
                QL   E + I  ++T    N+  +   D+ E     KP  +       L +    
Sbjct: 66  SFTSSQLPEDEAIHISKISTLKHLNWASVNNFDMDE--MEFKPDTNLKLPSKHLVN---- 119

Query: 113 IKIVRKFKHEQEVTRARYMPQSPNIIATLNGAGIVYIFDR------------NIKEKD-- 158
             +  KF +  +  RARY+PQ+P++IA  +  G VYIFDR            N+K  D  
Sbjct: 120 -DLTIKFPN-GDCNRARYLPQNPDVIAAASSNGSVYIFDRTKHGSSRIRQSKNLKPYDAV 177

Query: 159 ----HGAIASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSP---SQTF 211
                  +     +      LA+N    G L S    G V +WD+    + +P       
Sbjct: 178 LFNNSETVEELHENTNEAISLAWNYQKEGTLASCYLQGQVQIWDIKQYFHSNPVLDKPVL 237

Query: 212 DVHTDI--VNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVS---SAFNTLAFS 266
           ++  D   VND  W     SLF    E +TL + D    + + +++ +      N+  F+
Sbjct: 238 NIQFDALGVNDVSWMPSHDSLFVACGESDTLALFDQRIGKEVSRIAQNRHNGGVNSCKFN 297

Query: 267 KRSENLLAAAGTDSNVYLYDLRRL-QKPLHSMAGHEDSVTSLEFSPHQDGLLTSSG-SDR 324
            ++  LLA+A ++  V ++D+R L Q P+ S+  H  S++++E++P+ D ++ ++G +D 
Sbjct: 298 YQNNMLLASADSEGLVNMWDIRNLDQYPIKSI-NHGSSISTIEWNPNLDTIIATAGQNDG 356

Query: 325 RIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENVLQ 384
            + +WD+ N   E            L  +HGGH   VN+ S + +  WLMCSV  +N +Q
Sbjct: 357 LVKLWDVSNTDNE------------LLFVHGGHMLGVNDISWDLHDSWLMCSVSNDNSIQ 404

Query: 385 IWKPANKIVRPPQ 397
           IWKPA+ +V   Q
Sbjct: 405 IWKPAHNLVEAEQ 417

>Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON}
           YBR195C (REAL)
          Length = 424

 Score =  148 bits (373), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 118/438 (26%), Positives = 197/438 (44%), Gaps = 78/438 (17%)

Query: 10  PTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLP---TEMQPREV------DGQQL 60
           P  + E Y  W  N  ++YD+++     WPSLT Q+ P   T +    +        Q+ 
Sbjct: 16  PIDLQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTLDEHRILLSSFTSSQKP 75

Query: 61  LRQELLIGTLTTDNEPNYLKIAAIDL------PENVTSSKPSVSDDAKENELSHRQSKIK 114
             + + I  ++T     +  +   D+      PEN T   PS           H  + I 
Sbjct: 76  EDETIYISKISTLGHIKWSSLNNFDMDEMEFKPENTTRLPPS-----------HLVNDIS 124

Query: 115 IVRKFKHEQEVTRARYMPQSPNIIATLNGAGIVYIFDRN------IKEK----------- 157
           I   F    +  RARY+PQ+P+IIA  +  G +YIFDR       I++            
Sbjct: 125 I---FFPNGDCNRARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKNSHPFEAKLF 181

Query: 158 -DHG------AIASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSP--- 207
             HG      A+ + S        LA+N      LLS+  +G V +WD+   ++++P   
Sbjct: 182 GSHGVIQDVEAMDTSSADVNEATSLAWNLQQEALLLSSHSNGQVQIWDIKQYSHENPLID 241

Query: 208 SQTFDVHTDI--VNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRA---IQKLSVSSAFNT 262
           S    + +D   VND  W     SLF   +E N + + D  + +      + + +   N+
Sbjct: 242 SPLVSIESDASGVNDVTWMPTHDSLFAACTEGNVVSLLDLRTKKEKLRSNRQNHTGGVNS 301

Query: 263 LAFSKRSENLLAAAGTDSNVYLYDLRRL-QKPLHSMAGHEDSVTSLEFSPHQDGLLTSSG 321
             F+ R+  +LA+A ++  + L+D+R++ + P+ +M  H  S+++LE++P+   +L ++G
Sbjct: 302 CKFNYRNSLVLASADSNGRLNLWDIRKMNESPITTME-HGASISTLEWNPNFSTVLATAG 360

Query: 322 S-DRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEE 380
             D  + +WD                  E    HGGH   VN+ S + + PWLMCSV  +
Sbjct: 361 QQDGLVKLWDT--------------AREETIFTHGGHMLGVNDVSWDVHDPWLMCSVAND 406

Query: 381 NVLQIWKPANKIVRPPQP 398
           N + IWKPA  +V   QP
Sbjct: 407 NSVHIWKPAENLVGLEQP 424

>Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON}
           YBR195C (REAL)
          Length = 422

 Score =  146 bits (369), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 121/441 (27%), Positives = 196/441 (44%), Gaps = 78/441 (17%)

Query: 2   TEVEEPEQPTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLP---TEMQPREV--- 55
           T  E    P  + E Y  W  N  ++Y++++     WPSLT Q+ P   T +    +   
Sbjct: 8   TANEASNIPPNLQERYSHWKKNTKLLYEYLNTNSTKWPSLTCQFFPDLDTTLDEHRILLS 67

Query: 56  ---DGQQLLRQELLIGTLTTDNEPNYLKIAAIDL------PENVTSSKPSVSDDAKENEL 106
                Q+   + + I  ++T     +  +   D+      PEN T   P           
Sbjct: 68  SFTSSQKPEDESIYISKISTLGHIKWSSLNNFDMDEMEFKPENSTRYPPK---------- 117

Query: 107 SHRQSKIKIVRKFKHEQEVTRARYMPQSPNIIATLNGAGIVYIFDRN------IKEK--- 157
            H  + I I   F    E  RARY+PQ+P+IIA  +  G +YIFDR       I++    
Sbjct: 118 -HLVNDISI---FFPNGECNRARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKIS 173

Query: 158 ---------DHGAIASF------SYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTST 202
                     HG I         S        +A+N      LLS+  +G V +WD+   
Sbjct: 174 HPFEAKLFGSHGVIQDVETMDASSADINEATSIAWNLQQEALLLSSHSNGQVQVWDIKQY 233

Query: 203 ANKSPSQTF---DVHTDI--VNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVS 257
           ++++P        +++D   VND  W     SLF   +E NT+ + D  + +   K +  
Sbjct: 234 SHENPIIDLPLVSINSDGSGVNDVTWMPTHDSLFAACTEGNTVSLLDLRTKKEKLKSNCR 293

Query: 258 S---AFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQK-PLHSMAGHEDSVTSLEFSPHQ 313
           S     N+  F+ R+  +LA+A ++  + L+D+R +   PL +M  H  SV++LE+SP+ 
Sbjct: 294 SHNGGVNSCKFNYRNSLILASADSNGKLNLWDIRNMNDCPLTTME-HGGSVSTLEWSPNF 352

Query: 314 DGLLTSSGSDRRII-MWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPW 372
           D +L ++G +  ++ +WD                  E    HGGH   VN+ S +++ PW
Sbjct: 353 DTVLATAGQEDGLVKLWDT--------------SREENIFTHGGHMLGVNDISWDAHDPW 398

Query: 373 LMCSVEEENVLQIWKPANKIV 393
           LMCSV  +N + IWKPA  +V
Sbjct: 399 LMCSVANDNSVHIWKPAVNLV 419

>Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON}
           YBR195C (REAL)
          Length = 422

 Score =  145 bits (367), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 116/432 (26%), Positives = 190/432 (43%), Gaps = 82/432 (18%)

Query: 13  INEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLP---TEMQPREV------DGQQLLRQ 63
           + E Y  W  N  ++YD+++     WPSLT Q+ P   T +    +        Q+   +
Sbjct: 19  LQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTLNEHRILLSSFTSSQKPEDE 78

Query: 64  ELLIGTLTTDNEPNYLKIAAIDL------PENVTS--SKPSVSDDAKENELSHRQSKIKI 115
            + I  ++T     +  +   D+      PEN T+  SK  V D                
Sbjct: 79  TIYISRISTLGHIKWASLNNFDMDEMEFKPENTTTYPSKHLVDD---------------- 122

Query: 116 VRKFKHEQEVTRARYMPQSPNIIATLNGAGIVYIFDRN------IKEK------------ 157
           +R F    E  RARY+PQ+P+IIA  +  G +YIFDR       I++             
Sbjct: 123 IRIFFPNGECNRARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFEIKLLG 182

Query: 158 DHGAIASFSYHKEN------GYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPS--- 208
            HG I        +         LA+N      LLS+  +G + +WD+   ++ +P    
Sbjct: 183 SHGVIQDVETMDTSLVDINEATSLAWNLQQEALLLSSHSNGQIQVWDIKQYSHDNPIIDV 242

Query: 209 --QTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSV---SSAFNTL 263
              + D     VND  W     SLF   +E N + + D  + +   K +        N+ 
Sbjct: 243 PLMSIDSDGSSVNDVTWMPTHDSLFAACTERNAVSLLDLRTKKEKLKSNCKIHGGGVNSC 302

Query: 264 AFSKRSENLLAAAGTDSNVYLYDLRRL-QKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGS 322
            F+ ++  +LA+A ++  + L+D+R + + P+ +M  H  SV++LE+SP+ D +L ++G 
Sbjct: 303 KFNYKNSLILASADSNGRLNLWDIRNMNENPIATME-HGASVSTLEWSPNFDTVLATAGQ 361

Query: 323 DRRII-MWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEEN 381
           +  ++ +WD                  E    HGGH   VN+ S + + PWLMCSV  +N
Sbjct: 362 EDGLVKLWDTTR--------------EESIFTHGGHMFGVNDISWDVHDPWLMCSVANDN 407

Query: 382 VLQIWKPANKIV 393
            + IWKPA  IV
Sbjct: 408 SVHIWKPAENIV 419

>TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score =  145 bits (367), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 110/417 (26%), Positives = 194/417 (46%), Gaps = 60/417 (14%)

Query: 13  INEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLRQELLIGTLTT 72
           + E Y  W  N  ++YD+++     WPSL+ Q+   ++  +  D  ++L      G +  
Sbjct: 23  LQERYTHWKKNTRLLYDYLNTNSTKWPSLSCQFFQ-DVNTKN-DSHRILLSSFTSGLMPE 80

Query: 73  DNEPNYLKIAAIDLPENVTSSKPSVS-DDAKENELSHR-QSKIKIVRKFKH-EQEVT--- 126
               N + I+ +          P  S ++   +E+  +  + +K+  K  H EQ +T   
Sbjct: 81  QESINIMSISTL-------KHVPWASLNNFDMDEMEFKPDNNLKLPPKNLHTEQTITFPN 133

Query: 127 ----RARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHK------EN----- 171
               RARY+PQ+ +IIA  +  G VYIF+R          +SF  ++      EN     
Sbjct: 134 GDCNRARYLPQNQDIIAGASSDGTVYIFNRTKYGSTLRQTSSFQSYQARFAEPENTVQSV 193

Query: 172 ------GYGLAFNPTVSGQLLSASDDGTVALWDVTSTANK-----SPSQTFDVHTDIVND 220
                    + +N    G L ++  DG +  WD+   +N      +P+ +  + T+  ND
Sbjct: 194 DSNPNEALSIDWNVQREGLLAASYSDGEIKTWDLKKFSNANTTITTPTVSIMMDTNGAND 253

Query: 221 CKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVS---SAFNTLAFSKRSENLLAAAG 277
             W     SL     E N LII+D    R    +S        N   F+  +  ++A+A 
Sbjct: 254 VTWMPLHDSLLAACGESNKLIIYDIRGSREHTTISSGIHEDGINACRFNYANNLIVASAD 313

Query: 278 TDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRII-MWDLFNIGA 336
           T  NV+++D+R+  + + ++  H  S++++E++P+ D +L ++G D  ++ +WD+ +   
Sbjct: 314 TVGNVHIWDIRKSNEIVKTIP-HGSSISTIEWNPNMDTILATAGQDDGLVKLWDVTD--- 369

Query: 337 EQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENVLQIWKPANKIV 393
                       EL   HGGH   VN+ S N + PWLMCSV  +N +QIW+PA+ +V
Sbjct: 370 -----------SELIFTHGGHMLGVNDISWNRHDPWLMCSVARDNSVQIWRPAHNLV 415

>KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 417

 Score =  145 bits (366), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 107/422 (25%), Positives = 193/422 (45%), Gaps = 45/422 (10%)

Query: 4   VEEPEQ-----PTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLP----TEMQPR- 53
           +EEP +        + + Y  W  N  ++YD+++     WPSL+ Q+ P    T  + R 
Sbjct: 6   IEEPPELGSGISNEVQQRYTNWKKNTKLLYDYLNTNTSKWPSLSCQFFPDRTLTNDKQRI 65

Query: 54  ---EVDGQQLLRQE-LLIGTLTTDNEPNYLKIAAIDLPENVTSSKPSVSDDAKENELSHR 109
                  QQL + E + IG+++T N   +  I   D+ E     +  + +  K N+ +  
Sbjct: 66  LLSSFTSQQLPQDESIYIGSISTMNHMKWSSINNFDMDE----MEFKLDNSLKLNDKTLE 121

Query: 110 QSKIKIVRKFKHEQEVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHK 169
           +     VR    + +  R RYMPQ+P+II T +  G VYIFDR            F    
Sbjct: 122 EE----VRITYPDGDCNRCRYMPQNPDIIGTASSNGSVYIFDRTKHGNKISTGRKFEIEC 177

Query: 170 ENG--------YGLAFNPTVSGQLLSASDDGTVALWDVTSTANKS-----PSQTFDVHTD 216
            N           LA+N  + G L +   +G V +WD+T           P +   +  +
Sbjct: 178 RNNGDDEQDESLSLAWNYQLEGTLATCQSNGKVKVWDLTKFDKSKQRMEIPERESVMDAN 237

Query: 217 IVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSS---AFNTLAFSKRSENLL 273
            VND  W    +S+  +  E N + + D   D  +  L  ++     N + F+ +++ +L
Sbjct: 238 GVNDVSWMVNHTSILASCGESNVIGLIDIRQDTKMDTLHRTTHTDGINAIEFNYKNDMIL 297

Query: 274 AAAGTDSNVYLYDLRRLQKPLHSMA-GHEDSVTSLEFSPHQDGLLTSSGSDRRII-MWDL 331
               +   + ++D+R  ++P+     G +D +++++++P    +L ++     ++ +WD 
Sbjct: 298 CTGDSQGQLKIWDIRDFKEPIKEWEHGDQDPISAIQWNPQIPQILATADQQSGLVKIWD- 356

Query: 332 FNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENVLQIWKPANK 391
                EQ+  +A + +  L  +HGGH   VN+ S + + PW MCSV  +N + IWKPA  
Sbjct: 357 --ASGEQEDSNAENNM--LLFVHGGHMLGVNDISWSQHDPWTMCSVSNDNSIHIWKPAAN 412

Query: 392 IV 393
           +V
Sbjct: 413 LV 414

>YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}
           MSI1Subunit of chromatin assembly factor I (CAF-1);
           chromatin assembly by CAF-1 is important for multiple
           processes including silencing at telomeres, mating type
           loci, and rDNA; maintenance of kinetochore structure;
           deactivation of the DNA damage checkpoint after DNA
           repair; and chromatin dynamics during transcription;
           Msi1p localizes to both nucleus and cytoplasm and has an
           independent role as a negative regulator of the RAS/cAMP
           pathway via sequestration of Npr1p kinase
          Length = 422

 Score =  145 bits (366), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 118/434 (27%), Positives = 195/434 (44%), Gaps = 70/434 (16%)

Query: 5   EEPEQPTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLP----TEMQPREV----- 55
           E    P  + E Y  W  N  ++YD+++     WPSLT Q+ P    T  + R +     
Sbjct: 11  EASSIPIDLQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTSDEHRILLSSFT 70

Query: 56  DGQQLLRQELLIGTLTTDNEPNYLKIAAIDLPENVTSSKPSVSDDAKENELSHRQSKIKI 115
             Q+   + + I  ++T     +  +   D+ E     KP  S       L      +  
Sbjct: 71  SSQKPEDETIYISKISTLGHIKWSSLNNFDMDE--MEFKPENSTRFPSKHL------VND 122

Query: 116 VRKFKHEQEVTRARYMPQSPNIIATLNGAGIVYIFDRN------IKEK------------ 157
           +  F    E  RARY+PQ+P+IIA  +  G +YIFDR       I++             
Sbjct: 123 ISIFFPNGECNRARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFETKLFG 182

Query: 158 DHGAIASF------SYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTF 211
            HG I         S        LA+N      LLS+  +G V +WD+   ++++P    
Sbjct: 183 SHGVIQDVEAMDTSSADINEATSLAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPIIDL 242

Query: 212 ---DVHTD--IVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVS-----SAFN 261
               +++D   VND  W     SLF   +E N + + D  + +  +KL  +        N
Sbjct: 243 PLVSINSDGTAVNDVTWMPTHDSLFAACTEGNAVSLLDLRTKK--EKLQSNREKHDGGVN 300

Query: 262 TLAFSKRSENLLAAAGTDSNVYLYDLRRLQK-PLHSMAGHEDSVTSLEFSPHQDGLLTSS 320
           +  F+ ++  +LA+A ++  + L+D+R + K P+ +M  H  SV++LE+SP+ D +L ++
Sbjct: 301 SCRFNYKNSLILASADSNGRLNLWDIRNMNKSPIATME-HGTSVSTLEWSPNFDTVLATA 359

Query: 321 GSDRRII-MWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPWLMCSVEE 379
           G +  ++ +WD                  E    HGGH   VN+ S +++ PWLMCSV  
Sbjct: 360 GQEDGLVKLWDT--------------SCEETIFTHGGHMLGVNDISWDAHDPWLMCSVAN 405

Query: 380 ENVLQIWKPANKIV 393
           +N + IWKPA  +V
Sbjct: 406 DNSVHIWKPAGNLV 419

>ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 397

 Score =  144 bits (363), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 107/410 (26%), Positives = 185/410 (45%), Gaps = 54/410 (13%)

Query: 15  EEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPT--------EMQPREVDGQQLLRQE-L 65
           + Y LW  N  ++YD+++     WPSL+ Q+ P          +        QL + E +
Sbjct: 10  QRYTLWKKNTKLLYDYLNTNSFKWPSLSCQFFPDLDTSSDTHRLLFTSFTSSQLPQDENV 69

Query: 66  LIGTLTTDNEPNYLKIAAIDLPENVTSSKPSVSDDAKENELSHRQSKIKIVRKFKHEQEV 125
            I +++T     +  +   D+ E     KP +S      +L  +  +I++   F H  + 
Sbjct: 70  TIASISTLRHVPWSSLNNFDMDE--MEFKPDLS-----TKLPPKNLQIQLTINFPH-GDC 121

Query: 126 TRARYMPQSPNIIATLNGAGIVYIFDRNIKEKD-----HGAIASFSYHKENG------YG 174
            RA Y+PQ+P++I+T +  G VYIFDR  + K       G   +      NG        
Sbjct: 122 NRATYLPQNPDLISTASSDGSVYIFDRTKRGKSPISHLRGPFEAQLLPNNNGSPIGETVA 181

Query: 175 LAFNPTVSGQLLSASDDGTVALWDVTSTANKSP------SQTFDVHTDIVNDCKWHEFQS 228
           L +N  + G L S   +G + +WD+     ++P      +   D  +   ND  W     
Sbjct: 182 LDWNRQIEGILASTYSNGQLCIWDIKKFEKRNPIMSQPSADFIDTESQGFNDVSWMPSHD 241

Query: 229 SLFGTVSEDNTLIIHDTNSDRAIQKLSVS----SAFNTLAFSKRSENLLAAAGTDSNVYL 284
            L     EDN + + DT ++  I +   S    S  N   F+     L+A A  D  V L
Sbjct: 242 CLLSIAREDNIMTLFDTRTNGNIAQTGPSTNHASGINCTKFNPSQPLLVATASGDGLVQL 301

Query: 285 YDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRII-MWDLFNIGAEQQPDDA 343
           +D+R+L  P+ ++   E  +++LE++P    +L + G +  ++ +W+            A
Sbjct: 302 WDIRKLHNPIKTI-NCESPLSALEWNPQLPTVLATGGQEDGLVKLWN------------A 348

Query: 344 YDGVPELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENVLQIWKPANKIV 393
            +G  +L   HGGH   VN+ + + +  WLMCSV  +N   +WKPA+++V
Sbjct: 349 SNG--QLLFTHGGHMLGVNDIAWSPHDKWLMCSVANDNSTHLWKPASRLV 396

>KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {ON}
           Anc_8.548 YBR195C
          Length = 413

 Score =  142 bits (359), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 111/426 (26%), Positives = 193/426 (45%), Gaps = 59/426 (13%)

Query: 4   VEEPEQPTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPT--------EMQPREV 55
           +E    P  + E Y  W  N  ++Y +++     WPSLT Q+ P          +     
Sbjct: 7   IEPSSIPDDLQERYSRWKKNTKLLYSYLNTNTSKWPSLTCQFFPDLDTTTDTHRILLSTF 66

Query: 56  DGQQLLRQE-LLIGTLTTDNEPNYLKIAAIDLPENVTSSKPSVSDDAKENELSHRQSKIK 114
              QL   E L I  L+T N  N+  +   D+ E     KP  S      +   +   + 
Sbjct: 67  TSSQLPEDESLYIANLSTSNHLNWSSLNNFDMDE--MEFKPDNS-----TKFPSKNLNVD 119

Query: 115 IVRKFKHEQEVTRARYMPQSPNIIATLNGAGIVYIFDR--------NIKEKDHGA-IASF 165
           I   F +  +  RARY+PQ+P+++A  +  G +YIF+R        N  ++   A + S 
Sbjct: 120 ISIPFPN-GDCNRARYLPQNPDLLAAASSNGSIYIFNRTKHGSRRLNSNQRSFEARLYST 178

Query: 166 SYHKEN------GYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQ-----TFDVH 214
               EN         +A+N   +G L S+   G++ +WD+T  +   P+      T    
Sbjct: 179 DKMDENFTNSNEAVSIAWNLQKNGTLASSYSQGSIKIWDITKYSCSDPTLRENELTIPFD 238

Query: 215 TDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSV-----SSAFNTLAFSKRS 269
            +  N+  W     S+F   SE N L + D  +   + K++      S   N+  F+  +
Sbjct: 239 PEGCNEVTWMVNHDSIFAACSESNKLSLFDVRTKEEMLKMTENIGTHSGGINSCKFNYYN 298

Query: 270 ENLLAAAGTDSNVYLYDLRRLQK-PLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRII- 327
           + LLA+A +   + ++D+R+L K P+ S   H  S+++LE++P+ + +L ++G D  ++ 
Sbjct: 299 DMLLASADSTGKINMWDIRKLDKEPIKSF-NHNSSISTLEWNPNLETILVTAGQDDGLVK 357

Query: 328 MWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENVLQIWK 387
           +WD  N               +   +HGGH   VN+ S + + PWL+ SV  +N + +WK
Sbjct: 358 IWDTAN--------------GQNIFVHGGHMLGVNDVSWDLHDPWLLSSVSNDNSIHVWK 403

Query: 388 PANKIV 393
           PA  +V
Sbjct: 404 PATNLV 409

>KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 418

 Score =  141 bits (356), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 113/423 (26%), Positives = 192/423 (45%), Gaps = 58/423 (13%)

Query: 11  TTINEE----YDLWVSNVPMMYDFVSETRLTWPSLTVQWLP-TEMQPREVDGQQLLRQEL 65
           +TI EE    Y  W  N  + YD+++     WPSLT Q  P  ++   E          +
Sbjct: 15  STIAEERQKRYTRWKKNSKLYYDYLNTNSTKWPSLTCQLFPDLDLATDE--------HRI 66

Query: 66  LIGTLTTDNEPN--YLKIAAIDLPENVT-SSKPSVSDDAKENELSHR-----QSKIKIVR 117
           L+ + T+   P    L +A +   +++  SS  +   + KE ++ +      +S ++ +R
Sbjct: 67  LLSSFTSSQVPEDESLYVARLSSMKHIPWSSLNNFDMEEKEFKVDNSLKLPSKSLVEDLR 126

Query: 118 KFKHEQEVTRARYMPQSPNIIATLNGAGIVYIFDR-----------NIKEKDHGAIASFS 166
                 +  +ARY P +P++I + +  G +Y+FDR           +  + DH      S
Sbjct: 127 IKFPAGDCNKARYCPSNPDLIGSASSNGSIYVFDRTKHGFARQKLISAGDTDHQIHCQLS 186

Query: 167 Y----HKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIV---- 218
                HK     LA+N    G L ++   G V +WD+      SP+    +    V    
Sbjct: 187 TSLEEHKNEAVSLAWNWQRQGLLATSYSHGQVCVWDLEKYDKNSPTLINPLAMSTVDPRG 246

Query: 219 -NDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSV----SSAFNTLAFSKRSENLL 273
            N+  W     SL    SEDN + I D  +    Q        S+  NT  F+   + LL
Sbjct: 247 SNEVSWMVRHDSLLAYCSEDNLVGIMDIRNPEKGQSSGSNPHHSNGINTCQFNYHRDMLL 306

Query: 274 AAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRII-MWDLF 332
            +A +   + L+D+R   +PL ++  H DS++ L+++P +  +L + G D  ++ +WDL 
Sbjct: 307 CSADSAGRINLWDIRNFTQPLKTLL-HNDSISVLQWNPREPTVLATGGQDGGLVKIWDL- 364

Query: 333 NIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENVLQIWKPANKI 392
                 QP+       EL   HGGH   VN+ S + +  W+MCSV  +N +Q+W+P+N +
Sbjct: 365 -----SQPEGQ-----ELIFTHGGHMLGVNDISWDPHDTWMMCSVANDNSIQVWRPSNSL 414

Query: 393 VRP 395
           V P
Sbjct: 415 VEP 417

>SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {ON}
           similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195C MSI1 Subunit of chromatin assembly factor I
           (CAF- I) regulates the RAS/cAMP pathway via
           sequestration of Npr1p kinase localizes to the nucleus
           and cytoplasm homologous to human retinoblastoma binding
           proteins RbAp48 and RbAp46
          Length = 425

 Score =  141 bits (356), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 113/417 (27%), Positives = 189/417 (45%), Gaps = 48/417 (11%)

Query: 7   PEQPTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLRQELL 66
           P  P  +   Y  W  N  ++YD+++     WPSLT Q+ P        D  +LL     
Sbjct: 24  PTIPEEVQTRYTNWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTN--DQHRLLLSSFT 81

Query: 67  IGTLTTDNEPNYLKIAAID-LPENVTSSKPSVSDDAKENEL--SHRQSKIKIVRKFKHE- 122
              L  D      +++ +  LP    SS  +   D  E +L  S +     ++++     
Sbjct: 82  SSQLPEDESIYVSRVSTLKHLP---WSSLNNFDMDEMEFKLDNSSKLPSKNLIKELNISF 138

Query: 123 --QEVTRARYMPQSPNIIATLNGAGIVYIFDRNI------KEKDHGAI-------ASFSY 167
              +   ARY+PQ+P++IA  +  G +Y+FDR        K  D G++       +S   
Sbjct: 139 PMGDCNGARYLPQNPDVIAAASSNGSIYVFDRTKHGLTRQKLHDGGSMFELEFQSSSLEE 198

Query: 168 HKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSP-----SQTFDVHTDIVNDCK 222
           H+E    LA+N    G L +    G V +WDV   +   P       T +      ND  
Sbjct: 199 HQE-VVSLAWNWQREGLLAACYSGGDVKVWDVKKYSRNFPVIDKADYTHNADPRGCNDVS 257

Query: 223 WHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSV-----SSAFNTLAFSKRSENLLAAAG 277
           W    +S+     E N++ + DT + + +   +      S   N+  F+  ++ LL +  
Sbjct: 258 WMVNHASILACCGESNSINVIDTRAQKGVLSSTKDTKHHSRGINSSQFNYHNDMLLCSGD 317

Query: 278 TDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLL-TSSGSDRRIIMWDLFNIGA 336
           +   V L+D+R L+ PL S+  H  S++  +++P+   +L T+  SD  + +WD+     
Sbjct: 318 STGRVNLWDIRDLETPLKSL-DHGSSISKTQWNPNLSTILATADQSDGLVKLWDI----- 371

Query: 337 EQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENVLQIWKPANKIV 393
            Q+P +      EL  +HGGH   VN+ S N + PWLMCSV  +N +Q+W+PA  +V
Sbjct: 372 AQEPGE------ELLFVHGGHMLGVNDISWNYHDPWLMCSVANDNSVQLWRPARNLV 422

>Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR195C
           (MSI1) - p50 subunit of the yeast Chromatin Assembly
           Factor-I (CAF-I) negative regulator of ras-mediated cAMP
           induction; homologous to beta subunit of GTP-binding
           proteins [contig 24] FULL
          Length = 418

 Score =  140 bits (354), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 112/420 (26%), Positives = 194/420 (46%), Gaps = 54/420 (12%)

Query: 10  PTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLRQELLIGT 69
           P    + Y  W  N  ++Y++++     WPSLT Q  P      ++ G +     +L+ +
Sbjct: 18  PEDRQQRYTHWKKNCKLLYEYLNTNNTKWPSLTCQLFPD----LDLAGDE---HRILLSS 70

Query: 70  LTTDNEPN--YLKIAAIDLPENVT-SSKPSVSDDAKENELSHR-----QSKIKIVRKFKH 121
            T+   P    + +A +   +++  SS  +   D  E ++ +      ++ ++ +R    
Sbjct: 71  FTSSQLPEDEAIYVARLSSMKHIPWSSLNNFDTDEMEFKMDNSLKLPPKNIVEDLRIKFP 130

Query: 122 EQEVTRARYMPQSPNIIATLNGAGIVYIFDR----NIKEK-------DHGAIASFSYHKE 170
             +  +ARY P +P++I++ +  G VY+FDR    + ++K       DH      S   E
Sbjct: 131 AGDCNKARYCPSNPDLISSASSNGSVYVFDRTKHGSARQKLISGGDPDHQIHCQLSTSLE 190

Query: 171 N----GYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIV------ND 220
                   LA+N    G L +    G V +WD+      SP+   D H+ ++      ND
Sbjct: 191 ERQNEALNLAWNWQQQGLLATCYSGGEVCVWDLAKYDKASPT-LIDPHSSLLADPQGSND 249

Query: 221 CKWHEFQSSLFGTVSEDNTLIIHDTN-SDRAIQKLSV---SSAFNTLAFSKRSENLLAAA 276
             W     SL     E N L + DT  + +  Q  S    S+  N   F+   + LL +A
Sbjct: 250 ISWMVNHDSLLAYCGEGNALGVLDTRITKQPPQSFSNPHHSNGVNACQFNYYKDLLLCSA 309

Query: 277 GTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRII-MWDLFNIG 335
            +   + L+D+R    P+ S+  H  SV++L+++PH   +L ++G D  ++ +WDL    
Sbjct: 310 DSAGRINLWDIRDFSSPIRSL-DHHGSVSALQWNPHHPTILATAGQDDGLVKIWDL---- 364

Query: 336 AEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENVLQIWKPANKIVRP 395
              QP D      EL   HGGH   VN+ S + N PW+MCSV  +N +Q+WKP+  ++ P
Sbjct: 365 --SQPVDQ-----ELKFTHGGHMLGVNDISWDPNDPWMMCSVSNDNSIQLWKPSQNLMTP 417

>TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {ON}
           Anc_8.548 YBR195C
          Length = 412

 Score =  137 bits (344), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 106/428 (24%), Positives = 192/428 (44%), Gaps = 82/428 (19%)

Query: 15  EEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLL-----------RQ 63
           + Y  W  N  ++YD+++     WPSLT ++ P        D  +LL            +
Sbjct: 17  QRYSNWKKNTKLLYDYLNTNSAKWPSLTCEFFPD--LDTTTDSHRLLLSSFTSSQLPEDE 74

Query: 64  ELLIGTLTTDNEPNYLKIAAIDL------PENVTSSKP-SVSDDAKENELSHRQSKIKIV 116
            + I  ++T    ++  +   D+      PEN T   P +++DD            I+I 
Sbjct: 75  SIYISRISTLKHLHWSSLNNFDMDEMEFKPENSTKLPPRNLTDDIS----------IRIP 124

Query: 117 RKFKHEQEVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLA 176
                  +  RARY+PQ+P++I+  +  G +YIFDR    K +  I+  +  +     L 
Sbjct: 125 -----SGDSNRARYLPQNPDVISAASSDGSIYIFDRT---KHNSTISRSTTSRPYEIKLE 176

Query: 177 FNPTVS------------------GQLLSASDDGTVALWDVTSTANKSPS------QTFD 212
             P V                   G L S    G + +WD++   + +P+         D
Sbjct: 177 VAPQVELMDSPNEVVSLDWNKRKEGILASCHSRGQLLVWDISQYLHSNPTIQTPICSIDD 236

Query: 213 VHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSV---SSAFNTLAFSKRS 269
                 ND  W     SL     E NT+ I+DT S   + K+     +   N+  F+  +
Sbjct: 237 FDPQGANDITWMPSHDSLLAACGESNTVAIYDTRSKSQVSKIQPGLHNGGINSCDFNAHN 296

Query: 270 ENLLAAAGTDSNVYLYDLRRL-QKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRII- 327
           + LLA+A +   V+++D+R+L Q P+ S++ H  S+++++++P+   ++  +G +  ++ 
Sbjct: 297 DYLLASADSIGTVHMWDIRKLDQDPIQSVS-HGSSISTVKWNPNVATIIAVAGQEDGLVK 355

Query: 328 MWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENVLQIWK 387
           +WD  N               +L   HGGH   VN+ + N++ PWLMCSV  +N + +W+
Sbjct: 356 LWDASN--------------GQLIFTHGGHMLGVNDIAWNAHDPWLMCSVSNDNSIHLWR 401

Query: 388 PANKIVRP 395
           P++ +V P
Sbjct: 402 PSSHLVEP 409

>CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa]
           {ON} similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195c MSI1
          Length = 419

 Score =  137 bits (344), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 112/424 (26%), Positives = 193/424 (45%), Gaps = 60/424 (14%)

Query: 10  PTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLP----TEMQPR----EVDGQQLL 61
           P  +   Y  W  N  ++YD+++     WPSLT Q+ P    +  Q R         QL 
Sbjct: 18  PEDVQTRYIHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTSSDQHRLLLSSFTSSQLP 77

Query: 62  RQE-LLIGTLTTDNEPNYLKIAAIDLPENVTSSKPSVSDDAKENELSHRQSKIKIVRKFK 120
             E + I  ++T    N+  +   D+ E      PSV       +L  +    ++  +F 
Sbjct: 78  EDESVYISKISTLKHLNWSSLNNFDMDEMEFKPDPSV-------KLPPKNLTTEVSIRFP 130

Query: 121 HEQEVTRARYMPQSPNIIATLNGAGIVYIFDRN------IKEKD----HGAIASFSYHKE 170
           +  +  R+RY+PQ+P++IA  +  G VYIF++       ++ K        + S S+  +
Sbjct: 131 N-GDCNRSRYLPQNPDLIAAASSDGSVYIFNKTKHGNSVLRSKSSDDFQARLFSGSHDAQ 189

Query: 171 N------GYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKS-----PSQTFDVHTDIVN 219
           N         L++N    G L  +   G   +WDV   +  +     P  T    ++  N
Sbjct: 190 NLDNFNEAVSLSWNKHKEGILGVSYSQGQCNIWDVKKFSRSNILISQPELTVTFDSNGCN 249

Query: 220 DCKWHEFQSSLFGTVSEDNTLIIHDT--NSDRAIQKLSV---SSAFNTLAFSKRSENLLA 274
           D  W     S+F    E N L + D   N ++ +  +S        NT  F+  +  L+A
Sbjct: 250 DLDWMPMHDSMFIACGESNKLGLFDMRLNGEKEVNSISNYKHEDGINTCKFNPGNSLLVA 309

Query: 275 AAGTDSNVYLYDLRRL-QKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRII-MWDLF 332
           +A T   + L+D+R+L Q+P+ +M  H  S++++E++P+   +  S+G +  ++ +WD  
Sbjct: 310 SADTCGRINLWDIRKLDQEPISTMQ-HGSSISTIEWNPNIGVVFASAGQEDGLVKLWDA- 367

Query: 333 NIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENVLQIWKPANKI 392
           ++G E               +HGGH   VN+ S + + PWLM SV  +N +QIW+PA  I
Sbjct: 368 SVGKE-------------IFVHGGHMLGVNDISWDMHDPWLMASVSNDNTIQIWRPAKNI 414

Query: 393 VRPP 396
           V  P
Sbjct: 415 VSKP 418

>NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {ON}
           Anc_8.548
          Length = 414

 Score =  134 bits (338), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 114/439 (25%), Positives = 193/439 (43%), Gaps = 74/439 (16%)

Query: 1   MTEVEEPEQPTT-----INEEYDLWVSNVPMMYDFVSETRLTWPSLTVQW---LPTEMQP 52
           M+ +EE   P +     + + Y  W  N  ++YD+++     WPSLT Q+   L T    
Sbjct: 1   MSAIEEEHVPQSSIPEDLQQRYSNWKKNTRLLYDYLNTNSKKWPSLTCQFFHDLDTTSDT 60

Query: 53  REV-----DGQQLLRQE-LLIGTLTTDNEPNYLKIAAIDLPENVTSSKPSVSDDAKENEL 106
             +        QL   E + I  L+T     +  I   D+ E     KP  +       L
Sbjct: 61  HRILLSAFTSSQLPEDEAIYIAKLSTLKHLEWASINNFDMDE--MEFKPENNIKLPSKNL 118

Query: 107 SHRQSKIKIVRKFKHEQEVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFS 166
           ++      I  +F  + +   ARY+PQ+P++IA  +  G +YIFDR      HG++    
Sbjct: 119 TN-----DISIRFP-DGDCNIARYLPQNPDVIAGASSHGSIYIFDR----TKHGSLRMRQ 168

Query: 167 YHKENGY---------------------GLAFNPTVSGQLLSASDDGTVALWDVTSTANK 205
                 Y                      +++N    G L S    G + LWD+   +N 
Sbjct: 169 SKNLKPYEAALYCPPKGIENVENTNEATSISWNLQREGLLASCYSSGQIQLWDLKKYSNS 228

Query: 206 -----SPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHD----TNSDRAIQKLSV 256
                +P    D     VND  WH    S+     E N + + D    T   R+ +K+  
Sbjct: 229 KLEMDTPLLNVDFDALGVNDVNWHPSHDSILAASGESNIIGLFDNRLGTEILRSNEKMH- 287

Query: 257 SSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQ-KPLHSMAGHEDSVTSLEFSPHQDG 315
           +   N+  F+   ++LL +  ++  + L+DLR+L  +P+ ++  H  S+++LE++P+ + 
Sbjct: 288 NGGINSCKFNSHCDSLLISGDSEGRINLWDLRKLDGEPIKTLH-HGSSISTLEWNPNLET 346

Query: 316 LLTSSGSDRRII-MWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPWLM 374
           ++ S+G D  ++ +WD+                 EL   HGGH   VN+ S N +  WLM
Sbjct: 347 IVASAGQDDGLVKLWDV--------------STDELVFTHGGHMLGVNDISWNLHDTWLM 392

Query: 375 CSVEEENVLQIWKPANKIV 393
           CSV  +N +Q+WKPA+ +V
Sbjct: 393 CSVSNDNSVQVWKPAHNLV 411

>KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {ON}
           Anc_8.548 YBR195C
          Length = 426

 Score =  133 bits (334), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 115/447 (25%), Positives = 191/447 (42%), Gaps = 87/447 (19%)

Query: 11  TTINEE----YDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLRQELL 66
           +TI+E+    Y  W  N  ++YD+++     WPSLT Q+ P      +VD      + +L
Sbjct: 9   STISEDLQTRYAYWKKNTKLLYDYLNTNTAKWPSLTCQFFP------DVDANTDTHR-IL 61

Query: 67  IGTLTTDNEPNYLKIAAIDLPENVTSSKPSVS-----DDAKENELSHRQSKIKIVRKFKH 121
           + + T+             LPE+      S+S     D A  N     + + K  R  K 
Sbjct: 62  LSSYTS-----------CQLPEDENVYVASISTLAHLDWASLNNFDMDEMEFKPDRTTKF 110

Query: 122 --------------EQEVTRARYMPQSPNIIATLNGAGIVYIFDRNI------------- 154
                           +  RARYMPQ+P++IA  +  G VY+F+R               
Sbjct: 111 PPKNLATNVSITFPRGDCNRARYMPQNPDVIAAASSNGAVYVFNRTKHGTRRIQKHAASD 170

Query: 155 KEKDHGAIASFSYHKEN-----------GYGLAFNPTVSGQLLSASDDGTVALWDV---- 199
            E+D+G   +  Y++E               LA+N    G L  A   G V +WD+    
Sbjct: 171 AEQDYGPYEARFYNEETDEARRTPVDNEAVSLAWNHHREGTLAVAYSHGAVKVWDLQRFN 230

Query: 200 --TSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSE-DNTLIIHDTNSDRAIQKLS- 255
              +T +++  +  +  +  VND  W     S+     E  ++L + DT +  A+ K+  
Sbjct: 231 VDNTTISETEWECSNFDSRGVNDVSWMSQHDSILAACGERSDSLALFDTRAQNAVAKIRN 290

Query: 256 --VSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQ 313
              S   N   F+  +  LLA+  +     L+D+R+L         H  SV++LE++PH 
Sbjct: 291 QFKSEGINACKFNWENNLLLASTDSTGRTNLWDVRKLSAEPIVHFDHGGSVSTLEWNPHD 350

Query: 314 DGLLTSSG-SDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPW 372
             +L ++G SD  I +WD            + +   +   +H GH   VN+ + + + PW
Sbjct: 351 HSVLATAGQSDGLIKIWDT-----------SLEIEDKTIFVHSGHMLGVNDIAWDLHDPW 399

Query: 373 LMCSVEEENVLQIWKPANKIVRPPQPP 399
           LMCSV  +N + +WKPA  +V+    P
Sbjct: 400 LMCSVSNDNSVHVWKPAANLVQRCTSP 426

>ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 RiboSome Assembly 2
          Length = 516

 Score = 75.1 bits (183), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 95/410 (23%), Positives = 172/410 (41%), Gaps = 62/410 (15%)

Query: 25  PMMYDFVSETRLTWPSLTVQWLPTEM-QPREVDGQQLLRQELLIGTLTTDNEPNYLKIAA 83
           P +Y+ +    + WP +T+  +P  +   R    Q LL       T   DNE   LK++ 
Sbjct: 118 PSVYEMLHNVNMPWPCMTLDVIPDTLGSERRSYPQSLLLTTATQATRKKDNELMVLKLSQ 177

Query: 84  ID----------LPENVTSSKPSVSDDAKENE---LSHRQSKIKIVRKFKHEQEVTRARY 130
           +             E+    + + SD   ENE   L    +++K+     H QEV     
Sbjct: 178 LSKTLVKDDTEENDEDDEDDEDADSDPIIENENIALKDTTNRLKVSPFATHGQEV----- 232

Query: 131 MPQSPNIIATLNGAGIVYIFDRNIKEK------------DHGAIASFSYHKE-NGYGLAF 177
                 + AT+   G VY+FD   + K               AI +   H    GYGL +
Sbjct: 233 ------LTATMCENGEVYVFDLGAQTKAFETPGYQVPKTSRKAIHTIRNHGNVEGYGLDW 286

Query: 178 NPTV-SGQLLSASDDGTVALWDVTSTANKSPSQTFDV-HTDIVNDCKWHEFQSSLFGTVS 235
           +P + +G LL+    G + L    ++   +  Q F   +   V D +W   +S++F T  
Sbjct: 287 SPLIKTGALLTGDCSGQIFLTQRHTSKWITDKQPFTAANNQSVEDIQWSPTESTVFATSG 346

Query: 236 EDNTLIIHDTNSDR---AIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQ- 291
            D  + I DT S +   AI   + ++  N ++++++   LLA+   + +  ++DLR+   
Sbjct: 347 TDGYVRIWDTRSKKHKPAISTRASNTDVNVISWNEKLGYLLASGDDNGSWGVWDLRQFSP 406

Query: 292 ------KPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAE----QQPD 341
                 +P+     H   +TS+ F+P  D ++  +  D  + +WDL ++ A+    QQ  
Sbjct: 407 ANSEGVQPVAQYDFHRGPITSISFNPLDDSVVAVASEDNTVTLWDL-SVEADDDEIQQQT 465

Query: 342 DAYDGV----PELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENVLQIWK 387
             Y  +    P+L  +H   +  V +   +  +P  + S   +  L +WK
Sbjct: 466 KEYKELQKIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWK 512

>KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 87/407 (21%), Positives = 173/407 (42%), Gaps = 57/407 (14%)

Query: 25  PMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLRQELLIGTLTTDNEPNYLKIAAI 84
           P +YD +    + WP LT+  +P  +  +    ++   Q LL+ T T  +     ++  +
Sbjct: 119 PTVYDMLHNVTMPWPCLTLDIIPDNLGSQ----RRNYPQSLLMTTATQASRKKENELMVL 174

Query: 85  DLPENVTSSKPSVSDDAKENELSHRQSKIKIVRKFKHEQ-----EVTRARYMPQSPN--- 136
            L +    +K  V DD + N     + + +     ++E         R R  P + +   
Sbjct: 175 SLSQ---LAKTLVKDDDEVNSDEEDEDRDETDPIIENENISLRDTTNRLRVSPFAQSNKE 231

Query: 137 -IIATLNGAGIVYIFDRNIKEKDHGAIASFSYH----------------KENGYGLAFNP 179
            + AT++  G VYIFD   + K   A +S  Y                    GY L ++P
Sbjct: 232 VLTATMSENGEVYIFDLGPQSK---AFSSPGYQVPKSSKRPVHTIKNHGNVEGYALDWSP 288

Query: 180 TV-SGQLLSASDDGTVALWDVTSTANKSPSQTFDV-HTDIVNDCKWHEFQSSLFGTVSED 237
            + +G LL+    G + L    ++   +  Q F V +   V D +W   ++++F +   D
Sbjct: 289 LIKTGALLTGDCSGQIYLTQRNTSKWVTDKQPFTVGNNKSVEDIQWSRTEATVFASCGCD 348

Query: 238 NTLIIHDTNSDRAIQKLSVSSA---FNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQ--- 291
             + I DT S +    LSV ++    N ++++++   LLA+   + +  ++DLR+     
Sbjct: 349 GYVRIWDTRSKQHKPALSVKASNTDVNVISWNEKIGYLLASGDDNGSWGVWDLRQFTPDN 408

Query: 292 ----KPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLF------NIGAEQQPD 341
               +P+     H+ ++TS+ F+P ++ ++  +  D  + +WDL        I  +    
Sbjct: 409 INNVQPVAQYDFHKGAITSISFNPLEESIIAVASEDNTVTLWDLSVEADDEEIKQQAAET 468

Query: 342 DAYDGV-PELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENVLQIWK 387
              + + P+L  +H   +  V +   +  +P  + S   +  L IWK
Sbjct: 469 KELESIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNIWK 512

>Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {ON}
           YMR131C (REAL)
          Length = 510

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 65/284 (22%), Positives = 128/284 (45%), Gaps = 37/284 (13%)

Query: 137 IIATLNGAGIVYIFDRNIKEKDHGA------------IASFSYHKE-NGYGLAFNPTV-S 182
           + AT++  G VYI+D   + K                I +   H    GYGL ++P + +
Sbjct: 227 LTATMSENGDVYIYDLAAQSKAFSTPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKT 286

Query: 183 GQLLSASDDGTVALWDVTSTANKSPSQTFDV-HTDIVNDCKWHEFQSSLFGTVSEDNTLI 241
           G LLS    G + L    ++   +  Q+F V + + + D +W   +S++F T + D  + 
Sbjct: 287 GALLSGDCSGQIYLTQRHTSRWVTDKQSFTVSNNESIEDIQWSRTESTVFATAACDGYIR 346

Query: 242 IHDTNSDRAIQKLSVSSA---FNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQ------- 291
           I DT S +    +SV ++    N +++S +   LLA+   +    ++DLR+         
Sbjct: 347 IWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNADTV 406

Query: 292 KPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQ--------QPDDA 343
           +P+     H+ ++TS+ F+P  + ++     D  + +WDL ++ A+         +  + 
Sbjct: 407 QPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDL-SVEADDEEIKQQAAETKEL 465

Query: 344 YDGVPELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENVLQIWK 387
            D  P+L  +H   +  V +   +  +P  + S   +  L +WK
Sbjct: 466 QDIPPQLLFVH--WQREVKDVKWHKQIPGCLVSTGTDG-LNVWK 506

>CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131c Ribosome assembly protein
          Length = 513

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 86/411 (20%), Positives = 177/411 (43%), Gaps = 68/411 (16%)

Query: 25  PMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLRQELLIGTLTTDNEPNYLKIAAI 84
           P +Y+ +    + WP L++  +P  +       ++   Q +L+ T T  ++    ++  +
Sbjct: 119 PTVYEMLHNVNMPWPCLSLDIIPDTLGSE----RRNYPQSILMTTATQASKKKENELMVL 174

Query: 85  DLPENVTSS------------KPSVSDDAKENE---LSHRQSKIKIVRKFKHEQEVTRAR 129
            L  N+T +                 +   ENE   L    ++IK+       QEV    
Sbjct: 175 SL-SNLTKTLLKDEEEEEEEEDDDDVEPIIENENIALRDTTNRIKVSPFASQSQEV---- 229

Query: 130 YMPQSPNIIATLNGAGIVYIFD------------RNIKEKDHGAIASFSYHKE-NGYGLA 176
                  + AT++  G VYIFD              I ++    + +   H    GYGL 
Sbjct: 230 -------LTATMSENGEVYIFDIGAQAKCFNSPGYQIPKQSKRPVHTIRNHGNVEGYGLD 282

Query: 177 FNPTV-SGQLLSASDDGTVALWDVTSTANKSPSQTFDV-HTDIVNDCKWHEFQSSLFGTV 234
           ++P + SG LLS    G + L    ++   +  Q + V +   + D +W + +S++F T 
Sbjct: 283 WSPLIKSGALLSGDCSGQIYLTQRHTSKWVTDKQAYSVGNNKSIEDIQWSKTESTVFATA 342

Query: 235 SEDNTLIIHDTNSDRAIQKLSVSSA---FNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQ 291
             D  + + DT S +    +SV ++    N ++++++   LLA+   + +  ++DLR+  
Sbjct: 343 GCDGYIRVWDTRSKKHKPAISVKASNTDVNVISWNEKIGYLLASGDDNGSWGVWDLRQFT 402

Query: 292 -------KPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAE-----QQ 339
                  +P+     H+ ++TS+ F+P ++ ++     D  + +WDL ++ A+     QQ
Sbjct: 403 PDNAANIQPVAQYNFHKGAITSIAFNPLEESIVAVGSEDNTVTLWDL-SVEADDEEIKQQ 461

Query: 340 PDDAYDGV---PELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENVLQIWK 387
            ++  +     P+L  +H   +  + +   +  +P  + S   +  L IWK
Sbjct: 462 TEETKELKEIPPQLLFVH--WQKEIKDVKWHKQIPGCLVSTGTDG-LNIWK 509

>TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.401
           YMR131C
          Length = 514

 Score = 68.6 bits (166), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 76/348 (21%), Positives = 147/348 (42%), Gaps = 56/348 (16%)

Query: 25  PMMYDFVSETRLTWPSLTVQWLPTEM-QPREVDGQQLLRQELLIGTLTTDNEPNYLKIAA 83
           P +Y+ +    + WP LT+  +P  +   R    Q +L       +   +NE   LK++ 
Sbjct: 118 PTVYEMLHNVNMPWPCLTLDIIPDGLGTERRNYPQSILMATATQASKKKENELMVLKLSQ 177

Query: 84  ID--------------LPENVTSSKPSVSDDAKENELSHRQSKIKI-VRKFKHEQEVTRA 128
           ++                +    S P + ++    E+S R +  ++ +  F   QEV   
Sbjct: 178 LNKTLVKDDADEEEDDEDDEDNDSDPIIENE----EISLRDTTNRLKISPFASSQEV--- 230

Query: 129 RYMPQSPNIIATLNGAGIVYIFD------------RNIKEKDHGAIASFSYHKE-NGYGL 175
                   + AT++  G VYI D              I +     + +   H    GYGL
Sbjct: 231 --------LTATMSENGEVYIHDLGPQTKAFETPGYQIPKSAKKPLHTIRNHGNVEGYGL 282

Query: 176 AFNPTV-SGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDI-VNDCKWHEFQSSLFGT 233
            ++P + +G LL+    G V L    ++   +  Q F    +  + D +W   +S++F T
Sbjct: 283 DWSPLIKTGALLTGDCSGQVYLTQRHTSKWVTDKQPFTFSNNKSIEDIQWSRTESTVFAT 342

Query: 234 VSEDNTLIIHDTNSDR---AIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRL 290
              D  + I DT S +   AI   + ++  N ++++++   LLA+   D    ++DLR+L
Sbjct: 343 SGCDGYIRIWDTRSKKHKPAISTRASATDVNVISWNEKIGYLLASGDDDGRWGVWDLRQL 402

Query: 291 Q-------KPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
                   +P+     H+ ++TS+ F+P  + ++  +  D  + +WDL
Sbjct: 403 SPNNSENVQPVAQYDFHKGAITSISFNPLDESIIAVASEDNTVTLWDL 450

 Score = 37.7 bits (86), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 35/79 (44%), Gaps = 16/79 (20%)

Query: 162 IASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTAN---------------KS 206
           +A + +HK     ++FNP     +  AS+D TV LWD++  A+               + 
Sbjct: 413 VAQYDFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQQAAETKELQQI 472

Query: 207 PSQTFDVH-TDIVNDCKWH 224
           P Q   VH    V D KWH
Sbjct: 473 PPQLLFVHWQKEVKDVKWH 491

>KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 essential nuclear protein involved in early
           steps of ribosome biogenesis
          Length = 523

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 74/348 (21%), Positives = 145/348 (41%), Gaps = 56/348 (16%)

Query: 25  PMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLRQELLIGTLTTDNEPNYLKIAAI 84
           P +Y+ +    + WP +T+  +P  +      G++   Q LL+ T T  ++ N  ++  +
Sbjct: 127 PTVYEMLHTVNVPWPCMTLDVIPDTLG----SGRRNYPQSLLMATATQASKKNQNELMVL 182

Query: 85  DLPE-------------NVTSSKPSVSDDAKENE---LSHRQSKIKIVRKFKHEQEVTRA 128
            + +                      +D   ENE   L    +++K+       QEV   
Sbjct: 183 KMSQLAKTLVKEDEDENEGEDEDEDGTDPVIENENISLKDTTNRLKVSPFANAAQEV--- 239

Query: 129 RYMPQSPNIIATLNGAGIVYIFD------------RNIKEKDHGAIASFSYHKE-NGYGL 175
                   + +T++  G VYIFD              I ++    I +   H    GY  
Sbjct: 240 --------LCSTMSENGEVYIFDLASQVKAFETPGYQIPKQAKRPIHTVRNHGSVEGYAN 291

Query: 176 AFNPTV-SGQLLSASDDGTVALWDVTSTANKSPSQTFDV-HTDIVNDCKWHEFQSSLFGT 233
            ++P + +G +LS    G V L    ++   +  Q F V +   + D +W   +S++F +
Sbjct: 292 DWSPIIKTGAMLSGDCSGQVFLTQRHTSKWITDKQAFTVANNKSIEDLQWSRTESTVFAS 351

Query: 234 VSEDNTLIIHDTNSDRAIQKLSVSSA---FNTLAFSKRSENLLAAAGTDSNVYLYDLRRL 290
              D  + I DT S +    +SV ++    N +++S++   LLA+   D    ++DLR+ 
Sbjct: 352 CGIDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSEKIGYLLASGDDDGTWGVWDLRQF 411

Query: 291 -------QKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
                    P+     H+ ++TS+ F+P  + ++  +  D  + +WDL
Sbjct: 412 TPQNASTASPVAQYQFHKGAITSISFNPLDESIIAVASEDNTVTLWDL 459

 Score = 37.4 bits (85), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 36/80 (45%), Gaps = 16/80 (20%)

Query: 162 IASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTAN---------------KS 206
           +A + +HK     ++FNP     +  AS+D TV LWD++  A+               + 
Sbjct: 422 VAQYQFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQQAAETKELQQI 481

Query: 207 PSQTFDVH-TDIVNDCKWHE 225
           P Q   VH    V D KWH+
Sbjct: 482 PPQLLFVHWQKEVKDVKWHK 501

>TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON}
           Anc_2.401 YMR131C
          Length = 526

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 55/220 (25%), Positives = 105/220 (47%), Gaps = 26/220 (11%)

Query: 137 IIATLNGAGIVYIFD------------RNIKEKDHGAIASFSYHKE-NGYGLAFNPTV-S 182
           + AT++  G VYIFD              + ++    I +   H    G+GL ++P + S
Sbjct: 244 LTATMSENGEVYIFDIINQVKSFQIPGYQVSKQSKRPIHTIRSHGNVEGFGLDWSPLIKS 303

Query: 183 GQLLSASDDGTVALWDVTSTANKSPSQTFDV-HTDIVNDCKWHEFQSSLFGTVSEDNTLI 241
           G LL+    G + L    ++   +  Q+F V +   + D +W + + ++F T   D  + 
Sbjct: 304 GALLTGDCSGEIFLTSRHTSKWITEKQSFSVGNNKSIEDIQWSKTEQTVFATAGCDGYIR 363

Query: 242 IHDTNSDR---AIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVY-LYDLRRLQ------ 291
           I DT S +   AI   + +   N ++++++ E LLA+ G D  V+ ++DLR+        
Sbjct: 364 IWDTRSKKHKPAISTRASNVDVNVISWNEKMEYLLAS-GDDKGVWGVWDLRQFSPSQENA 422

Query: 292 KPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
            P+     H+ ++TS+ F+P  +  +  +  D  + +WDL
Sbjct: 423 SPVAQYDFHKGAITSISFNPLDESTVAVASEDNTVTLWDL 462

 Score = 37.7 bits (86), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 35/79 (44%), Gaps = 16/79 (20%)

Query: 162 IASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTAN---------------KS 206
           +A + +HK     ++FNP     +  AS+D TV LWD++  A+               + 
Sbjct: 425 VAQYDFHKGAITSISFNPLDESTVAVASEDNTVTLWDLSVEADDEEIKQQTHETKELEQI 484

Query: 207 PSQTFDVH-TDIVNDCKWH 224
           P Q   VH    V D KWH
Sbjct: 485 PPQLLFVHWQKEVKDVKWH 503

>Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {ON}
           complement(56019..57566) [1548 nt, 516 aa]
          Length = 515

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 87/400 (21%), Positives = 167/400 (41%), Gaps = 45/400 (11%)

Query: 25  PMMYDFVSETRLTWPSLTVQWLP-TEMQPREVDGQQLLRQELLIGTLTTDNEPNYLKIAA 83
           P +Y+ +    L WP +T+  +P T    R    Q +L           DNE   LK++ 
Sbjct: 120 PTVYEMLHNVNLPWPCMTLDIIPDTYGSERRNYPQSILMTTATQAAKKKDNELMVLKLSQ 179

Query: 84  IDLPENVTSSKPSVSDDAKENELSHRQSKIKIVRKFKHEQEVTRARYMPQSPN----IIA 139
           +    + T  K +  ++  E+   +    I        +    R R  P + +    + A
Sbjct: 180 L----SKTLVKENEEEEEDEDNSDNESDPILEDENVPLKDTTNRLRVSPFASSGQEVLTA 235

Query: 140 TLNGAGIVYIFD------------RNIKEKDHGAIASFSYHKE-NGYGLAFNPTV-SGQL 185
           T++  G VYIFD              I +     I +   H    GY L ++P + SG L
Sbjct: 236 TMSENGEVYIFDIAPQSRAFDTPGYQIPKTAKRPIHTIRNHGNVEGYALDWSPLIRSGAL 295

Query: 186 LSASDDGTVALWDVTSTANKSPSQTFDVHTDI-VNDCKWHEFQSSLFGTVSEDNTLIIHD 244
           L+    G V      ++   +  Q F V  +  + D +W   ++++F T   D  + + D
Sbjct: 296 LTGDCSGQVYFTQRHTSKWVTDKQPFTVSNNKSIEDIQWSRTEATVFATAGCDGYIRVWD 355

Query: 245 TNSDR---AIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQ------KPLH 295
           T S +   AI   + ++  N ++++++   LLA+   +    ++DLR+        +P+ 
Sbjct: 356 TRSKKHKPAISTKASNTDVNVISWNEKMGYLLASGDDNGTWGVWDLRQFSPSNENAQPVA 415

Query: 296 SMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAE-----QQPDDAYDGV--- 347
               H+ ++TS+ F P  + ++  +  D  + +WDL ++ A+     QQ  +  +     
Sbjct: 416 QYDFHKGAITSISFHPTDESIVAVASEDNTVTLWDL-SVEADDEEIKQQTAETKELAQIP 474

Query: 348 PELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENVLQIWK 387
           P+L  +H   +  V +   +  +P  + S   +  L IWK
Sbjct: 475 PQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNIWK 511

>Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 520
           aa] {ON} ANNOTATED BY YGOB -
          Length = 520

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 75/346 (21%), Positives = 143/346 (41%), Gaps = 50/346 (14%)

Query: 25  PMMYDFVSETRLTWPSLTVQWLPTEM-QPREVDGQQLLRQELLIGTLTTDNEPNYLKIAA 83
           P +Y+ +    + WP +T+  +P  +   R    Q +L       +   DNE   LK++ 
Sbjct: 122 PTVYEMLHNVNMPWPCMTLDIIPDSLGSERRNYPQSILMTTATQASKKKDNELMVLKLSQ 181

Query: 84  I--------DLPENVTSSKPSVSDDAKENE---LSHRQSKIKI--VRKFKHEQEVTRARY 130
           +        +  +          D   ENE   L    +++K+       + QE+     
Sbjct: 182 LTKTLAKEDNGEDEEEEDDDDTVDPIIENENIQLRDTTNRLKVSPFASSSNSQEI----- 236

Query: 131 MPQSPNIIATLNGAGIVYIFD------------RNIKEKDHGAIASFSYHKE-NGYGLAF 177
                 + AT++  G VYIFD              I +     I +   H    GY L +
Sbjct: 237 ------LTATMSENGEVYIFDLASQVKAFKTPGYQIPKAAKKPIHTIKSHGNVEGYALDW 290

Query: 178 NPTV-SGQLLSASDDGTVALWDVTSTANKSPSQTFDV-HTDIVNDCKWHEFQSSLFGTVS 235
           +P + +G LL+    G V L    ++   S  + F V +   V D +W   +S++F +  
Sbjct: 291 SPLIKTGALLTGDCSGQVYLTQRHTSKWISDKEPFTVANNQSVEDIQWSRTESTVFASCG 350

Query: 236 EDNTLIIHDTNSDRAIQKLSVSSA---FNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQ- 291
            D  + + DT S +    +SV ++    N +++S++   LLA+   +    ++DLR+   
Sbjct: 351 CDGYIRVWDTRSKKHKPAISVKASNTDVNVISWSEKIGYLLASGDDNGTWGVWDLRQFSP 410

Query: 292 ------KPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
                  P+     H+ ++TS+ F+P  + ++  +  D  + +WDL
Sbjct: 411 SNSNNTSPVAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDL 456

 Score = 37.0 bits (84), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 35/79 (44%), Gaps = 16/79 (20%)

Query: 162 IASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTAN---------------KS 206
           +A + +HK     ++FNP     +  AS+D TV LWD++  A+               + 
Sbjct: 419 VAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDEEIKQQAAETKELQQI 478

Query: 207 PSQTFDVH-TDIVNDCKWH 224
           P Q   VH    V D KWH
Sbjct: 479 PPQLLFVHWQKEVKDVKWH 497

>ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR131C
           (RRB1)
          Length = 521

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 75/339 (22%), Positives = 137/339 (40%), Gaps = 38/339 (11%)

Query: 25  PMMYDFVSETRLTWPSLTVQWLPTEM-QPREVDGQQLLRQELLIGTLTTDNEPNYLKIAA 83
           P +Y+ +    L WP +T+  +P  +   R    Q +L       +   DNE   LK++ 
Sbjct: 125 PTVYEMLHNVNLPWPCMTLDLIPDNLGSERRNYPQSILMTTATQASKKKDNELLVLKLSQ 184

Query: 84  IDLPENVTSSKPSVSDDAKENELSHRQSKIKIVRKFKHEQEVTRARYMPQSPN----IIA 139
           +       +       +  E++       I      K      R +  P +      + A
Sbjct: 185 L---AKTLAKDEDDGAEDDEDDEDEDADPIIENENIKLRDTTNRMQVSPFAAESQEVLAA 241

Query: 140 TLNGAGIVYIFDRNIKEKDHGAIASFSYH----------------KENGYGLAFNPTV-S 182
           T++  G  +IFD   + K   A +S  Y                    GYGL ++P + +
Sbjct: 242 TMSENGEAHIFDLGPQVK---AFSSPGYQVPKAAQRPQYTIKNHGNVEGYGLDWSPLIKT 298

Query: 183 GQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDI-VNDCKWHEFQSSLFGTVSEDNTLI 241
           G LL+    G V L   TS+   +  Q F V  +  + D KW   ++++F T   D  + 
Sbjct: 299 GALLTGDCSGRVFLTQRTSSKWITDKQPFTVDNNKSIEDIKWSPSENTVFATCGVDGHVR 358

Query: 242 IHDTNSDRAIQKLSVSSA---FNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQK------ 292
           I D  S +    LSV  +    N ++++++   LLA    +    ++DLR+         
Sbjct: 359 IWDIRSKKHKPALSVKVSDTDVNVMSWNQKISYLLATGDDNGTWGVWDLRQFSNQQGGVS 418

Query: 293 PLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
           P+     H+ ++TS+ F+P  + ++  +  D  + +WDL
Sbjct: 419 PVAQYDFHKGAITSISFNPLDESIIAVASEDNTVTLWDL 457

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 48/108 (44%), Gaps = 19/108 (17%)

Query: 137 IIATLNGAGIVYIFD-RNIKEKDHGA--IASFSYHKENGYGLAFNPTVSGQLLSASDDGT 193
           ++AT +  G   ++D R    +  G   +A + +HK     ++FNP     +  AS+D T
Sbjct: 392 LLATGDDNGTWGVWDLRQFSNQQGGVSPVAQYDFHKGAITSISFNPLDESIIAVASEDNT 451

Query: 194 VALWDVTSTAN---------------KSPSQTFDVH-TDIVNDCKWHE 225
           V LWD++  A+               + P Q   VH    V D KWH+
Sbjct: 452 VTLWDLSVEADDEEIKQQAAEVKELQQIPPQLLFVHWQKEVKDVKWHK 499

>Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 66.6 bits (161), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 79/349 (22%), Positives = 144/349 (41%), Gaps = 59/349 (16%)

Query: 25  PMMYDFVSETRLTWPSLTVQWLPTEM-QPREVDGQQLLRQELLIGTLTTDNEPNYLKIAA 83
           P +Y+ +    + WP LT+  +P  +   R    Q +L   L   T ++    N L + A
Sbjct: 114 PSVYEMLHNVNMPWPCLTLDVIPDTLGSERRNYPQSIL---LATATQSSRKRENELMVLA 170

Query: 84  IDLPENVTSS-------------KPSVSDDAKENE---LSHRQSKIKIVRKFKHEQEVTR 127
           +    N+T +             +    D   ENE   L    +++K+       QEV  
Sbjct: 171 L---SNLTKTLLKDDNEEDDDEEEEDDVDAVIENENMPLKDTTNRLKVSPFAASNQEV-- 225

Query: 128 ARYMPQSPNIIATLNGAGIVYIFD------------RNIKEKDHGAIASFSYHKE-NGYG 174
                    + AT++  G VYI+D              I +     I +   H    GYG
Sbjct: 226 ---------LTATMSENGDVYIYDLAPQSKAFSTPGYQISKSAKRPIHTVKSHGNVEGYG 276

Query: 175 LAFNPTV-SGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDI-VNDCKWHEFQSSLFG 232
           L ++P + +G LLS    G +      ++   +  Q F V  +  + D +W   +S++F 
Sbjct: 277 LDWSPLIKTGALLSGDCSGQIYFTQRHTSRWVTDKQPFTVSNNKSIEDIQWSRTESTVFA 336

Query: 233 TVSEDNTLIIHDTNSDRAIQKLSVSSA---FNTLAFSKRSENLLAAAGTDSNVYLYDLRR 289
           T   D  + I DT S +    +SV ++    N +++S +   LLA+   +    ++DLR+
Sbjct: 337 TAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQ 396

Query: 290 LQ-------KPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
                    +P+     H+ ++TS+ F+P  + ++     D  + +WDL
Sbjct: 397 FTPSNADTVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDL 445

 Score = 37.0 bits (84), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 34/80 (42%), Gaps = 16/80 (20%)

Query: 162 IASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKS--------------- 206
           +A + +HK     +AFNP     +   S+D TV LWD++  A+                 
Sbjct: 408 VAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQTAETKELQEI 467

Query: 207 PSQTFDVH-TDIVNDCKWHE 225
           P Q   VH    V D KWH+
Sbjct: 468 PPQLLFVHWQKEVKDVKWHK 487

>Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 55/223 (24%), Positives = 100/223 (44%), Gaps = 31/223 (13%)

Query: 137 IIATLNGAGIVYIFDRNIKEKDHGAIASFSYH----------------KENGYGLAFNPT 180
           + AT++  G VYI+D   + K   A A+  Y                    GYGL ++P 
Sbjct: 226 LTATMSENGDVYIYDLAPQSK---AFATPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPL 282

Query: 181 V-SGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDI-VNDCKWHEFQSSLFGTVSEDN 238
           + +G LLS    G V      ++   +  Q F V  +  + D +W   +S++F T   D 
Sbjct: 283 IKTGSLLSGDCSGQVYFTQRHTSRWVTDKQPFTVSNNKSIEDIQWSRSESTVFATAGCDG 342

Query: 239 TLIIHDTNSDRAIQKLSVSSA---FNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQ---- 291
            + I DT S +    +SV ++    N +++S +   LLA+   +    ++DLR+      
Sbjct: 343 YIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNA 402

Query: 292 ---KPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
              +P+     H+ ++TS+ F+P  + ++     D  + +WDL
Sbjct: 403 DSVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDL 445

 Score = 37.0 bits (84), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 34/80 (42%), Gaps = 16/80 (20%)

Query: 162 IASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKS--------------- 206
           +A + +HK     +AFNP     +   S+D TV LWD++  A+                 
Sbjct: 408 VAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQTAETKELQEI 467

Query: 207 PSQTFDVH-TDIVNDCKWHE 225
           P Q   VH    V D KWH+
Sbjct: 468 PPQLLFVHWQKEVKDVKWHK 487

>Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar to
           Ashbya gossypii ADR242C
          Length = 522

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 57/229 (24%), Positives = 107/229 (46%), Gaps = 28/229 (12%)

Query: 130 YMPQSPNIIA-TLNGAGIVYIFD------------RNIKEKDHGAIASFSYHKE-NGYGL 175
           +  +SP ++A T++  G  YI+D              I +     + S   H    GYGL
Sbjct: 231 FAAESPEVLAATMSENGEAYIYDLGPQVKAFTSPGYQIPKTAQKPLHSIRNHGNVEGYGL 290

Query: 176 AFNPTV-SGQLLSASDDGTVALWDVTSTANKSPSQTFDV-HTDIVNDCKWHEFQSSLFGT 233
            ++P + +G +L+    G V L   T++   +  Q F V +   + D +W   + ++F T
Sbjct: 291 DWSPLIKTGSILTGDCSGRVYLTQRTASRWVTDKQPFTVGNNKSIEDIQWSRAEMTVFAT 350

Query: 234 VSEDNTLIIHDTNSDRAIQKLSV---SSAFNTLAFSKRSENLLAAAGTDSNVY-LYDLRR 289
              D  + I DT S +    LSV    +  N ++++++   LLA+ G DS  + ++DLR+
Sbjct: 351 CGVDGHIRIWDTRSKKHKPALSVMVSDTDVNVMSWNEKIGYLLAS-GDDSGTWGVWDLRQ 409

Query: 290 LQK-------PLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
                     P+     H+ ++TS+ F+P  + ++  +  D  + +WDL
Sbjct: 410 FSAQNTEKTTPVAQYNFHKAAITSISFNPLDESIIAVASEDNTVTLWDL 458

 Score = 38.1 bits (87), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 36/79 (45%), Gaps = 16/79 (20%)

Query: 162 IASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTAN---------------KS 206
           +A +++HK     ++FNP     +  AS+D TV LWD++  A+               + 
Sbjct: 421 VAQYNFHKAAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQQTAETAELQQI 480

Query: 207 PSQTFDVH-TDIVNDCKWH 224
           P Q   VH    V D KWH
Sbjct: 481 PPQLLFVHWQRDVKDVKWH 499

>Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W
           (REAL)
          Length = 1273

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 48/212 (22%), Positives = 91/212 (42%), Gaps = 19/212 (8%)

Query: 137 IIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQLLSASDDGTVAL 196
           IIA     G + ++  N       + A F  H  +   + FN      L S  ++G + +
Sbjct: 76  IIAGALDNGTLELYSTNEANDTISSTAKFGSHSSSVKTVKFNARQDNVLASGGNNGEIFI 135

Query: 197 WDVTSTANK-------SPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDR 249
           WD+             +P Q+     D VN   W++  + +F +    N   I D  + +
Sbjct: 136 WDMNKCTESPSTYTPLTPGQSMS-SVDEVNSLAWNQSLAHVFASAGSSNFASIWDLKAKK 194

Query: 250 AIQKLSVSSAFNTLA--------FSKRSENLLAAAGTDSN--VYLYDLRRLQKPLHSM-A 298
            +  LS +S  + +           K S  +  A G+D++  + ++DLR    P+ ++  
Sbjct: 195 EVIHLSYTSPSSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPMQTLNQ 254

Query: 299 GHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWD 330
           GH+  + SL++    + LL SSG D  +++W+
Sbjct: 255 GHQKGILSLDWCDQDENLLLSSGRDNTVLLWN 286

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 48/90 (53%), Gaps = 4/90 (4%)

Query: 245 TNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMA---GHE 301
           T+S++ +  L V S FN L +S  +E ++A A  +  + LY        + S A    H 
Sbjct: 50  TDSEKPLASLQVDSKFNDLDWSHNNE-IIAGALDNGTLELYSTNEANDTISSTAKFGSHS 108

Query: 302 DSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
            SV +++F+  QD +L S G++  I +WD+
Sbjct: 109 SSVKTVKFNARQDNVLASGGNNGEIFIWDM 138

>Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W
           (REAL)
          Length = 1270

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 52/212 (24%), Positives = 95/212 (44%), Gaps = 19/212 (8%)

Query: 137 IIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQLLSASDDGTVAL 196
           IIA     G + ++  N       ++A FS H  +   + FN      L S  ++G + +
Sbjct: 76  IIAGALDNGSLELYSTNEVNDAISSMAKFSNHSSSVKTVKFNAKQDNVLASGGNNGEIFI 135

Query: 197 WDVT----STANKSP---SQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDR 249
           WD+     S AN +P    Q+     D VN   W++  + +F +    N   I D  + +
Sbjct: 136 WDMNKCTESPANYTPLTPGQSMS-SVDEVNSLAWNQSLAHVFASAGSSNFASIWDLKAKK 194

Query: 250 AIQKLSVSSAFNTLA--------FSKRSENLLAAAGTDSN--VYLYDLRRLQKPLHSM-A 298
            +  L  +S  + +           K S  +  A G+D++  + ++DLR    PL ++  
Sbjct: 195 EVIHLCYTSPNSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPLQTLNQ 254

Query: 299 GHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWD 330
           GH+  + SL++    + LL SSG D  +++W+
Sbjct: 255 GHQKGILSLDWCHQDENLLLSSGRDNTVLLWN 286

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 67/145 (46%), Gaps = 9/145 (6%)

Query: 245 TNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMA---GHE 301
           ++S++ I  L V S FN L +S  ++ ++A A  + ++ LY    +   + SMA    H 
Sbjct: 50  SDSEKPIASLQVDSKFNDLDWSHNNK-IIAGALDNGSLELYSTNEVNDAISSMAKFSNHS 108

Query: 302 DSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPV 361
            SV +++F+  QD +L S G++  I +WD+      + P +     P   M        V
Sbjct: 109 SSVKTVKFNAKQDNVLASGGNNGEIFIWDMNK--CTESPANYTPLTPGQSMSSVDE---V 163

Query: 362 NEFSHNSNVPWLMCSVEEENVLQIW 386
           N  + N ++  +  S    N   IW
Sbjct: 164 NSLAWNQSLAHVFASAGSSNFASIW 188

>Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}
           YCR057C (REAL)
          Length = 920

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 102/200 (51%), Gaps = 15/200 (7%)

Query: 168 HKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHE-- 225
           H ++   LA++P  S ++++ASDDG + +WDVTS    +   TF+ HT  V   ++ +  
Sbjct: 344 HFDSTNSLAYSPDGS-RVVTASDDGKIKVWDVTSGFCLA---TFEEHTSSVTAVQFAKRG 399

Query: 226 ---FQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNV 282
              F SS+ GTV   + +   +  +    +++     FN LA     E + A +  + ++
Sbjct: 400 QVMFSSSMDGTVRAWDLIRYRNFRTFTGTERIQ----FNCLAVDPSGEVVCAGSLDNFDI 455

Query: 283 YLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDD 342
           +++ ++  Q  L +++GHE  V+ L FS  ++ +L S+  D+ I +W +F    + +P +
Sbjct: 456 HVWSVQTGQ-LLDALSGHEGPVSCLSFS-QENSVLASASWDKTIRIWSIFGRSQQVEPLE 513

Query: 343 AYDGVPELFMMHGGHRSPVN 362
            Y  V  L M   G    V+
Sbjct: 514 VYSDVLALSMRPDGKEVAVS 533

>Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON}
           YCR057C (REAL)
          Length = 924

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 102/200 (51%), Gaps = 15/200 (7%)

Query: 168 HKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHE-- 225
           H ++   LA++P  S ++++ASDDG + +WD+TS    +   TF+ HT  V   ++ +  
Sbjct: 342 HFDSTNSLAYSPDGS-RVVTASDDGKIKVWDITSGFCLA---TFEEHTSSVTAVQFAKRG 397

Query: 226 ---FQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNV 282
              F SSL GTV   + +   +  +    +++     FN LA     E + A +  + ++
Sbjct: 398 QVMFSSSLDGTVRAWDLIRYRNFRTFTGTERIQ----FNCLAVDPSGEVVCAGSLDNFDI 453

Query: 283 YLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDD 342
           +++ ++  Q  L +++GHE  V+ L FS  ++ +L S+  D+ I +W +F    + +P +
Sbjct: 454 HVWSVQTGQ-LLDALSGHEGPVSCLSFS-QENSVLASASWDKTIRIWSIFGRSQQVEPLE 511

Query: 343 AYDGVPELFMMHGGHRSPVN 362
            Y  V  L M   G    V+
Sbjct: 512 VYSDVLALSMRPDGKEVAVS 531

>Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON}
           YCR057C (REAL)
          Length = 916

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 102/200 (51%), Gaps = 15/200 (7%)

Query: 168 HKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHE-- 225
           H ++   LA++P  S ++++ASDDG + +WD+TS    +   TF+ HT  V   ++ +  
Sbjct: 339 HFDSTNCLAYSPDGS-RVVTASDDGKIKVWDITSGFCLA---TFEEHTSSVTAVQFAKRG 394

Query: 226 ---FQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNV 282
              F SSL GTV   + +   +  +    +++     FN LA     E + A +  + ++
Sbjct: 395 QVMFSSSLDGTVRAWDLIRYRNFRTFTGTERIQ----FNCLAVDPSGEVVCAGSLDNFDI 450

Query: 283 YLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDD 342
           +++ ++  Q  L +++GHE  V+ L FS  ++ +L S+  D+ I +W +F    + +P +
Sbjct: 451 HVWSVQTGQ-LLDALSGHEGPVSCLSFS-QENSVLASASWDKTIRIWSIFGRSQQVEPLE 508

Query: 343 AYDGVPELFMMHGGHRSPVN 362
            Y  V  L M   G    V+
Sbjct: 509 VYSDVLALSMRPDGKEVAVS 528

 Score = 30.8 bits (68), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 51/230 (22%), Positives = 93/230 (40%), Gaps = 24/230 (10%)

Query: 121 HEQEVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPT 180
           H Q++T   +   S  ++ T        I+  N  EKD  A  +F+ H++   G AF   
Sbjct: 145 HFQDITSLTWSQDSRFVLTTSKDLS-TKIWSVNSDEKDLAA-TTFNGHRDYVMG-AFFSH 201

Query: 181 VSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVND----CKWHEFQSS------- 229
              ++ + S DG V +W+ T       ++  +   DI        K H F ++       
Sbjct: 202 DQEKIYTVSKDGAVFVWEFTRRPTDDDNEEEEEEVDISKYSWRITKKHFFYANQSKVKCV 261

Query: 230 -------LFGTVSEDNTLIIHDTNSDRAIQKLSVS-SAFNTLAFSKRSENLLAAAGTDSN 281
                  L           ++D      IQ+LS+  +  NT++ +   E L   +     
Sbjct: 262 TFHPATRLLAVGFTSGEFRLYDLPDFTLIQQLSMGQNPVNTVSVNSTGEWLAFGSSKLGQ 321

Query: 282 VYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
           + +Y+ +  +  +    GH DS   L +SP    ++T+S  D +I +WD+
Sbjct: 322 LLVYEWQS-ESYILKQQGHFDSTNCLAYSPDGSRVVTAS-DDGKIKVWDI 369

>YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON}
           RRB1Essential nuclear protein involved in early steps of
           ribosome biogenesis; physically interacts with the
           ribosomal protein Rpl3p
          Length = 511

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 88/187 (47%), Gaps = 20/187 (10%)

Query: 157 KDHGAIASFSYHKENGYGLAFNPTV-SGQLLSASDDGTVALWDVTSTANKSPSQTFDVHT 215
           K+HG +         GYGL ++P + +G LLS    G +      ++   +  Q F V  
Sbjct: 269 KNHGNV--------EGYGLDWSPLIKTGALLSGDCSGQIYFTQRHTSRWVTDKQPFTVSN 320

Query: 216 DI-VNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSA---FNTLAFSKRSEN 271
           +  + D +W   +S++F T   D  + I DT S +    +SV ++    N +++S +   
Sbjct: 321 NKSIEDIQWSRTESTVFATAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGY 380

Query: 272 LLAAAGTDSNVYLYDLRRLQ-------KPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDR 324
           LLA+   +    ++DLR+         +P+     H+ ++TS+ F+P  + ++     D 
Sbjct: 381 LLASGDDNGTWGVWDLRQFTPSNADAVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDN 440

Query: 325 RIIMWDL 331
            + +WDL
Sbjct: 441 TVTLWDL 447

 Score = 37.4 bits (85), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 34/80 (42%), Gaps = 16/80 (20%)

Query: 162 IASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKS--------------- 206
           +A + +HK     +AFNP     +   S+D TV LWD++  A+                 
Sbjct: 410 VAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQAAETKELQEI 469

Query: 207 PSQTFDVH-TDIVNDCKWHE 225
           P Q   VH    V D KWH+
Sbjct: 470 PPQLLFVHWQKEVKDVKWHK 489

>KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.401
           YMR131C
          Length = 517

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 71/337 (21%), Positives = 142/337 (42%), Gaps = 33/337 (9%)

Query: 25  PMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLRQELLIGTLTTDNEPNYLKIAAI 84
           P +Y+ +    L WP +T+  +P ++     +  Q +   +   T  +  + N L + ++
Sbjct: 120 PTVYEMLHNVNLPWPCMTLDVIPDKLGSERRNYPQSIL--MTTATQASKKKENELMVLSL 177

Query: 85  DLPENVTSSKPSVSDDAKENELSHRQSKIKIVRKFKHEQEVTRARYMPQSPN----IIAT 140
                         D+ ++++       I      K      R +  P +      + AT
Sbjct: 178 SQLNKTLVKSEEDEDEDEDSDEEDDSDPIIENENIKLNDTTNRLKVSPFASTDKEVLTAT 237

Query: 141 LNGAGIVYIFD------------RNIKEKDHGAIASFSYHKE-NGYGLAFNPTV-SGQLL 186
           ++  G VYIFD              I +     I +   H    GY L ++P + +G LL
Sbjct: 238 MSENGEVYIFDLAPQSKAFSTPGYQIPKTARRPIHTVRNHGNVEGYALDWSPMIKNGALL 297

Query: 187 SASDDGTVALWDVTSTANKSPSQTFDVHTDI-VNDCKWHEFQSSLFGTVSEDNTLIIHDT 245
           +    G +      ++   +  Q F    +  V D +W   +S++F +   D  + I DT
Sbjct: 298 TGDCSGQIYFTQRHTSKWITDKQPFTAENNKSVEDIQWSRTESTVFASAGCDGYIRIWDT 357

Query: 246 NSDRAIQKLSVSSA---FNTLAFSKRSENLLAAAGTDSNVY-LYDLRRLQ-------KPL 294
            S +    LSV ++    N +++S++   LLA+ G D+ ++ ++DLR+         +P+
Sbjct: 358 RSKKHKPALSVKASNTDVNVISWSEKIGYLLAS-GDDNGLWGVWDLRQFSPDNINDVQPV 416

Query: 295 HSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
                H+ ++TS+ F+P  D ++  +  D  + +WDL
Sbjct: 417 AQYDFHKGAITSINFNPLDDSIIAVASEDNTVTLWDL 453

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 35/80 (43%), Gaps = 16/80 (20%)

Query: 162 IASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTAN---------------KS 206
           +A + +HK     + FNP     +  AS+D TV LWD++  A+               K 
Sbjct: 416 VAQYDFHKGAITSINFNPLDDSIIAVASEDNTVTLWDLSVEADDEEIKQQIAETKELEKI 475

Query: 207 PSQTFDVH-TDIVNDCKWHE 225
           P Q   VH    V D KWH+
Sbjct: 476 PPQLLFVHWQKDVKDVKWHK 495

>Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {ON}
           YMR131C (RRB1) - RiboSome Assembly 2 [contig 204] FULL
          Length = 523

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 77/337 (22%), Positives = 141/337 (41%), Gaps = 34/337 (10%)

Query: 25  PMMYDFVSETRLTWPSLTVQWLPTEM-QPREVDGQQLLRQELLIGTLTTDNEPNYLKIAA 83
           P +Y+ +    L WP L++  +P  +   R    Q LL       +   DNE   LK++ 
Sbjct: 127 PTVYEMLHNVNLPWPCLSLDIVPDRLGSERRNYPQSLLLTTATQASKKKDNELLLLKMSQ 186

Query: 84  IDLPENVTSSKPSVSDDAKENELSHRQSKIKIVRKFKHEQEVTRARYMP---QSP-NIIA 139
           +      T  K    DD ++++    Q  I             R +  P   +SP  + A
Sbjct: 187 L----TKTLVKEDEDDDEEDDDEDEDQDPIVENENIPLRDTTNRLKVSPFASESPEKLTA 242

Query: 140 TLNGAGIVYIFD------------RNIKEKDHGAIASFSYHKE-NGYGLAFNP-TVSGQL 185
           +++  G VYIFD              I +     I +   H    GY L ++P   SG L
Sbjct: 243 SMSENGEVYIFDLGPQVKGFETPGYQIPKTAKKPIHTVKAHGNVEGYALDWSPLNKSGSL 302

Query: 186 LSASDDGTVALWDVTSTANKSPSQTFDV-HTDIVNDCKWHEFQSSLFGTVSEDNTLIIHD 244
           L+    G V L    ++   +    F   +   + D ++   ++++F T   D  + I D
Sbjct: 303 LTGDCSGRVYLTQRHTSKWITDKTAFSAGNNQSIEDIQFSRTEATVFATCGCDGYIRIWD 362

Query: 245 TNSDR---AIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQ-------KPL 294
           T S +   AI   + S+  N ++++++   LLA+   +    ++DLR+          P+
Sbjct: 363 TRSKKHKPAISVKASSTDVNVISWNEKIGYLLASGDDNGTWGVWDLRQFSPNNAASVSPV 422

Query: 295 HSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
              + H+ ++TS+ F+P  D ++  +  D  + +WDL
Sbjct: 423 AQYSFHKGAITSIAFNPLDDSIIAVASEDNTVTLWDL 459

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 37/80 (46%), Gaps = 16/80 (20%)

Query: 162 IASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTAN---------------KS 206
           +A +S+HK     +AFNP     +  AS+D TV LWD++  A+               + 
Sbjct: 422 VAQYSFHKGAITSIAFNPLDDSIIAVASEDNTVTLWDLSVEADDEEIKQQAAETKELQQI 481

Query: 207 PSQTFDVH-TDIVNDCKWHE 225
           P Q   VH    V D KWH+
Sbjct: 482 PPQLLFVHWQKEVKDVKWHK 501

>TBLA0D05560 Chr4 complement(1366222..1367991) [1770 bp, 589 aa]
           {ON} Anc_1.247 YKR036C
          Length = 589

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 76/265 (28%), Positives = 112/265 (42%), Gaps = 51/265 (19%)

Query: 149 IFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPS 208
           ++D N K     AI +   HK +   L  +  +   ++S S D TV LWD  S A+ + S
Sbjct: 281 VYDLNAKH----AITTLKSHKSSLTALQLDDHL---IVSGSKDATVKLWDTKSLADTTNS 333

Query: 209 -------QTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSV----- 256
                   TF  H D +       FQSSL  T S D T+   D N+++ IQ + +     
Sbjct: 334 NINSPLLHTFSSHKDEITAISL--FQSSLI-TTSLDKTIRHWDLNTNKNIQTIPLPSPVS 390

Query: 257 ---SSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQ 313
              S   NTL     +   LA    D  V L+DL R+ K + S   H D +T L+F+  Q
Sbjct: 391 VYTSPIINTLQCFDAA---LATGSRDGIVRLWDL-RIGKIVRSFEKHNDEITGLKFNNKQ 446

Query: 314 DGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPWL 373
              L S+  D  I +WDL              G  ++  M G   S +   S N     +
Sbjct: 447 ---LVSTSLDNSIKIWDL--------------GTGKIIDMFGYDHSII---SMNFANDKI 486

Query: 374 MCSVEEENVLQI--WKPANKIVRPP 396
           +C++ ++   QI  WK +     PP
Sbjct: 487 VCALRDQKSFQIYDWKLSKNWQCPP 511

>CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011w SOF1
          Length = 477

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 56/245 (22%), Positives = 100/245 (40%), Gaps = 64/245 (26%)

Query: 136 NIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTV------SGQ---LL 186
           N IA+ +G G++  +D + +E+    IASF  H     GL   P V      SG    +L
Sbjct: 81  NKIASGSGDGVIKYWDMSSREQ----IASFKAHYGTITGLCITPKVNIDSASSGNQNFVL 136

Query: 187 SASDDGTVALW-------------DVTSTANKSPSQTFDVHT------------------ 215
           S+SDD TV LW              V +T N      +  H                   
Sbjct: 137 SSSDDKTVKLWSVNHEDFAHVDNDQVINTDNGLIKHYYGEHAFQGLDHSRMTSNFVTGGP 196

Query: 216 --------------------DIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLS 255
                               D +N  K+++  +++ G+   DN+++++D  ++ A QK+ 
Sbjct: 197 RINLWDINRSKPLSDLSWGADNINTVKFNQNDANVLGSAGSDNSIVLYDLRTNSATQKIV 256

Query: 256 VSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDG 315
            +   N++ ++         A  D N Y YD+R + + L+    H  +V  ++ SP  + 
Sbjct: 257 QTMRVNSMCWNPMEAFNFVVASEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDISPTGEE 316

Query: 316 LLTSS 320
           ++T+S
Sbjct: 317 VVTAS 321

>NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {ON}
           Anc_2.401 YMR131C
          Length = 511

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 52/220 (23%), Positives = 99/220 (45%), Gaps = 25/220 (11%)

Query: 137 IIATLNGAGIVYIFDRNIKEKDHGA------------IASFSYHKE-NGYGLAFNP-TVS 182
           + AT++  G VYIFD   + K                I +   H    GY L ++P T +
Sbjct: 228 LAATMSENGEVYIFDLGPQSKAFSTPGYKVPKAAKRPIHTVKNHGNVEGYALDWSPLTKT 287

Query: 183 GQLLSASDDGTVALWDVTSTANKSPSQTFDV-HTDIVNDCKWHEFQSSLFGTVSEDNTLI 241
           G LL+    G +      ++   +  Q F V +   + D +W   +S++F +   D  + 
Sbjct: 288 GALLTGDCSGQIYFTQRHTSKWITDKQPFTVANNQSIEDIQWSRTESTVFASAGCDGYIR 347

Query: 242 IHDTNSDRAIQKLSVSSA---FNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQ------- 291
           I DT S +    +SV ++    N +++S++   LLA+   +    ++DLR+         
Sbjct: 348 IWDTRSKKHKPAISVKASNTDVNVISWSEKLGYLLASGDDNGTWGVWDLRQFSPENAGSV 407

Query: 292 KPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
           +P+     H+ ++TS+ F+P  + ++     D  + +WDL
Sbjct: 408 QPVAQYDFHKGAITSISFNPLDESIIAVGSEDNTVTLWDL 447

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 35/80 (43%), Gaps = 16/80 (20%)

Query: 162 IASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTAN---------------KS 206
           +A + +HK     ++FNP     +   S+D TV LWD++  A+               + 
Sbjct: 410 VAQYDFHKGAITSISFNPLDESIIAVGSEDNTVTLWDLSVEADDEEIKQQAAETKELQQI 469

Query: 207 PSQTFDVH-TDIVNDCKWHE 225
           P Q   VH    V D KWH+
Sbjct: 470 PPQLLFVHWQKEVKDVKWHK 489

>YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}
           PWP2Conserved 90S pre-ribosomal component essential for
           proper endonucleolytic cleavage of the 35 S rRNA
           precursor at A0, A1, and A2 sites; contains eight
           WD-repeats; PWP2 deletion leads to defects in cell cycle
           and bud morphogenesis
          Length = 923

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 53/200 (26%), Positives = 102/200 (51%), Gaps = 15/200 (7%)

Query: 168 HKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHE-- 225
           H ++   LA++P  S ++++AS+DG + +WD+TS    +   TF+ HT  V   ++ +  
Sbjct: 344 HFDSTNSLAYSPDGS-RVVTASEDGKIKVWDITSGFCLA---TFEEHTSSVTAVQFAKRG 399

Query: 226 ---FQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNV 282
              F SSL GTV   + +   +  +    +++     FN LA     E + A +  + ++
Sbjct: 400 QVMFSSSLDGTVRAWDLIRYRNFRTFTGTERIQ----FNCLAVDPSGEVVCAGSLDNFDI 455

Query: 283 YLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDD 342
           +++ ++  Q  L +++GHE  V+ L FS  ++ +L S+  D+ I +W +F    + +P +
Sbjct: 456 HVWSVQTGQ-LLDALSGHEGPVSCLSFS-QENSVLASASWDKTIRIWSIFGRSQQVEPIE 513

Query: 343 AYDGVPELFMMHGGHRSPVN 362
            Y  V  L M   G    V+
Sbjct: 514 VYSDVLALSMRPDGKEVAVS 533

>NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.401
           YMR131C
          Length = 512

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 53/221 (23%), Positives = 103/221 (46%), Gaps = 27/221 (12%)

Query: 137 IIATLNGAGIVYIFDRNIKEKDHGA------------IASFSYHKE-NGYGLAFNPTV-S 182
           + AT++  G VYIFD   + K                I +   H    GY L ++P++ +
Sbjct: 229 LTATMSENGEVYIFDLGPQSKAFSTPGYKIPKTAKRPIHTIKSHGNVEGYALDWSPSIQT 288

Query: 183 GQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDI-VNDCKWHEFQSSLFGTVSEDNTLI 241
           G LL+    G +      ++   +  Q F V  +  + D +W   + ++F +   D  + 
Sbjct: 289 GALLTGDCSGQIYFTQRHTSKWVTDKQPFTVSNNKSIEDIQWSRTEGTVFASAGCDGYIR 348

Query: 242 IHDTNSDRAIQKLSVSSA---FNTLAFSKRSENLLAAAGTDSNVY-LYDLRRLQ------ 291
           I DT S +    +SV ++    N +++S +   LLA+ G D+ V+ ++DLR+        
Sbjct: 349 IWDTRSKKHKPAISVKASNTDVNVISWSDKLGYLLAS-GDDNGVWGVWDLRQFSPDTANS 407

Query: 292 -KPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
            +P+     H+ ++TS+ F+P  + ++  +  D  + +WDL
Sbjct: 408 VQPVAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDL 448

 Score = 37.0 bits (84), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 36/80 (45%), Gaps = 16/80 (20%)

Query: 162 IASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTAN---------------KS 206
           +A + +HK     ++FNP     +  AS+D TV LWD++  A+               + 
Sbjct: 411 VAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDEEIKQQAAETKELQQI 470

Query: 207 PSQTFDVH-TDIVNDCKWHE 225
           P Q   VH    V D KWH+
Sbjct: 471 PPQLLFVHWQKEVKDVKWHK 490

>Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W
           (REAL)
          Length = 1271

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 85/188 (45%), Gaps = 19/188 (10%)

Query: 161 AIASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANK-------SPSQTFDV 213
           + A FS H  +   + FN      L S  ++G + +WD+             +P Q+   
Sbjct: 100 STAKFSNHSSSVKTVKFNSKQDNVLASGGNNGEIFIWDMNKCTESPSSYTPLTPGQSMS- 158

Query: 214 HTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLA--------F 265
             D VN   W++  + +F +    N   I D  + + +  LS +S  + +          
Sbjct: 159 SVDEVNSLAWNQSLAHVFASAGSSNFASIWDLKAKKEVIHLSYTSPNSGIKQQLSVVEWH 218

Query: 266 SKRSENLLAAAGTDSN--VYLYDLRRLQKPLHSMA-GHEDSVTSLEFSPHQDGLLTSSGS 322
            K S  +  A G+D++  + ++DLR    PL +++ GH+  + SL++    + LL SSG 
Sbjct: 219 PKNSTRVATATGSDNDPSILVWDLRNANTPLQTLSQGHQKGILSLDWCHQDENLLLSSGR 278

Query: 323 DRRIIMWD 330
           D  +++W+
Sbjct: 279 DNTVLLWN 286

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 63/145 (43%), Gaps = 9/145 (6%)

Query: 245 TNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMA---GHE 301
           T+S++ +  L V S FN L +S  ++ + A A  +  + LY +      + S A    H 
Sbjct: 50  TDSEKPMASLQVDSKFNDLDWSHNNKTI-AGALDNGTLELYSIGDAHDTIVSTAKFSNHS 108

Query: 302 DSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPV 361
            SV +++F+  QD +L S G++  I +WD+      + P       P   M        V
Sbjct: 109 SSVKTVKFNSKQDNVLASGGNNGEIFIWDMNK--CTESPSSYTPLTPGQSMSSVDE---V 163

Query: 362 NEFSHNSNVPWLMCSVEEENVLQIW 386
           N  + N ++  +  S    N   IW
Sbjct: 164 NSLAWNQSLAHVFASAGSSNFASIW 188

>KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {ON}
           highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 477

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 62/127 (48%), Gaps = 3/127 (2%)

Query: 194 VALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQK 253
           + LWD   ++   P+       D V+  K+++ ++ +F +   DN+++++D  ++   QK
Sbjct: 195 INLWD---SSRSRPTANLSWGADNVSTVKFNQNETDIFASAGSDNSVVLYDLRTNSPTQK 251

Query: 254 LSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQ 313
            +     N L ++         A  D N Y YD+R L + LH    H  +V  ++FSP  
Sbjct: 252 FTQRMRTNALCWNPMEAYNFVVASEDHNAYYYDMRNLSRALHVFKDHVSAVMDVDFSPTG 311

Query: 314 DGLLTSS 320
           D ++T S
Sbjct: 312 DEIVTGS 318

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 51/206 (24%), Positives = 89/206 (43%), Gaps = 53/206 (25%)

Query: 136 NIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQ----------L 185
           N +A+ +  G+V  ++ + +E+    I SF  H    YGL     V+ Q          +
Sbjct: 81  NKLASASADGVVKYWNMSTREE----ICSFKAH----YGLVHGLCVTPQHLSANKNENYM 132

Query: 186 LSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDT 245
           LS  DD TV LW V              +T+  +  K  E QSS  G        +I   
Sbjct: 133 LSCGDDKTVKLWSV--------------NTEDFSSSKNDEEQSSTDG--------LIKTF 170

Query: 246 NSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVT 305
           + D A   +             RS+     AG + N  L+D  R  +P  +++   D+V+
Sbjct: 171 HGDYAFLGID----------HHRSKPYFVTAGAEIN--LWDSSR-SRPTANLSWGADNVS 217

Query: 306 SLEFSPHQDGLLTSSGSDRRIIMWDL 331
           +++F+ ++  +  S+GSD  ++++DL
Sbjct: 218 TVKFNQNETDIFASAGSDNSVVLYDL 243

>KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035C Hypothetical ORF
          Length = 426

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 87/192 (45%), Gaps = 17/192 (8%)

Query: 171 NGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVND---CKWHEFQ 227
           N + L   P  +  LL++  +G V L D  +  +    QT   H   VND          
Sbjct: 33  NNWCLKLQPIYNSGLLTSLSNGRVELIDWATHKSILQIQT---HATSVNDMVIINNDRMN 89

Query: 228 SSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAA----AGTDSNVY 283
            SL  T +ED  + I+D  S+  +  L    +   L+   R   LL      +G D+ ++
Sbjct: 90  GSLIATAAED-AVKIYDLKSNDCVATLKNGKSAPFLSLDSR-HGLLGCGTELSGVDAELH 147

Query: 284 LYDLRRLQKPLHSMA-GHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDD 342
           +YD+R  Q+PL S+   H D +TS++F P    +L S  +D  + ++DL     +Q+ DD
Sbjct: 148 VYDIRSWQQPLRSLVDSHHDDITSIKFHPSDPNVLLSGSTDGYVNIYDL----TQQEEDD 203

Query: 343 AYDGVPELFMMH 354
           A   V     +H
Sbjct: 204 ALHQVINFASIH 215

>TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 71/336 (21%), Positives = 138/336 (41%), Gaps = 31/336 (9%)

Query: 25  PMMYDFVSETRLTWPSLTVQWLPTEM-QPREVDGQQLLRQELLIGTLTTDNEPNYLKIAA 83
           P +Y+ +    L WP LT+  +P  +   R    Q +L       +   DNE   LK++ 
Sbjct: 119 PTVYEMLHNVNLPWPCLTLDIIPDNLGSERRNYPQSILMTTATQASKKKDNELMVLKLS- 177

Query: 84  IDLPENVTSSKPSVSDDAKENELSHRQSKIKIVRKFKHEQEVTRARYMP----QSPNIIA 139
             L + +     +V ++  + +       I             R R  P    Q   + +
Sbjct: 178 -HLTKTLVKDDDNVDNEDDDEDDDEAGEPILENESLPLRDTTNRLRISPYATVQQEILTS 236

Query: 140 TLNGAGIVYIFD------------RNIKEKDHGAIASFSYHKE-NGYGLAFNPTV-SGQL 185
           T++  G V+I+D              I +     + +   H    GYGL ++P + +G L
Sbjct: 237 TMSENGEVFIYDLTPQTRAFETPGYQIPKTAKRPLHTIRNHGNVEGYGLDWSPLIKTGAL 296

Query: 186 LSASDDGTVALWDVTSTANKSPSQTFDV-HTDIVNDCKWHEFQSSLFGTVSEDNTLIIHD 244
           L+    G V L    ++   +    F V +   + D +W   +S++F T   D  + I D
Sbjct: 297 LTGDCSGMVYLTQRHTSKWVTDKTPFTVGNNKSIEDIQWSRTESTVFATAGCDGYIRIWD 356

Query: 245 TNSDR---AIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQK------PLH 295
           T S +    I  +  ++  N ++++++   LLA+        ++DLR+         P+ 
Sbjct: 357 TRSKKHKPVISTVVSNTDVNVISWNEKMGYLLASGDDKGTWGIWDLRQFSPNSEKALPVA 416

Query: 296 SMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
               H+ ++TS+ F+P  + ++  +  D  + +WDL
Sbjct: 417 QYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDL 452

 Score = 37.4 bits (85), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 36/80 (45%), Gaps = 16/80 (20%)

Query: 162 IASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTAN---------------KS 206
           +A + +HK     ++FNP     +  AS+D TV LWD++  A+               + 
Sbjct: 415 VAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDEEIKQQKAEIKELEQI 474

Query: 207 PSQTFDVH-TDIVNDCKWHE 225
           P Q   VH    V D KWH+
Sbjct: 475 PPQLLFVHWQKEVKDVKWHK 494

>YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}
           SEC31Component of the Sec13p-Sec31p complex of the COPII
           vesicle coat, required for vesicle formation in ER to
           Golgi transport; mutant has increased aneuploidy
           tolerance
          Length = 1273

 Score = 63.2 bits (152), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 92/212 (43%), Gaps = 19/212 (8%)

Query: 137 IIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQLLSASDDGTVAL 196
           IIA     G + ++  N       ++A FS H  +   + FN      L S  ++G + +
Sbjct: 76  IIAGALDNGSLELYSTNEANNAINSMARFSNHSSSVKTVKFNAKQDNVLASGGNNGEIFI 135

Query: 197 WDVTSTANK-------SPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDR 249
           WD+             +P Q+     D V    W++  + +F +    N   I D  + +
Sbjct: 136 WDMNKCTESPSNYTPLTPGQSMS-SVDEVISLAWNQSLAHVFASAGSSNFASIWDLKAKK 194

Query: 250 AIQKLSVSSAFNTLA--------FSKRSENLLAAAGTDSN--VYLYDLRRLQKPLHSM-A 298
            +  LS +S  + +           K S  +  A G+D++  + ++DLR    PL ++  
Sbjct: 195 EVIHLSYTSPNSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILIWDLRNANTPLQTLNQ 254

Query: 299 GHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWD 330
           GH+  + SL++    + LL SSG D  +++W+
Sbjct: 255 GHQKGILSLDWCHQDEHLLLSSGRDNTVLLWN 286

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 50/89 (56%), Gaps = 4/89 (4%)

Query: 246 NSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMA---GHED 302
           +S++ I  L V S FN L +S  ++ ++A A  + ++ LY        ++SMA    H  
Sbjct: 51  DSEKPIASLQVDSKFNDLDWSHNNK-IIAGALDNGSLELYSTNEANNAINSMARFSNHSS 109

Query: 303 SVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
           SV +++F+  QD +L S G++  I +WD+
Sbjct: 110 SVKTVKFNAKQDNVLASGGNNGEIFIWDM 138

>Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011W
           (SOF1) - 56 kDa nucleolar snRNP protein that shows
           homology to beta subunits of G-proteins and the splicing
           factor Prp4 [contig 94] FULL
          Length = 473

 Score = 62.0 bits (149), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 80/171 (46%), Gaps = 9/171 (5%)

Query: 151 DRNIKEKDHGAIASFSYHKENGY-GLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQ 209
           D  + +  +G I +F  H E+ + G+  + + S  +   ++   + LWD T +    P  
Sbjct: 157 DEEVIKSGNGLIKTF--HGEHAFLGIDHHRSNSNFVTGGAE---INLWDSTRS---RPIT 208

Query: 210 TFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRS 269
                 D V+  K+++ ++ +F +   DN+++++D  ++   QK       N L ++   
Sbjct: 209 NLSWGADNVSTVKFNQNETDIFASAGSDNSVVLYDLRTNSPTQKFVQKMRTNALCWNPME 268

Query: 270 ENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSS 320
                 A  D N Y YD+R L + LH    H  +V  ++FSP  D ++T S
Sbjct: 269 AYNFVVANEDHNAYYYDMRNLSRALHVFKDHVSAVMDVDFSPTGDEIVTGS 319

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 37/186 (19%), Positives = 85/186 (45%), Gaps = 29/186 (15%)

Query: 168 HKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVND-CKWHEF 226
           H++  Y +A N  V  +L +AS DG V  W++++   +    +F  H  +++  C   + 
Sbjct: 66  HRDGVYTIAKNYHVLNKLATASADGVVKYWNMST---REEVCSFKAHYGLIHGLCVTPQH 122

Query: 227 QS-----SLFGTVSEDNTLIIHDTNSD----------------RAIQKLSVSSAFNTLAF 265
            S     +   +  +D T+ +   N+D                  I+      AF  +  
Sbjct: 123 LSQNKNENYMLSCGDDRTVKLWSVNTDDFSSERGDEEVIKSGNGLIKTFHGEHAFLGIDH 182

Query: 266 SKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRR 325
            + + N +      + + L+D  R  +P+ +++   D+V++++F+ ++  +  S+GSD  
Sbjct: 183 HRSNSNFVTGG---AEINLWDSTR-SRPITNLSWGADNVSTVKFNQNETDIFASAGSDNS 238

Query: 326 IIMWDL 331
           ++++DL
Sbjct: 239 VVLYDL 244

>AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR178W
           (PRP4)
          Length = 455

 Score = 62.0 bits (149), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 60/209 (28%), Positives = 97/209 (46%), Gaps = 18/209 (8%)

Query: 166 SYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHE 225
           + H+    GL ++P     LLS   D  V LWD+TS +     +    H   V+  K H 
Sbjct: 212 AAHEGKIGGLDWHPD-GNHLLSGGGDNLVKLWDMTSNS----FEELRGHAGRVSRVKVHP 266

Query: 226 FQSSLFGTVSEDNTLIIHDTNSDRAIQ-KLSVSSAFNTLAFSKRSENLLAAAGTDSNVYL 284
               L  + S D T I+ D      +Q +   S A  T+AF      LLA+AG D+   +
Sbjct: 267 -SGRLAASASFDLTWILWDLERKVELQLQEGHSKAVYTIAFQSDGA-LLASAGLDAVCAI 324

Query: 285 YDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQ------ 338
           +DLR   +P+  + GH  +++ +++SP+   L T+ G+D  + +WD+ N+G E       
Sbjct: 325 WDLRS-GEPIMKLEGHAGAISGVDWSPNGYQLATA-GADGTVRVWDIRNVGTESALLAHQ 382

Query: 339 --QPDDAYDGVPELFMMHGGHRSPVNEFS 365
               D  +      F++  GH   VN F+
Sbjct: 383 VAALDVKFKKNNGTFLVSCGHDRLVNIFN 411

>NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa]
           {ON} Anc_1.247 YJL112W
          Length = 668

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 75/283 (26%), Positives = 115/283 (40%), Gaps = 52/283 (18%)

Query: 85  DLPENVTSSKPSVSDDAKENELSHRQSKIKIVRKFK--HEQEVTRARYMPQSPNIIATLN 142
           DL +NVT    S S       L  +      +  FK  H   +T   +      +    N
Sbjct: 318 DLADNVTKKHTSSSTTRSNYNLGDK------IHSFKSAHTDSITCLDFAKSWNTLCTAAN 371

Query: 143 GAGIVYIFDRNIKEKDHGAIASFSYHKE--NGYGLAFNPTVSGQLLSASDDGTVALWDV- 199
               V I+D +  E+    + SFS HK   N   ++ N ++   L++ S D TV +W++ 
Sbjct: 372 YDNTVKIWDLSTTEQ----LGSFSGHKATINCLQMSNNNSL---LMTGSKDATVKVWNID 424

Query: 200 --TSTANKSPSQ-----------TFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTN 246
                A K  +Q           TFD H+D +       F      + S D T+  +D  
Sbjct: 425 LGIELAKKENNQLEEKDESPCVLTFDSHSDEITALS---FDGEYLISASRDKTVRQYDII 481

Query: 247 SDRAIQKL-----SVSSAFNTLAFSKRS---------ENLLAAAGTDSNVYLYDLRRLQK 292
           S +  Q L     S+S     +  S+ S            L    +D    L+DLR + K
Sbjct: 482 SGKCFQTLATNFGSISKTNGDMLMSRNSPVVGALQYYNTALITGSSDGIARLWDLR-IGK 540

Query: 293 PLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIG 335
            + SM GH  ++TSL+F P +   LT+S +D  I +WDL   G
Sbjct: 541 VVRSMEGHNGAITSLQFDPIK---LTTSSTDGDIRVWDLRTAG 580

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 43/98 (43%), Gaps = 16/98 (16%)

Query: 290 LQKPLHSM-AGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVP 348
           L   +HS  + H DS+T L+F+   + L T++  D  + +WDL                 
Sbjct: 339 LGDKIHSFKSAHTDSITCLDFAKSWNTLCTAANYDNTVKIWDL--------------STT 384

Query: 349 ELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENVLQIW 386
           E      GH++ +N    ++N   LM   ++  V ++W
Sbjct: 385 EQLGSFSGHKATINCLQMSNNNSLLMTGSKDATV-KVW 421

>Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa]
           {ON} YDR128W - Hypothetical ORF [contig 174] FULL
          Length = 1102

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 82/155 (52%), Gaps = 4/155 (2%)

Query: 178 NPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSED 237
           +P+    ++S S+   + LW+++  ++ +       H+  + D  +H     +  T S D
Sbjct: 78  HPSKPSWVISTSNQKAL-LWNLSRNSSDAIEHVLHGHSRAITDINFHPTHPEILATCSID 136

Query: 238 NTLIIHDTNS-DRAIQKLSV-SSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLH 295
             +   D  S  RA    SV S+  + + ++ ++ N++A+A ++ +VY++DLR+   PLH
Sbjct: 137 AYVHAWDMRSPRRAYYSASVWSAGASQVKWNYKNSNVMASAHSN-DVYIWDLRKGCTPLH 195

Query: 296 SMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWD 330
            + GH +SV S++FS   +  + SS +D  +  WD
Sbjct: 196 VLQGHVNSVNSIDFSKFDETEIMSSSNDGTVKFWD 230

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 45/201 (22%), Positives = 80/201 (39%), Gaps = 22/201 (10%)

Query: 121 HEQEVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPT 180
           H + +T   + P  P I+AT +    V+ +D     +   A  S S        + +N  
Sbjct: 113 HSRAITDINFHPTHPEILATCSIDAYVHAWDMRSPRR---AYYSASVWSAGASQVKWNYK 169

Query: 181 VSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTL 240
            S  + SA  +  V +WD+      +P      H + VN   + +F  +   + S D T+
Sbjct: 170 NSNVMASAHSN-DVYIWDLRKGC--TPLHVLQGHVNSVNSIDFSKFDETEIMSSSNDGTV 226

Query: 241 IIHDTN-SDRAIQKLSVSSAF-----NTLAFSKRSENLLAAAGTDSNVYLYDLRRLQ--- 291
              D + SD+  Q+ +V++ F       L F K    ++   G  ++VYL          
Sbjct: 227 KFWDYSLSDKEPQR-TVTTDFPVSRGRYLPFGK-GFCVMPMIGGKNSVYLSSFPSSSESE 284

Query: 292 -----KPLHSMAGHEDSVTSL 307
                +P++   GH D V+  
Sbjct: 285 PVSKFQPIYVFKGHSDRVSDF 305

>SAKL0A01738g Chr1 (157360..160089) [2730 bp, 909 aa] {ON} highly
           similar to uniprot|P25636 Saccharomyces cerevisiae
           YCR057C PWP2 part of small (ribosomal) subunit (SSU)
           processosome (contains U3 snoRNA) Eight WD-repeats with
           homology with G protein beta subunits flanked by
           nonhomologous N-terminal and C-terminal extensions
           regulatory protein
          Length = 909

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 98/196 (50%), Gaps = 15/196 (7%)

Query: 168 HKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHE-- 225
           H ++   L ++P  S +++++SDDG + +WDV S    +   TFD HT  V   ++ +  
Sbjct: 341 HFDSMNSLTYSPDGS-RVVTSSDDGKIKIWDVVSGFCLA---TFDDHTSSVTAVQFAKKG 396

Query: 226 ---FQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNV 282
              F +SL GTV   + +   +  +  A +++     FN LA     E + A +     +
Sbjct: 397 QVLFSASLDGTVKAWDLIRYRNFRTFTAAERIQ----FNCLAVDPSGEVVCAGSVDSFEI 452

Query: 283 YLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDD 342
           +++ ++     L ++AGHE  V+ L FS +++ +L S+  D+ I +W +F    + +P D
Sbjct: 453 HVWSVQT-GNLLDTLAGHEGPVSCLSFS-NENSVLASASWDKTIRIWSIFGRSQQVEPFD 510

Query: 343 AYDGVPELFMMHGGHR 358
            Y  V  + M   G +
Sbjct: 511 VYSDVLAISMRPDGKQ 526

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 45/82 (54%), Gaps = 3/82 (3%)

Query: 251 IQKLSVS-SAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEF 309
           IQ+LS+  +A NT++ +   E L   +     + +Y+ +  +  +    GH DS+ SL +
Sbjct: 292 IQQLSMGQNAVNTVSINNSGEWLAFGSSKLGQLLVYEWQS-ESYILKQQGHFDSMNSLTY 350

Query: 310 SPHQDGLLTSSGSDRRIIMWDL 331
           SP    ++TSS  D +I +WD+
Sbjct: 351 SPDGSRVVTSS-DDGKIKIWDV 371

>KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {ON}
           highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131C RRB1 RiboSome Assembly 2
          Length = 522

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 74/340 (21%), Positives = 144/340 (42%), Gaps = 40/340 (11%)

Query: 25  PMMYDFVSETRLTWPSLTVQWLPTEM-QPREVDGQQLLRQELLIGTLTTDNEPNYLKIAA 83
           P +Y+ +    L WP L++  +P ++   R    Q LL       +   DNE   LK++ 
Sbjct: 126 PTVYEMLHNVNLPWPCLSLDIVPDKLGSERRNYPQSLLLTTATQASKKKDNELLLLKMSQ 185

Query: 84  IDLPENVTSSKPSVSDDAKENELSHRQSKIKIVRKFKHEQEVTRARYMP---QSP-NIIA 139
           +      T  K   +++  +++    Q  I        +    R +  P   +SP  + A
Sbjct: 186 L----AKTLVKDDNNEEEDDDDEDEDQDPIVENENIPLKDTTNRLKVSPFASESPEKLTA 241

Query: 140 TLNGAGIVYIFD----------------RNIKEKDHGAIASFSYHKENGYGLAFNP-TVS 182
           T++  G VYIFD                +  K+  H      S+    GY L ++P   S
Sbjct: 242 TMSENGEVYIFDLGPQVKAFEIPGYQLPKTAKKPIHTV---RSHGNVEGYALDWSPLNKS 298

Query: 183 GQLLSASDDGTVALWDVTSTANKSPSQTFDV-HTDIVNDCKWHEFQSSLFGTVSEDNTLI 241
           G LL+    G V L    ++   +    F   +   + D ++   ++++F +   D  + 
Sbjct: 299 GSLLTGDCSGRVYLTQRHTSKWITDKTAFSAGNNQSIEDIQFSRTEATVFASCGCDGYIR 358

Query: 242 IHDTNSDRAIQKLSVSSA---FNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQ------- 291
           I DT S +    +SV ++    N ++++++   LLA+   + +  ++DLR+         
Sbjct: 359 IWDTRSKKHKPAISVKASATDVNVISWNEKIGYLLASGDDNGSWGVWDLRQFSPNTAAST 418

Query: 292 KPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
            P+     H+ ++TS+ F+P  D ++  +  D  + +WDL
Sbjct: 419 SPVAQYNFHKGAITSISFNPLDDSIIAVASEDNTVSLWDL 458

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 37/80 (46%), Gaps = 16/80 (20%)

Query: 162 IASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKS--------------- 206
           +A +++HK     ++FNP     +  AS+D TV+LWD++  A+                 
Sbjct: 421 VAQYNFHKGAITSISFNPLDDSIIAVASEDNTVSLWDLSVEADDEEIKQQAAETRELQEI 480

Query: 207 PSQTFDVH-TDIVNDCKWHE 225
           P Q   VH    V D KWH+
Sbjct: 481 PPQLLFVHWQKEVKDVKWHK 500

>NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {ON}
           Anc_6.276
          Length = 494

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 79/327 (24%), Positives = 132/327 (40%), Gaps = 66/327 (20%)

Query: 26  MMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLRQELLIGTLTTDNEPNYLKIAAID 85
           + +D ++E  +T+    +QWLP+ + PR++                T +E   L+I + +
Sbjct: 141 LTWDKIAECNVTYSISNIQWLPSHVNPRKI---------------ATSSES--LRIWSFN 183

Query: 86  LPENVTSSKPSVSDDAKENELSHRQSKIKIVRKFKHEQEVTRARYMPQSPNIIATLNGAG 145
             EN    + ++S   K N+  H Q                      Q P    T  G  
Sbjct: 184 DEENTIQEQINLSL-CKYNKQHHHQ----------------------QQPAPSETPGGTV 220

Query: 146 IVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANK 205
           I  + +  + E     I SF +          NP  +  L+S+S D T  +WD+ S +N 
Sbjct: 221 IDPLSNSVLGELP--PITSFHW----------NPIDTNLLISSSIDTTCIVWDLQS-SNY 267

Query: 206 SPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNS---DRAIQKLSVS----- 257
             +Q    H   V D ++    + LF +   D ++ + D  S      I +  VS     
Sbjct: 268 VKTQLI-AHDSEVYDVRFLTQSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPVSDLNPD 326

Query: 258 -SAFNTLAF--SKRSENLLAAAGTDSN-VYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQ 313
            S F  L    S    N++A    DSN + + D+R  + PL  + GH  SV  +++ P +
Sbjct: 327 TSQFALLRLEPSPHDPNVMATFAADSNKILILDMRNPESPLMILEGHSASVNQIKWHPIK 386

Query: 314 DGLLTSSGSDRRIIMWDLFNIGAEQQP 340
             +L S G D +++ WDL    A   P
Sbjct: 387 RNVLLSGGDDCQVLYWDLNKCTASSDP 413

>KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011W
          Length = 478

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 52/241 (21%), Positives = 94/241 (39%), Gaps = 60/241 (24%)

Query: 136 NIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPT-VSGQ----LLSASD 190
           N +AT +G G++  ++ + +E+    ++SF  H     GL   P+ +S Q    +LS  D
Sbjct: 81  NKLATASGDGVIKYWNMSTREE----LSSFKAHYGMVTGLCVTPSYLSPQRENFMLSCGD 136

Query: 191 DGTVALWDVTS------------------------------------------------- 201
           D TV LW V S                                                 
Sbjct: 137 DKTVKLWSVNSDDFSNVKDDTRLNTDEGIIKTFHGEHAFQSLDHHRQKSNFVTGGAQIEL 196

Query: 202 --TANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSA 259
             T    P        D +N  ++++ +  +  +   DN+++++D  ++   QK+  +  
Sbjct: 197 WDTNRSKPISNLSWGADNINHVRFNQNEVDILASTGSDNSVVLYDLRTNSPTQKIVQTMR 256

Query: 260 FNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTS 319
            N++ ++         A  D N Y YD+R + K LH    H  +V  ++FSP  D ++T 
Sbjct: 257 TNSICWNPVEAFNFVIANEDHNAYYYDMRNMSKALHVFKDHVSAVMDVDFSPTGDEVVTG 316

Query: 320 S 320
           S
Sbjct: 317 S 317

>KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON}
           similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1133

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 79/157 (50%), Gaps = 4/157 (2%)

Query: 185 LLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHD 244
           ++S S+   + +W+++ +++K+       H   + D  +H  Q  +  T S D   +  D
Sbjct: 85  VISTSNQKAI-VWNLSRSSSKAVEHVLHGHFRAITDINFHPLQPEILATSSIDTYALAWD 143

Query: 245 TNSDRA--IQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHED 302
             S +    +  +  S    + ++ ++ N+LA + ++  VY++D+R+   PL  + GH  
Sbjct: 144 MRSPKKPYFRTSNWRSGAAQVKWNHKNSNVLATSHSNI-VYVWDVRKGTSPLSVLEGHSG 202

Query: 303 SVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQ 339
           SV S++F+P  +  + SSG+D  +  WD   +  E Q
Sbjct: 203 SVNSIDFNPFNETEIMSSGNDGTVKFWDYNKVEDELQ 239

 Score = 33.9 bits (76), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 42/90 (46%), Gaps = 4/90 (4%)

Query: 109 RQSKIKIVRKFKHEQEVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYH 168
           R  K    R         + ++  ++ N++AT + + IVY++D     K    ++    H
Sbjct: 145 RSPKKPYFRTSNWRSGAAQVKWNHKNSNVLAT-SHSNIVYVWD---VRKGTSPLSVLEGH 200

Query: 169 KENGYGLAFNPTVSGQLLSASDDGTVALWD 198
             +   + FNP    +++S+ +DGTV  WD
Sbjct: 201 SGSVNSIDFNPFNETEIMSSGNDGTVKFWD 230

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 45/205 (21%), Positives = 79/205 (38%), Gaps = 23/205 (11%)

Query: 124 EVTRARYMPQSPN---IIATLNGAGIVYIFDRN----IKEKDHGAIASFSYHKENGYGLA 176
           EV   ++ P       +I+T N   IV+   R+    ++   HG   + +        + 
Sbjct: 69  EVADVQWCPHPAKHHWVISTSNQKAIVWNLSRSSSKAVEHVLHGHFRAIT-------DIN 121

Query: 177 FNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSE 236
           F+P     L ++S D     WD+ S   K P              KW+   S++  T S 
Sbjct: 122 FHPLQPEILATSSIDTYALAWDMRSP--KKPYFRTSNWRSGAAQVKWNHKNSNVLAT-SH 178

Query: 237 DNTLIIHDTNSDRAIQKLSV----SSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQK 292
            N + + D    +    LSV    S + N++ F+  +E  + ++G D  V  +D  +++ 
Sbjct: 179 SNIVYVWDVR--KGTSPLSVLEGHSGSVNSIDFNPFNETEIMSSGNDGTVKFWDYNKVED 236

Query: 293 PLHSMAGHEDSVTSLEFSPHQDGLL 317
            L      E  V    + P  DG  
Sbjct: 237 ELQMTITTEFPVWRGRYLPFGDGYC 261

>AAR057W Chr1 (442821..445589) [2769 bp, 922 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR057C (PWP2)
          Length = 922

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 100/194 (51%), Gaps = 15/194 (7%)

Query: 174 GLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHE-----FQS 228
            LA++P    ++++A++DG + +WD+ S    +   TF+ HT  V   ++ +     F S
Sbjct: 361 ALAYSPD-GARIVTAAEDGKIKIWDIVSGFCLA---TFEEHTSSVTSVQFAKNGQIMFSS 416

Query: 229 SLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLR 288
           SL GTV   + +   +  +  A +++     F+ LA     E + A +  + ++ ++ ++
Sbjct: 417 SLDGTVKAWDLMRFRNFRTFTATERIQ----FSCLAADPTGEVVCAGSLDNYDIQVWSVQ 472

Query: 289 RLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVP 348
             Q  L +++GHE  V+ L FS  ++ +L S+  D+ I +W +F    + +P +AY  V 
Sbjct: 473 TGQ-LLDTLSGHEGPVSCLSFS-RENSILASASWDKTIRVWSIFGRSQQVEPIEAYSDVL 530

Query: 349 ELFMMHGGHRSPVN 362
           ++ M   G +  V+
Sbjct: 531 DISMRPDGKQVAVS 544

>Ecym_2093 Chr2 (165578..168349) [2772 bp, 923 aa] {ON} similar to
           Ashbya gossypii AAR057W
          Length = 923

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 98/193 (50%), Gaps = 15/193 (7%)

Query: 175 LAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHE-----FQSS 229
           LA++P  S ++++AS DG + +WD+ S    +   TF+ H   V   ++ +     F + 
Sbjct: 363 LAYSPDGS-RIVTASSDGKIKIWDIVSGFCLA---TFEEHVSAVTAVQFAKKGQIMFSAC 418

Query: 230 LFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRR 289
           L GTV   + +   +  +  A +++     FN LA     E + A +  D N++++ ++ 
Sbjct: 419 LDGTVKAWDLIRYRNFRTFTATERIQ----FNCLAVDPSGEIVCAGSLDDFNIHVWSVQT 474

Query: 290 LQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPE 349
            Q  L +++GHE  V+ L FS +++ +L S+  D+ I +W +F    + +P + +  V  
Sbjct: 475 GQ-LLDTLSGHEGPVSCLSFS-NENSVLASASWDKTIRIWSIFGRSQQVEPIEVFSDVLA 532

Query: 350 LFMMHGGHRSPVN 362
           + M   G +  V+
Sbjct: 533 ISMRPDGKQVSVS 545

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 45/199 (22%), Positives = 87/199 (43%), Gaps = 31/199 (15%)

Query: 156 EKDHGAIASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTF---- 211
           EKD  +I +FS H++   G  F+      + + S DG +  W+ T    K P++ +    
Sbjct: 196 EKDLASI-TFSGHRDYVMGSFFSDN-QEVIYTVSKDGALFQWEYT----KKPTEGYISED 249

Query: 212 DVHTDIVN------------------DCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQK 253
           +  +D+ N                   C      S+L      +    I++  +   IQ+
Sbjct: 250 EEESDLSNYSWRITKKNYFHIKQTKVKCVTFHAASNLLVVGFGNGEFRIYELPTFTLIQQ 309

Query: 254 LSVS-SAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPH 312
           LS+  +  NT++ +K  E L   +     + +Y+ +  +  +    GH D++  L +SP 
Sbjct: 310 LSMGQNPVNTVSVNKSGEWLAFGSSKLGQLLVYEWQS-ESYILKQQGHFDTMNDLAYSPD 368

Query: 313 QDGLLTSSGSDRRIIMWDL 331
              ++T+S SD +I +WD+
Sbjct: 369 GSRIVTAS-SDGKIKIWDI 386

>CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} similar
           to uniprot|P16649 Saccharomyces cerevisiae YCR084c TUP1
           general transcription repressor
          Length = 643

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 57/218 (26%), Positives = 101/218 (46%), Gaps = 19/218 (8%)

Query: 175 LAFNPTVSGQLLS-ASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGT 233
           + F+P   G+ L+  ++D  + +WD+   A +        H   +    + +  + L  +
Sbjct: 379 VCFSP--DGKFLATGAEDKLIRIWDI---AQRKIVMVLRGHEQDIYSLDYFQSGNKLV-S 432

Query: 234 VSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYD------L 287
            S D T+ I D ++ +    LS+     T+A S  + N +AA   D  V ++D      +
Sbjct: 433 GSGDRTIRIWDLHTGQCSLTLSIEDGVTTVAVSPGNGNYVAAGSLDRTVRVWDSNSGFLV 492

Query: 288 RRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGS-DRRIIMWDLFNI-GAEQQPDDAYD 345
            RL     +  GH+DSV S+ F+  +DG    SGS DR + +W+L NI GA   P    +
Sbjct: 493 ERLDSEGETGVGHKDSVYSVVFT--RDGKNIVSGSLDRSVKLWNLRNINGASTSPQPKTE 550

Query: 346 GVPELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENVL 383
           G  E  M + GH+  V   +   N  +++   ++  V+
Sbjct: 551 GNCE--MTYIGHKDFVLSVTTTENDQYILSGSKDRGVI 586

>KLLA0C08976g Chr3 (784536..787271) [2736 bp, 911 aa] {ON} highly
           similar to uniprot|P25636 Saccharomyces cerevisiae
           YCR057C PWP2 part of small (ribosomal) subunit (SSU)
           processosome (contains U3 snoRNA) Eight WD-repeats with
           homology with G protein beta subunits flanked by
           nonhomologous N-terminal and C-terminal extensions
           regulatory protein
          Length = 911

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 99/190 (52%), Gaps = 15/190 (7%)

Query: 174 GLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHE-----FQS 228
           GL ++P  S ++++AS +G + +WDV S    +   TFD H   V+  ++ +     F +
Sbjct: 346 GLCYSPDGS-KIVTASHEGKIKIWDVASGFCLA---TFDEHAGGVSAVEFAKKGQVLFSA 401

Query: 229 SLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLR 288
           SL GTV   + +   +  +  A +++     FN+LA     E + A +    +++++ ++
Sbjct: 402 SLDGTVKAWDLIRYRNFRTFTATERIQ----FNSLAVDPSGEVVCAGSEDSFDIFVWSVQ 457

Query: 289 RLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVP 348
             Q  + +++GHE  ++ L FS +++G+L S+  D+ I +W LF    + +P + +  V 
Sbjct: 458 TGQ-LVDTLSGHEGPISCLSFS-NENGVLASASWDKTIRVWSLFGRSQQVEPFEVFSDVL 515

Query: 349 ELFMMHGGHR 358
            + M   G +
Sbjct: 516 SISMKPDGQQ 525

>KNAG0I02540 Chr9 (489509..492265) [2757 bp, 918 aa] {ON} Anc_6.325
           YCR057C
          Length = 918

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 101/200 (50%), Gaps = 15/200 (7%)

Query: 168 HKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHE-- 225
           H ++   L ++P  S ++++A++DG + +WDV S    +   T D HT  V   ++ +  
Sbjct: 340 HFDSTNSLTYSPDGS-RVVTAAEDGKIKVWDVVSGFCLA---TLDEHTAAVTQVQFAKKG 395

Query: 226 ---FQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNV 282
              F +SL GTV   + +   +     A +++     FN+LA     E + A +  + ++
Sbjct: 396 QVLFSASLDGTVKAWDLIRYRNFRVFTAAERIQ----FNSLAVDPSGEVVCAGSMDNFDI 451

Query: 283 YLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDD 342
           +++ ++  Q  L S++GHE  V+ L FS  ++G+L S+  D+ I +W +F    +  P +
Sbjct: 452 HVWSVQTGQ-LLDSLSGHEGPVSCLAFS-QENGVLASASWDKTIRIWYIFGRSQQVDPIE 509

Query: 343 AYDGVPELFMMHGGHRSPVN 362
            Y  V  L +   G +  V+
Sbjct: 510 VYSDVLSLTIRPDGKQVAVS 529

>NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {ON}
           Anc_7.310
          Length = 1276

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 51/213 (23%), Positives = 95/213 (44%), Gaps = 19/213 (8%)

Query: 137 IIATLNGAGIVYIFDR--NIKEKDHGAIASFSYHKENGYGLAFNPTVSGQLLSASDDGTV 194
           I   L+  G + +F +  N  +    ++  F  H      L FNP     L SA ++G +
Sbjct: 79  IAGALDDNGKIELFSKEENDTKISLKSLGKFKKHTTAVNTLRFNPKQQNVLASAGNNGEI 138

Query: 195 ALWDVT---STANKSPSQTFDVHT--DIVNDCKWHEFQSSLFGTVSEDNTLI-IHDTNSD 248
            +WD+    S+ + SPS      +  D +    W++  + +F +  +  T   I D  + 
Sbjct: 139 LIWDINKTLSSTDYSPSAPGIAMSTQDEIKSVSWNKSLAHVFASAGDTTTYASIWDLKAK 198

Query: 249 RAIQKLSVSSAFNTLA--------FSKRSENLLAAAGTDSN--VYLYDLRRLQKPLHSMA 298
           + +  L+ +S    L           K +  +  A+G+DS+  + ++DLR    P+ ++ 
Sbjct: 199 KEVIHLNYTSPKTGLKPNLAVVEWHPKVTTYVATASGSDSDPVILIWDLRNSNMPMTTLE 258

Query: 299 G-HEDSVTSLEFSPHQDGLLTSSGSDRRIIMWD 330
           G H   + SL++    + LL SSG D  + +WD
Sbjct: 259 GPHTKGIMSLDWCTKDESLLLSSGRDGIVALWD 291

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 85/187 (45%), Gaps = 25/187 (13%)

Query: 154 IKEKDHGAIASFSYHKENGYGLAFNPTVSGQLLS-ASDDGTVALWDVTSTANKSPSQTFD 212
           +K  ++   A+F++ ++         T SG + +  S+D T+ LW + S   K P+    
Sbjct: 2   VKLAEYSRTATFAWSQDK-IPYIVTGTASGTIAADFSNDSTLELWSLLSDPKKDPTPVAS 60

Query: 213 VHTDI-VNDCKWHEFQSSLFGTVSEDNTLI--IHDTNSDRAIQKLSV------SSAFNTL 263
           + TD    D  W  F +       +DN  I       +D  I   S+      ++A NTL
Sbjct: 61  ITTDARFKDLDW-SFDNKFIAGALDDNGKIELFSKEENDTKISLKSLGKFKKHTTAVNTL 119

Query: 264 AFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSD 323
            F+ + +N+LA+AG +  + ++D+ +             +++S ++SP   G+  S+  +
Sbjct: 120 RFNPKQQNVLASAGNNGEILIWDINK-------------TLSSTDYSPSAPGIAMSTQDE 166

Query: 324 RRIIMWD 330
            + + W+
Sbjct: 167 IKSVSWN 173

>KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 422

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 52/176 (29%), Positives = 85/176 (48%), Gaps = 19/176 (10%)

Query: 167 YHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKW--H 224
           Y +EN + L   P     L+++  DG+V L D  +    S  Q    HT  +ND K    
Sbjct: 10  YFEENNWCLKLQPLYQHGLMTSISDGSVHLLDWGNLKTISSIQ---CHTTSINDMKVINS 66

Query: 225 EFQS-SLFGTVSEDNTLI--IHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGT--- 278
           +F + ++F T +ED   +  I   N+  ++Q    +S F    FS  S + + A GT   
Sbjct: 67  DFDTGAVFATAAEDGVKVWDIRARNNVASLQN-DKASPF----FSLDSRHNMLACGTELK 121

Query: 279 --DSNVYLYDLRRLQKPLHSMA-GHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
             D+ +++YD+R   KP+ S    H D +T ++F P    LL S  +D  + ++DL
Sbjct: 122 DYDAELHIYDIRNWTKPVRSFVDSHHDDITDIKFHPCDSNLLMSGSTDGYVNIYDL 177

>ADR090W Chr4 (868742..872443) [3702 bp, 1233 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL195W (SEC31)
          Length = 1233

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 54/210 (25%), Positives = 88/210 (41%), Gaps = 22/210 (10%)

Query: 139 ATLNGA---GIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQLLSASDDGTVA 195
           A L GA   G+V  F      ++  ++A  + H      + FN   +   +S    G + 
Sbjct: 74  AMLAGALENGVVEFF----CARERRSVARVARHTTGVRAVRFNAKQANVAVSGGSQGEIF 129

Query: 196 LWDVT--STANKSPSQTFDVHTDI--VNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAI 251
           +WD    S A  SP       T I  V    W++  + +F +        I D  + + +
Sbjct: 130 VWDTNKISAAGYSPFGPGTAMTPIDEVQSLAWNQSLAHVFASAGSSGFASIWDLKAKKEV 189

Query: 252 QKLSVSSAF----NTLAFSK----RSENLLAAAGTDSN--VYLYDLRRLQKPLHSMA-GH 300
             LS +S      N LA  +     S  +  A G D+   + ++DLR    PL  M+ GH
Sbjct: 190 IHLSYTSPHSGLKNQLAVVEWHPSNSTRVATATGNDNEPVILVWDLRNANMPLQVMSQGH 249

Query: 301 EDSVTSLEFSPHQDGLLTSSGSDRRIIMWD 330
              + SL++  H + L+ SSG D   I+W+
Sbjct: 250 SKGILSLDWCKHDEKLMLSSGRDNTCILWN 279

>TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {ON}
           Anc_5.201 YLL011W
          Length = 488

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 53/242 (21%), Positives = 91/242 (37%), Gaps = 61/242 (25%)

Query: 136 NIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQ------LLSAS 189
           N +A+ +  G+V  F+ + +E+    I SF  H     GL   P  S        ++S  
Sbjct: 81  NKLASSSADGVVKYFNMSTREE----ICSFKAHYGLVTGLCVRPETSATNKNEHYMISCG 136

Query: 190 DDGTVALWDVTST----------------------------------------------- 202
           DD TV LW V S                                                
Sbjct: 137 DDKTVKLWSVDSNDFSNNKKDDTIHKGDGLLKTYYGDHAFFGLDHHRNNSTFVTGGAQIQ 196

Query: 203 ---ANKS-PSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSS 258
              AN+S P        D V   K+++ ++ +  +   DN+++++D  ++   QK+  S 
Sbjct: 197 LWDANRSKPISNLTWGADNVTSVKFNQTETDILASTGSDNSIVLYDLRTNSPTQKIRQSM 256

Query: 259 AFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLT 318
             N + ++         A  D N Y YD+R + + L+    H  +V  ++FSP  D ++T
Sbjct: 257 RTNAICWNPMEAFNFVIANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFSPTGDEIVT 316

Query: 319 SS 320
            S
Sbjct: 317 GS 318

>NCAS0D04480 Chr4 complement(851440..854187) [2748 bp, 915 aa] {ON}
           Anc_6.325
          Length = 915

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 98/193 (50%), Gaps = 15/193 (7%)

Query: 175 LAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHE-----FQSS 229
           L ++P  S ++++A++DG + +WDV S    +   TF  HT  V   ++ +     F SS
Sbjct: 349 LTYSPDGS-RVVTAAEDGKIKVWDVVSGFCLA---TFQEHTSSVTQVQFAKRGQVLFSSS 404

Query: 230 LFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRR 289
           L GTV   + +   +  +  A +++     FN LA     E + A +  + +++++ ++ 
Sbjct: 405 LDGTVRAWDLIRYRNFRTFTAAERIQ----FNCLAVDPSGEVVCAGSLDNFDIHVWSVQT 460

Query: 290 LQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPE 349
            Q  L +++GHE  V+ L FS  ++ +L S+  D+ + +W +F    + +P D Y  V  
Sbjct: 461 GQ-LLDTLSGHEGPVSCLAFS-QENSVLASASWDKTVRVWSIFGRSQQVEPFDVYSDVLA 518

Query: 350 LFMMHGGHRSPVN 362
           L +   G +  V+
Sbjct: 519 LTIRPDGKQVAVS 531

 Score = 30.8 bits (68), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 43/199 (21%), Positives = 87/199 (43%), Gaps = 26/199 (13%)

Query: 155 KEKDHGAIASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVT--STANKSPSQTFD 212
           +EKD  ++ +F+ H++   G AF      ++ + S DG + +W+ T  ST ++      +
Sbjct: 178 EEKDLASM-TFAGHRDYVMG-AFFSADQEKIYTVSKDGALFVWEFTKKSTDDEDDDDEEE 235

Query: 213 VHTDIVNDCKWHEFQSSLFGTV----------SEDNTLIIHDTNSD---------RAIQK 253
                ++   W   Q   F             +  N L++  TN +           +Q+
Sbjct: 236 EEDIDISKYSWRITQKHFFYANQCKVKCVTFHAPSNMLVVGFTNGEFRLYELPHFTLLQQ 295

Query: 254 LSVS-SAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPH 312
           LS+  +  NT+A +   E L   +     + +Y+ +  +  +    GH D+  SL +SP 
Sbjct: 296 LSMGQNPINTVAVNSSGEWLAFGSSKLGQLLVYEWQS-ESYILKQQGHFDATNSLTYSPD 354

Query: 313 QDGLLTSSGSDRRIIMWDL 331
              ++T++  D +I +WD+
Sbjct: 355 GSRVVTAA-EDGKIKVWDV 372

>TBLA0I02280 Chr9 complement(523331..526114) [2784 bp, 927 aa] {ON}
           Anc_6.325 YCR057C
          Length = 927

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 52/194 (26%), Positives = 98/194 (50%), Gaps = 15/194 (7%)

Query: 174 GLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHE-----FQS 228
           GL ++P  S ++++AS+DG + +WDV S    +   TF+ HT  V+  ++ +     F +
Sbjct: 346 GLTYSPDGS-RVVTASEDGKIKIWDVVSGFCLA---TFEEHTSAVSAVQFSKRGQVLFSA 401

Query: 229 SLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLR 288
           SL GTV   + +   +  +  A +++     FN+LA     E + A +  +  + ++ ++
Sbjct: 402 SLDGTVRAWDLIRYRNFRTFTAAERIQ----FNSLAVDPSGEVVCAGSIDNYEIQVWSVQ 457

Query: 289 RLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVP 348
             Q  L  +AGHE  V+ L FS  ++ +L S+  D+ I +W +F    + +P D    V 
Sbjct: 458 TGQ-LLDCLAGHEGPVSCLAFS-QENNVLASASWDKTIRVWSIFGRSQQVEPIDVSADVL 515

Query: 349 ELFMMHGGHRSPVN 362
            L +   G +  V+
Sbjct: 516 ALSIRPDGRQVAVS 529

 Score = 30.8 bits (68), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

Query: 185 LLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLII 242
           LL+ S D T  +W V S   +  S TF  H D V    + + Q  ++ TVS+D  L +
Sbjct: 161 LLTTSKDLTSRIWSVASEDKELASTTFAGHRDYVLGAFFSQDQEKIY-TVSKDGALFV 217

>Kpol_1036.65 s1036 complement(180839..181954) [1116 bp, 371 aa]
           {ON} complement(180839..181954) [1116 nt, 372 aa]
          Length = 371

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 60/231 (25%), Positives = 102/231 (44%), Gaps = 36/231 (15%)

Query: 141 LNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVT 200
           L G G ++I D + + + H ++ SF   ++  Y +A+N     Q+L A  DG++ L+D  
Sbjct: 35  LVGNGNLFILDIDPQGRIH-SMNSF-MTQDCLYDVAWNELHENQVLVAQGDGSLRLFD-- 90

Query: 201 STANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAF 260
           ++  K P   F  H+  V  C W+      F + S D T+ I   N   +++ L V    
Sbjct: 91  TSLQKFPIAIFKEHSKEVLSCNWNLINKQTFVSSSWDGTVKIWTPNRKESLRTLQVQPVM 150

Query: 261 ------NTLA--------------------FSKRSENLLAAAGTDSNVYLYDLRR---LQ 291
                 NT+A                    FS   ENL+     +S V L+DLR+     
Sbjct: 151 QSQLVDNTIAKTNGSRGTISANKNCIYQAQFSPHDENLVMCCSGNSYVTLFDLRQPNSNN 210

Query: 292 KPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWD---LFNIGAEQQ 339
           K    +A +     + +F+ ++  ++ +SG D  I +WD   L N+G + Q
Sbjct: 211 KQQRFLAHNGSETLTCDFNKYRPTVVATSGVDSSIRIWDIRMLVNLGPQSQ 261

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 56/278 (20%), Positives = 105/278 (37%), Gaps = 54/278 (19%)

Query: 110 QSKIKIVRKFKHEQEVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHK 169
           Q +I  +  F  +  +    +     N +    G G + +FD ++++     IA F  H 
Sbjct: 49  QGRIHSMNSFMTQDCLYDVAWNELHENQVLVAQGDGSLRLFDTSLQKF---PIAIFKEHS 105

Query: 170 ENGYGLAFNPTVSGQLLSASDDGTVALW----------------------DVTSTANKSP 207
           +      +N       +S+S DGTV +W                      D T       
Sbjct: 106 KEVLSCNWNLINKQTFVSSSWDGTVKIWTPNRKESLRTLQVQPVMQSQLVDNTIAKTNGS 165

Query: 208 SQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDT---NSDRAIQKLSVSSAFNTLA 264
             T   + + +   ++     +L    S ++ + + D    NS+   Q+    +   TL 
Sbjct: 166 RGTISANKNCIYQAQFSPHDENLVMCCSGNSYVTLFDLRQPNSNNKQQRFLAHNGSETLT 225

Query: 265 --FSKRSENLLAAAGTDSNVYLYDLRRL------QKPLHSMAG--------HEDSVTSLE 308
             F+K    ++A +G DS++ ++D+R L       + ++S A         HE +V  + 
Sbjct: 226 CDFNKYRPTVVATSGVDSSIRIWDIRMLVNLGPQSQHINSSAACINEITRAHELAVRKVA 285

Query: 309 FSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDG 346
           +SPH   +L S+  D    +W           D +YDG
Sbjct: 286 WSPHHPNVLLSASYDMTCSVWQ----------DLSYDG 313

>NDAI0I00460 Chr9 (91809..94562) [2754 bp, 917 aa] {ON} Anc_6.325
          Length = 917

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/200 (25%), Positives = 100/200 (50%), Gaps = 15/200 (7%)

Query: 168 HKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHE-- 225
           H ++   L ++P  S ++++A+DDG + +WDV S    +   TF  HT  V   ++ +  
Sbjct: 340 HFDSTNSLTYSPDGS-RVVTAADDGKIKVWDVVSGFCLA---TFTEHTSSVTQVQFAKKG 395

Query: 226 ---FQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNV 282
              F SSL GTV   + +   +  +  A +++     FN LA     E + A +    ++
Sbjct: 396 QVLFSSSLDGTVRAWDLIRYRNFRTFTAAERIQ----FNCLAVDPSGEVVCAGSIDSFDI 451

Query: 283 YLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDD 342
           +++ ++  Q  L +++GHE  V+ L FS  ++ +L S+  D+ + +W +F    + +P +
Sbjct: 452 HVWSVQTGQ-LLDTLSGHEGPVSCLSFS-QENSVLASASWDKTVRIWSIFGRSQQVEPFE 509

Query: 343 AYDGVPELFMMHGGHRSPVN 362
            Y  V  L +   G +  V+
Sbjct: 510 VYSDVLALSVRPDGKQIAVS 529

>AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL011W
           (SOF1)
          Length = 479

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 67/138 (48%), Gaps = 4/138 (2%)

Query: 194 VALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQK 253
           + LWDV     K P        D V+  ++++ +  +  +   DN+++++D  ++   QK
Sbjct: 198 IQLWDVN---RKKPLSNLSWGVDNVSFVRFNQNEEDILASTGSDNSIVLYDLRTNSPTQK 254

Query: 254 LSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQ 313
           +      N L ++       A A  D N Y YD+R + + LH    H  +V  ++FSP  
Sbjct: 255 VVQRMRTNALCWNPMEPFNFAIANEDHNAYYYDMRNMSRALHVFKDHVSAVMDVDFSPTG 314

Query: 314 DGLLTSSGSDRRIIMWDL 331
           + ++T S  D+ I +++L
Sbjct: 315 EEIVTGS-YDKTIRIFNL 331

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 87/189 (46%), Gaps = 33/189 (17%)

Query: 168 HKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVN-------- 219
           H++  Y LA N  V  +L S S DG V  W++   A +    +F  H  +V         
Sbjct: 66  HRDGCYVLAKNYNVLNKLASGSADGVVKYWNM---ATREELCSFRAHYGLVTGLCVTPTH 122

Query: 220 -----------DC------KWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNT 262
                       C      K     S  F ++ +D+T I+ DT     ++      AF +
Sbjct: 123 LSPTKKDSFMLSCGDDKTIKLWSVNSDDFNSI-KDDTKIVSDTGDGALLKTFYGEHAFQS 181

Query: 263 LAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGS 322
           +   +R+ N +      + + L+D+ R +KPL +++   D+V+ + F+ +++ +L S+GS
Sbjct: 182 IDHHRRNPNFVTGG---AQIQLWDVNR-KKPLSNLSWGVDNVSFVRFNQNEEDILASTGS 237

Query: 323 DRRIIMWDL 331
           D  I+++DL
Sbjct: 238 DNSIVLYDL 246

>KLLA0E19515g Chr5 complement(1733708..1735426) [1719 bp, 572 aa]
           {ON} similar to uniprot|P21304 Saccharomyces cerevisiae
           YLR196W PWP1
          Length = 572

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 83/172 (48%), Gaps = 11/172 (6%)

Query: 166 SYHKENGYGLAFNPTVSGQLLSASDDGTVALWDV-TSTANKSPSQTFDVHTDI-VNDCKW 223
           ++H +    LA N      L S S D TV LWD+ T+TA +S     ++H++  V+  +W
Sbjct: 285 THHTDAILSLAHNKQFRAVLASTSADHTVKLWDLNTATAARS---LINIHSNTNVSASQW 341

Query: 224 HEFQSSLFGTVSEDNTLIIHDT---NSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDS 280
           H    S+  T   D+   + D    N +   +  +VSS           EN+      + 
Sbjct: 342 HPSNGSVLLTAGYDSRAALSDVRIENDNDMSKYWNVSSGEEIECVRFADENIFICGTDNG 401

Query: 281 NVYLYDLRR--LQKPLHSMAGHEDSVTSLEFSPH-QDGLLTSSGSDRRIIMW 329
           NVY +D+R     KP+ ++  H+  V+S+E + H  + LLTS+  ++ + +W
Sbjct: 402 NVYSFDIRNGAESKPVWTLKAHDAGVSSVEINRHIPNMLLTSAMGEKPVKLW 453

>Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON}
           (56367..60125) [3759 nt, 1253 aa]
          Length = 1252

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 52/215 (24%), Positives = 103/215 (47%), Gaps = 21/215 (9%)

Query: 136 NIIATLNGAGI-VYIFDRNIKE-KDHGAIASFSYHKENGYGLAFNPTVSGQLLSASD-DG 192
           NI   L+   I ++ FD   +  K  G ++  + HK +   L FN   S  L+S SD +G
Sbjct: 76  NIAGALDNGNIELFNFDNKSQTIKSLGNLSDSNKHKGSVKTLKFNTKQSNLLVSGSDKNG 135

Query: 193 TVALWDVTSTANKSP--SQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRA 250
            + +WD+ +  +K+P         T+ +    W++  S +F   S  + + I D  + + 
Sbjct: 136 EILIWDLNNL-DKTPLTPGMPMTPTNEITSLAWNKSLSHVFSCSSNTSNVSIFDLKAKKE 194

Query: 251 IQKLS-------VSSAFNTLAFSKRSENLLAAAGTDSN------VYLYDLRRLQKPLHSM 297
           +  L+       V S F+ + +  ++   +A A  +++      ++++DLR    PL  +
Sbjct: 195 VIHLNYTNPVNNVKSLFSVVEWHPKNSTRIATATLNNDSTESDSIFIWDLRNSHTPLQIL 254

Query: 298 A--GHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWD 330
           +  GH + + SL++    + LL SSG D  +++W+
Sbjct: 255 SKDGHSNGILSLDWCSTDENLLLSSGRDNSVMLWN 289

>KAFR0J02550 Chr10 complement(484360..487080) [2721 bp, 906 aa] {ON}
           Anc_6.325 YCR057C
          Length = 906

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 100/200 (50%), Gaps = 15/200 (7%)

Query: 168 HKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHE-- 225
           H ++   L ++P  S ++++A++DG + +WDV S    +   TF+ HT  V   ++ +  
Sbjct: 339 HFDSTNSLTYSPDGS-RVVTAAEDGKIKVWDVVSGFCLA---TFEEHTSSVTQVQFAKKG 394

Query: 226 ---FQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNV 282
              F +SL GTV   + +   +     A +++     FN+LA     E + A +    ++
Sbjct: 395 QVLFSASLDGTVRAWDLIRYRNFRVFTAAERIQ----FNSLAVDPSGEVVCAGSVDSFDI 450

Query: 283 YLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDD 342
           +++ ++  Q  L ++AGHE  ++ L FS  ++ +L S+  D+ I +W +F    + +P +
Sbjct: 451 HVWSVQTGQ-LLDTLAGHEGPISCLAFS-QENSILASASWDKTIRIWSIFGRSQQVEPIE 508

Query: 343 AYDGVPELFMMHGGHRSPVN 362
            Y  V  L +   G    V+
Sbjct: 509 VYSDVVALTIRPDGKHVAVS 528

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 54/233 (23%), Positives = 99/233 (42%), Gaps = 30/233 (12%)

Query: 121 HEQEVTRARYMPQSPNIIATLNG--AGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFN 178
           H Q++T   +   S  II+T     A I  +F    +EKD  A  +F+ H++   G AF 
Sbjct: 145 HFQDITSLTWSQDSRFIISTSKDLTAKIWSVFS---EEKDLAA-TTFAGHRDYVMG-AFF 199

Query: 179 PTVSGQLLSASDDGTVALWDVTSTANK-------------------SPSQTFDVHTDIVN 219
                ++ + S DG V +W+ T+   +                   S    F  +   V 
Sbjct: 200 SKDQEKIYTVSKDGAVFIWEFTAKETEEEEEDSDEEIDISKYSWRISQKHFFYANQAKVK 259

Query: 220 DCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVS-SAFNTLAFSKRSENLLAAAGT 278
              +H   SSL           +++  S   IQ+LS+  +  N+++ ++  E L   +  
Sbjct: 260 CVTFHP-ASSLLVVGFTTGEFRLYELPSFTLIQQLSMGQNPINSVSINESGEWLAFGSSK 318

Query: 279 DSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
              + +Y+ +  +  +    GH DS  SL +SP    ++T++  D +I +WD+
Sbjct: 319 LGQLLVYEWQS-ESYILKQQGHFDSTNSLTYSPDGSRVVTAA-EDGKIKVWDV 369

>KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.340
           YCR072C
          Length = 519

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 63/246 (25%), Positives = 102/246 (41%), Gaps = 65/246 (26%)

Query: 184 QLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIH 243
           +L SAS DGT+ +WD   TA +    T   H++ V   KW      L  + S D T+ + 
Sbjct: 252 RLASASKDGTIKIWD---TARRVCLYTLSGHSNSVACVKWG--GEGLLYSGSHDKTVRVW 306

Query: 244 DTNSDRA-------------IQKLSVSSAF--------------NTLAFSKR-------- 268
           D NS                +  LS+S+ +              +T A +KR        
Sbjct: 307 DMNSATVGKCISILKNHAHWVNHLSLSTDYALRIGPFDHTGVKPSTPAEAKRRAQANYDK 366

Query: 269 -------SENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDG-LLTSS 320
                  +E L+  A  D  ++L++ ++L KPL  M GH+  V  + FSP  DG  + S+
Sbjct: 367 VAKRNGSAEELMVTASDDFTMFLWNPKKLTKPLARMTGHQKLVNHVAFSP--DGRYIVSA 424

Query: 321 GSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEE 380
             D  I +W            D  DG  +      GH + V + + +S+   L+ S  ++
Sbjct: 425 SFDNSIKLW------------DGRDG--KFLSTFRGHVASVYQVAWSSDCR-LLVSCSKD 469

Query: 381 NVLQIW 386
             L++W
Sbjct: 470 TTLKVW 475

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 83/170 (48%), Gaps = 21/170 (12%)

Query: 176 AFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVS 235
           AF P  S ++++ + D T  +WD  +   ++P  T + H++ V    W      +  T S
Sbjct: 146 AFAPDTSSRMVTGAGDNTARIWDCDT---QTPLATLEGHSNWVLCVSWSP-DGEVIATGS 201

Query: 236 EDNTLIIHDTNSDRAIQKLSVSSA--------FNTLAFS------KRSENLLAAAGTDSN 281
            D+T+ + ++   + +   + SS+          +L++         ++  LA+A  D  
Sbjct: 202 MDSTIRLWESTKGKPVGGGNGSSSALKGHMKWITSLSWEPLHLVPDGAKPRLASASKDGT 261

Query: 282 VYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
           + ++D  R +  L++++GH +SV  +++    +GLL S   D+ + +WD+
Sbjct: 262 IKIWDTAR-RVCLYTLSGHSNSVACVKWG--GEGLLYSGSHDKTVRVWDM 308

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 70/148 (47%), Gaps = 11/148 (7%)

Query: 185 LLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHD 244
           +++ASDD T+ LW+        P      H  +VN   +         + S DN++ + D
Sbjct: 378 MVTASDDFTMFLWNPKKLTK--PLARMTGHQKLVNHVAFSP-DGRYIVSASFDNSIKLWD 434

Query: 245 TNSDRAIQKLS--VSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHED 302
               + +      V+S +  +A+S     LL +   D+ + ++D+ R +K    + GH+D
Sbjct: 435 GRDGKFLSTFRGHVASVYQ-VAWSSDCR-LLVSCSKDTTLKVWDV-RTRKLSVDLPGHQD 491

Query: 303 SVTSLEFSPHQDG-LLTSSGSDRRIIMW 329
            V ++++S   DG  + S G D+ + +W
Sbjct: 492 EVFTVDWS--VDGKRVCSGGKDKMVRIW 517

>TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {ON}
           Anc_5.201 YLL011W
          Length = 481

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 60/128 (46%), Gaps = 3/128 (2%)

Query: 193 TVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQ 252
           T+ LWD   TA   P        D +   K+++ ++ +  +   DN+++++D  ++   Q
Sbjct: 194 TIQLWD---TARSKPLSNLSWGADNITSVKFNQTETDILASTGSDNSIVLYDVRTNSPTQ 250

Query: 253 KLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPH 312
           K+      N + ++         A  D N Y YD+R + + L+    H  +V  ++F+P 
Sbjct: 251 KIVQRLRTNAICWNPMEAFNFVTANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFAPT 310

Query: 313 QDGLLTSS 320
            D ++T S
Sbjct: 311 GDEIVTGS 318

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 50/206 (24%), Positives = 83/206 (40%), Gaps = 53/206 (25%)

Query: 136 NIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQ----------L 185
           N +A+ +G G++  +  N+  +D   I SF  H    YGL     VS Q          +
Sbjct: 81  NKVASGSGDGVIKYW--NMSSRDE--ICSFKAH----YGLITGLCVSPQRSPLNRDQHFM 132

Query: 186 LSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDT 245
           LS  DD TV LW +                               F  V +D  L     
Sbjct: 133 LSCGDDKTVKLWSMNGDD---------------------------FANVKDDQNL----N 161

Query: 246 NSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVT 305
           + D  ++      AF  +   K     +    T   + L+D  R  KPL +++   D++T
Sbjct: 162 SQDGLLKTFYGEHAFQGIDHHKVKTTFVTGGPT---IQLWDTAR-SKPLSNLSWGADNIT 217

Query: 306 SLEFSPHQDGLLTSSGSDRRIIMWDL 331
           S++F+  +  +L S+GSD  I+++D+
Sbjct: 218 SVKFNQTETDILASTGSDNSIVLYDV 243

>Kpol_1028.54 s1028 (125940..128657) [2718 bp, 905 aa] {ON}
           (125940..128657) [2718 nt, 906 aa]
          Length = 905

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 94/188 (50%), Gaps = 15/188 (7%)

Query: 168 HKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHE-- 225
           H ++  GL ++P    ++++A++DG + +WDV S    +   TF  HT  V   ++ +  
Sbjct: 337 HFDSLNGLTYSPD-GARVVTAANDGKIKVWDVVSGFCLA---TFSEHTSSVTAVQFAKRG 392

Query: 226 ---FQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNV 282
              F SSL GTV   + +   +  +  + Q++     FN LA     E + A +     +
Sbjct: 393 QVLFSSSLDGTVRAWDLIRFRNFRTFTSTQRI----PFNCLAVDPSGEVVCAGSSDSFEI 448

Query: 283 YLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDD 342
           +++ ++  Q  L S+ GHE  V+ L FS  ++ +L S+  D+ I +W +F+   + +P +
Sbjct: 449 HVWSVQTGQ-LLDSLDGHEGPVSCLAFS-QENSVLASASWDKTIRIWSIFSRSQQVEPIE 506

Query: 343 AYDGVPEL 350
            +  V  L
Sbjct: 507 VFSDVLAL 514

 Score = 34.3 bits (77), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 39/188 (20%), Positives = 80/188 (42%), Gaps = 20/188 (10%)

Query: 161 AIASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTAN---------------- 204
           A  +F+ H++N  G AF      ++ + S DG + +W+ +S                   
Sbjct: 183 AATTFAGHRDNVLG-AFFTADQEKIYTVSKDGALFIWEYSSLEEDQDDEDEEIDLSKYSW 241

Query: 205 KSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVS-SAFNTL 263
           +   + F         C      S+L      +    ++D  S   +Q+LS+  +A NT+
Sbjct: 242 RIAEKHFFFQNQAKVKCVTFHPGSNLLVVGFSNGEFRLYDLPSFTLVQQLSMGQNAVNTV 301

Query: 264 AFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSD 323
           + +   E L   +     + +Y+ +  +  +    GH DS+  L +SP    ++T++ +D
Sbjct: 302 SINNTGEWLAFGSSALGQLLVYEWQS-ESYILKQQGHFDSLNGLTYSPDGARVVTAA-ND 359

Query: 324 RRIIMWDL 331
            +I +WD+
Sbjct: 360 GKIKVWDV 367

>KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.283
           YNL035C
          Length = 367

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 56/210 (26%), Positives = 95/210 (45%), Gaps = 21/210 (10%)

Query: 164 SFSYHKENGYG-----LAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIV 218
           S+S  +E  +G     L F P  +  LL++  +G V L D  +    +P + F +    +
Sbjct: 2   SYSLVQEQSFGSDNWCLKFQPLYNHGLLTSLSNGEVKLLDWETL---NPVRNFKIDQVSI 58

Query: 219 NDCKW--HEFQ-SSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAA 275
           N  K   +++  +SLF T +  N++ I+D  S+  I  ++       L+   R + L   
Sbjct: 59  NSMKLINNDYNNASLFATATL-NSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACG 117

Query: 276 A---GTDSNVYLYDLRRLQKPLHSMA-GHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
               G D+ +Y+YD+R    P+ S    H D +T ++F P     L S  +D    ++DL
Sbjct: 118 TELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177

Query: 332 FNIGAEQQPDDAYDGVPELFMMHG-GHRSP 360
                +Q+ DDA   V     +H  G  SP
Sbjct: 178 ----TQQEEDDALYQVINYASIHSCGWLSP 203

>KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} similar
           to uniprot|P40968 Saccharomyces cerevisiae YDR364C CDC40
           Pre-mRNA splicing factor important for catalytic step II
           of pre-mRNA splicing and plays a role in cell cycle
           progression required for DNA synthesis during mitosis
           and meiosis has WD repeats
          Length = 429

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 88/194 (45%), Gaps = 15/194 (7%)

Query: 162 IASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDC 221
           IA +  HK     L F P     LLS  +D  + LWD      +   +T++ H+  + D 
Sbjct: 128 IAEYYGHKNGTTSLRFIPKTGHLLLSGGNDNIIKLWDFYH--ERELLRTYEGHSMTIKDL 185

Query: 222 KWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSN 281
            + +   S F + S D  + I +T      ++L  +S  N + F  + +N L    ++S 
Sbjct: 186 NFTDNGHS-FASASFDKWVKIWNTEKGIIDKRLRFNSVPNCITFHPKDKNQLVVGLSNSE 244

Query: 282 VYLYDLR------RLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWD-LFNI 334
           +  YDLR       +QK  H    H+ S+ +L++ P    L++SS  D+ + +W+   NI
Sbjct: 245 IRHYDLRLSENHGEVQKYDH----HQGSILALKYFPDGKKLISSS-EDKTVRIWENRINI 299

Query: 335 GAEQQPDDAYDGVP 348
             +Q    A   +P
Sbjct: 300 PIKQISGTAQHSMP 313

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 7/63 (11%)

Query: 299 GHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDG----VPELFMMH 354
           GH++  TSL F P    LL S G+D  I +WD ++   E++    Y+G    + +L    
Sbjct: 133 GHKNGTTSLRFIPKTGHLLLSGGNDNIIKLWDFYH---ERELLRTYEGHSMTIKDLNFTD 189

Query: 355 GGH 357
            GH
Sbjct: 190 NGH 192

>Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}
           similar to Ashbya gossypii AAL157C
          Length = 484

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 89/188 (47%), Gaps = 32/188 (17%)

Query: 168 HKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVN-------- 219
           H++  Y +A N  V  +L SAS DG V  W++++   +    +F  H  +V         
Sbjct: 66  HRDGCYVIAKNYNVLNRLASASADGVVKYWNIST---REELCSFKAHYGLVTGLCVSPQH 122

Query: 220 ----------DC------KWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTL 263
                      C      K     S  F  V +D+T ++H ++ +  I+      AF  +
Sbjct: 123 IGNQSDSYMLSCGDDKMVKMWSVDSGDFNNV-KDDTKVLHPSDGNGLIKTFYGEHAFQGI 181

Query: 264 AFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSD 323
              K + + +      + + L+D+ R +KPL +++   D++T+++F+ ++  LL SSGSD
Sbjct: 182 DHHKENTSFVTGG---AQIELWDINR-RKPLSNLSWGIDNITAVKFNQNEADLLLSSGSD 237

Query: 324 RRIIMWDL 331
             ++++DL
Sbjct: 238 NSVVLYDL 245

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 32/141 (22%), Positives = 67/141 (47%), Gaps = 7/141 (4%)

Query: 194 VALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQK 253
           + LWD+     + P        D +   K+++ ++ L  +   DN+++++D  ++   QK
Sbjct: 197 IELWDIN---RRKPLSNLSWGIDNITAVKFNQNEADLLLSSGSDNSVVLYDLRTNSPTQK 253

Query: 254 LSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQ 313
           +  +   N++ ++         A  D N Y YD+R + + LH    H  ++  ++ SP  
Sbjct: 254 IVQTMKTNSMCWNPMEPFNFVTANEDQNAYYYDMRNMSRALHVFKDHVSAIMDVDISPTG 313

Query: 314 DGLLTSSGSDRRIIMWDLFNI 334
           + ++T S  D+ I    +FNI
Sbjct: 314 EEIVTGS-YDKTI---RIFNI 330

>Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W
           (REAL)
          Length = 490

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 61/133 (45%), Gaps = 3/133 (2%)

Query: 188 ASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNS 247
           A+    + LWDV       P        D +   K+++ ++ +  +   DN+++++D  +
Sbjct: 195 ATGGAKIQLWDVNRV---KPVSNLSWGADNITSVKFNQNETDILASTGSDNSIVLYDLRT 251

Query: 248 DRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSL 307
           +   QK+  +   N + ++         A  D N Y YD+R L + L+    H  +V  +
Sbjct: 252 NSPTQKIVQTMRTNAICWNPMEAFNFVIANEDHNAYYYDMRNLSRSLNVFKDHVSAVMDV 311

Query: 308 EFSPHQDGLLTSS 320
           +FSP  D ++T S
Sbjct: 312 DFSPTGDEIVTGS 324

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 54/210 (25%), Positives = 94/210 (44%), Gaps = 51/210 (24%)

Query: 134 SPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAF--------NPTVSGQ- 184
           S N +AT +  G++  ++ + +E+      SF  H     GL           P +  Q 
Sbjct: 79  SLNKLATGSADGVIKYWNMSTREE----FVSFKAHYGLITGLCVTQPHFHDKKPDLKNQN 134

Query: 185 -LLSASDDGTVALW--DVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLI 241
            +LS SDD TV LW  +V   +NK  S                            DN  +
Sbjct: 135 FMLSCSDDKTVKLWSINVDDYSNKRSS----------------------------DNDSV 166

Query: 242 IHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHE 301
           I   N +  ++     SAF  +  S R  +  A  G  + + L+D+ R+ KP+ +++   
Sbjct: 167 I---NEEGLVRTFDGESAFQGID-SHRVNSTFATGG--AKIQLWDVNRV-KPVSNLSWGA 219

Query: 302 DSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
           D++TS++F+ ++  +L S+GSD  I+++DL
Sbjct: 220 DNITSVKFNQNETDILASTGSDNSIVLYDL 249

>KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1101

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 82/155 (52%), Gaps = 4/155 (2%)

Query: 178 NPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSED 237
           +P+    ++S S+   + +W+++ +++ +       H+  + D  +H     +  T S D
Sbjct: 78  HPSKPSWVVSTSNQKAL-VWNLSRSSSNAVEHVLHGHSRAITDINFHPTNPEILATCSID 136

Query: 238 NTLIIHDTNSDR-AIQKLSVSSAFNT-LAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLH 295
             +   D  S R A    SV SA    + ++ ++ N++A+A ++ +++++DLR+   PLH
Sbjct: 137 AYVHAWDMRSSRRAFYSASVWSAGAAQVKWNFKNPNVMASAHSN-DIFIWDLRKGCMPLH 195

Query: 296 SMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWD 330
            + GH +SV S++FS   +  + SS +D  +  WD
Sbjct: 196 ILKGHANSVNSIDFSRFNETEIMSSSNDGTVKFWD 230

>Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W
           (REAL)
          Length = 489

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 61/133 (45%), Gaps = 3/133 (2%)

Query: 188 ASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNS 247
           A+    + LWDV       P        D +   K+++ ++ +  +   DN+++++D  +
Sbjct: 195 ATGGAKIHLWDVNRL---KPVSNLSWGADNITSVKFNQSETDILASTGSDNSIVLYDLRT 251

Query: 248 DRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSL 307
           +   QK+  +   N + ++         A  D N Y YD+R L + L+    H  +V  +
Sbjct: 252 NSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNVFKDHVSAVMDV 311

Query: 308 EFSPHQDGLLTSS 320
           +FSP  D ++T S
Sbjct: 312 DFSPTGDEIVTGS 324

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/191 (23%), Positives = 91/191 (47%), Gaps = 34/191 (17%)

Query: 168 HKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVND-C----K 222
           H++  Y +A N     +L + S DG +  W++++   +    +F  H  ++   C    +
Sbjct: 66  HRDGVYAIAKNYGSLNKLATGSADGVIKYWNMST---REEFVSFKAHYGLITGLCVTQPR 122

Query: 223 WHEFQSSLFG-----TVSEDNTLIIHD-----------------TNSDRAIQKLSVSSAF 260
           +H+ +  L       + S+D T+ +                   TN +  ++     SAF
Sbjct: 123 FHDKKPDLKNQNFMLSCSDDKTVKLWSINVDDFSNKSSSDNDSVTNEEGLVRTFDGESAF 182

Query: 261 NTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSS 320
             +  S R  +  A  G  + ++L+D+ RL KP+ +++   D++TS++F+  +  +L S+
Sbjct: 183 QGID-SHRENSTFATGG--AKIHLWDVNRL-KPVSNLSWGADNITSVKFNQSETDILAST 238

Query: 321 GSDRRIIMWDL 331
           GSD  I+++DL
Sbjct: 239 GSDNSIVLYDL 249

>TPHA0D03830 Chr4 complement(802754..805492) [2739 bp, 912 aa] {ON}
           Anc_6.325 YCR057C
          Length = 912

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 91/178 (51%), Gaps = 9/178 (5%)

Query: 175 LAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTV 234
           L ++P  S +++++S+DG + +WDV S    +   TF+ HT  V   ++ +    LF + 
Sbjct: 342 LTYSPDGS-RVVTSSEDGKIKIWDVVSGFCLA---TFEEHTSSVTAVQFAKRGQVLF-SA 396

Query: 235 SEDNTLIIHDTNSDRAIQKLSVSS--AFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQK 292
           S D T+   D    R  +  + +    FN LA     E + A +  +  ++++ ++  Q 
Sbjct: 397 SLDGTVRAWDLIRYRNFRTFTSTDRIQFNCLAVDPSGEVVCAGSLDNFEIHVWSVQTGQ- 455

Query: 293 PLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPEL 350
            L ++AGHE  V+ L FS  ++G+L S+  D+ I +W +F    + +P + Y  +  L
Sbjct: 456 LLDTLAGHEGPVSCLAFS-QENGVLASASWDKTIRIWSIFARSQQVEPLEVYSDIVAL 512

>Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON}
           (237070..238533) [1464 nt, 488 aa]
          Length = 487

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 67/138 (48%), Gaps = 4/138 (2%)

Query: 194 VALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQK 253
           + LWD   ++   P        D V + K+++ ++ +  +   DN+++++D  ++   QK
Sbjct: 195 IQLWD---SSRSKPISNLTWGADNVTNVKFNQTETDILASTGSDNSIVLYDLRTNSPTQK 251

Query: 254 LSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQ 313
           +  S   N + ++         A  D N Y YD+R + + L+    H  +V  ++FSP  
Sbjct: 252 IVQSMRSNAICWNPMEAFNFVIANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFSPTG 311

Query: 314 DGLLTSSGSDRRIIMWDL 331
             L+T S  D+ I ++D+
Sbjct: 312 TELVTGS-YDKTIRIYDI 328

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 82/192 (42%), Gaps = 29/192 (15%)

Query: 162 IASFSYHKENG-YGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVND 220
           I    Y   +G Y +A N     +L +AS DG V  W++++   +    +F  H  +V  
Sbjct: 59  IGQLGYGYRDGVYCIAKNYNSLNKLAAASADGVVKYWNMST---REELCSFKAHYGLVTG 115

Query: 221 -CKWHEFQSS-----LFGTVSEDNTLIIHDTNS---------------DRAIQKLSVSSA 259
            C   E  SS        +  +D T+ +   NS               D  I+      A
Sbjct: 116 LCVSPEKYSSDKNEHFMISCGDDKTIKLWSVNSEDFANVKDDESVNTKDGLIKTFYGEHA 175

Query: 260 FNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTS 319
           F  L   + +   +      + + L+D  R  KP+ ++    D+VT+++F+  +  +L S
Sbjct: 176 FQGLDHHRNNSTFVTGG---AQIQLWDSSR-SKPISNLTWGADNVTNVKFNQTETDILAS 231

Query: 320 SGSDRRIIMWDL 331
           +GSD  I+++DL
Sbjct: 232 TGSDNSIVLYDL 243

>TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7.310
           YDL195W
          Length = 1264

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 50/214 (23%), Positives = 89/214 (41%), Gaps = 25/214 (11%)

Query: 137 IIATLNGAGIVYIFDR---NIKEKDHGAIASFSYHKENGYGLAFNPTVSGQLLSASDDGT 193
           IIA    +G+V +F     ++K +     A F  H+     + FN   +  L S    G 
Sbjct: 76  IIAGALDSGVVELFSSTGDSLKSE-----ARFQQHQGAAKTVKFNSKQNNVLASGGSKGE 130

Query: 194 VALWDVTSTANKSPSQT------FDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNS 247
           + +WD+ +    S   T           + V    W++  + +F +    +   I D  +
Sbjct: 131 IYIWDLNTCLKNSEGYTPLTPGVASTPIEEVTSLAWNQSLAHVFASAGSTSYASIWDLKA 190

Query: 248 DRAIQKLSVSSAFNTLA--------FSKRSENLLAAAGTDSN--VYLYDLRRLQKPLHSM 297
            + +  LS +S    L           K S  +  A G+D+   + ++DLR    PL  +
Sbjct: 191 KKEVIHLSYASPSTGLKSQLSVVEWHPKNSTRVATATGSDTEPLILVWDLRNANTPLQVL 250

Query: 298 A-GHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWD 330
           + GH   + SL++    + LL SSG D  I++W+
Sbjct: 251 SKGHSKGILSLDWCSQDEELLLSSGRDNTIVLWN 284

 Score = 38.5 bits (88), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 43/191 (22%), Positives = 77/191 (40%), Gaps = 17/191 (8%)

Query: 154 IKEKDHGAIASFSYHKENGYGLAFNPTVSGQL-LSASDDGTVALWDVTSTANKSPSQTFD 212
           +K  ++   A+F++  E    L    T SG +  + S +  + LW + ++    P  +  
Sbjct: 2   VKLAEYSRTATFAWSHERIPSLVTG-TASGTVDANFSSESALELWSLLASDPSKPKASLA 60

Query: 213 VHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTN----SDRAIQKLSVSSAFNTLAFSKR 268
           V     ND  W      + G +      +   T     S+   Q+     A  T+ F+ +
Sbjct: 61  VDAKF-NDLDWSNDDKIIAGALDSGVVELFSSTGDSLKSEARFQQHQ--GAAKTVKFNSK 117

Query: 269 SENLLAAAGTDSNVYLYDLRRLQK------PLHSMAGHE--DSVTSLEFSPHQDGLLTSS 320
             N+LA+ G+   +Y++DL    K      PL         + VTSL ++     +  S+
Sbjct: 118 QNNVLASGGSKGEIYIWDLNTCLKNSEGYTPLTPGVASTPIEEVTSLAWNQSLAHVFASA 177

Query: 321 GSDRRIIMWDL 331
           GS     +WDL
Sbjct: 178 GSTSYASIWDL 188

>NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340
          Length = 515

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 82/164 (50%), Gaps = 15/164 (9%)

Query: 176 AFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVS 235
           AF P  S ++++ + D T  +WD  +   ++P  T   H + V  C  +     +  T S
Sbjct: 150 AFAPNTSSRMVTGAGDNTARIWDCDT---QTPKATLTGHFNWVL-CVSYCPNGEVIATGS 205

Query: 236 EDNTLIIHDTNSDRAIQ-------KLSVSSAFNTLAFSKRSEN-LLAAAGTDSNVYLYDL 287
            DNT+ + D+   + +        K   S A+  +   K  E+  LA+A  D  + ++D+
Sbjct: 206 MDNTIRLWDSKDGKPLGDALRGHLKWITSLAWEPIHLVKPGESPRLASASKDGTIRIWDI 265

Query: 288 RRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
            R +  L++M+GH +SV+ +++S    G++ S   D+ + +WD+
Sbjct: 266 TR-RVCLYTMSGHTNSVSCIKWSGQ--GIIYSGSHDKTVRVWDM 306

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 60/249 (24%), Positives = 101/249 (40%), Gaps = 63/249 (25%)

Query: 179 PTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDN 238
           P  S +L SAS DGT+ +WD+T    +    T   HT+ V+  KW      +  + S D 
Sbjct: 245 PGESPRLASASKDGTIRIWDIT---RRVCLYTMSGHTNSVSCIKWS--GQGIIYSGSHDK 299

Query: 239 TLIIHDTNSDRA-----------IQKLSVSS--AFNTLAF-------------------- 265
           T+ + D N+D             +  LS+S+  A    AF                    
Sbjct: 300 TVRVWDMNADGKCINILKSHAHWVNHLSLSTDYALRVGAFDHTGAQPASAKDARDKALAN 359

Query: 266 -------SKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDG-LL 317
                  + + E L+  A  D  ++L++  +  KP+  M GH+  V  + FSP  DG  +
Sbjct: 360 YEKVVKKNGKLEELMVTASDDFTMFLWNPLKSNKPIARMTGHQKLVNHVAFSP--DGRYI 417

Query: 318 TSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPWLMCSV 377
            S+  D  I +W            D  DG  +      GH + V + + +++   L+ S 
Sbjct: 418 VSASFDNSIKLW------------DGRDG--KFISTFRGHVASVYQVAWSADCR-LLVSC 462

Query: 378 EEENVLQIW 386
            ++  L++W
Sbjct: 463 SKDTTLKVW 471

 Score = 30.8 bits (68), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 80/178 (44%), Gaps = 31/178 (17%)

Query: 79  LKIAAIDLPENVTSSKPSVSDDAKENELSHRQSKIKIVRKFKHEQEVTRARYMPQSPNII 138
           L++ A D     T ++P+ + DA++  L++ +   K+V+K    +E            ++
Sbjct: 334 LRVGAFDH----TGAQPASAKDARDKALANYE---KVVKKNGKLEE------------LM 374

Query: 139 ATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWD 198
            T +    +++++     K +  IA  + H++    +AF+P     ++SAS D ++ LWD
Sbjct: 375 VTASDDFTMFLWN---PLKSNKPIARMTGHQKLVNHVAFSPD-GRYIVSASFDNSIKLWD 430

Query: 199 VTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSV 256
                  S   TF  H   V    W      L  + S+D TL + D  +    +KLSV
Sbjct: 431 GRDGKFIS---TFRGHVASVYQVAWSA-DCRLLVSCSKDTTLKVWDVRT----RKLSV 480

>TBLA0C05010 Chr3 complement(1217846..1219564) [1719 bp, 572 aa]
           {ON} Anc_7.356 YLR196W
          Length = 572

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 84/173 (48%), Gaps = 14/173 (8%)

Query: 166 SYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTS-TANKSPSQTFDVHTDIVNDCKWH 224
           ++H +    LA N      L S S D TV LWD+ S TA +S +Q    H   V+  +WH
Sbjct: 290 THHTDAVLSLAHNQLFRAILASTSADSTVKLWDLNSGTAARSLNQVH--HGSRVSSSQWH 347

Query: 225 EFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRS-----ENLLAAAGTD 279
           +   S+  T   D+ + + D    R   + ++S  +N ++  +        +    AGTD
Sbjct: 348 QTDGSILLTAGYDSKIALTDV---RISDEKNMSKYWNVMSGEEIETASFINDYTVLAGTD 404

Query: 280 S-NVYLYDLRRLQ-KPLHSMAGHEDSVTSLEFSPHQDG-LLTSSGSDRRIIMW 329
           + NVY +D+R ++ KPL ++  H+  +  L    +  G LLT +  ++ I +W
Sbjct: 405 NGNVYSFDVRSVESKPLWTLKAHDAGIAGLSVPKNIPGMLLTGAMGEKVIKLW 457

>SAKL0F10384g Chr6 complement(799553..803338) [3786 bp, 1261 aa]
           {ON} similar to uniprot|P38968 Saccharomyces cerevisiae
           YDL195W SEC31 involved in protein transport from
           endoplasmic reticulum to Golgi Component (p150) of COPII
           coat of secretory pathway vesicles
          Length = 1261

 Score = 57.0 bits (136), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 53/211 (25%), Positives = 88/211 (41%), Gaps = 21/211 (9%)

Query: 136 NIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQLLSASDDGTVA 195
           +I+A     GIV  F      K+  ++A  S H      L FN      L S    G + 
Sbjct: 75  SILAGALDNGIVEFFS----PKELKSVAKISKHTTPVNTLKFNAKQDNVLCSGDSRGEIF 130

Query: 196 LWDVTSTANK-----SPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRA 250
           +WD+    +      SP        D V    W++  + +F +        I D  + + 
Sbjct: 131 IWDINKITSSGYVPFSPGVAM-TPIDEVYSLAWNQSLAHVFASAGSSGYTSIWDLKAKKE 189

Query: 251 IQKLSVSS----AFNTLAFSK----RSENLLAAAGTDSN--VYLYDLRRLQKPLHSMA-G 299
           +  LS +S    A N L+  +     S  +  A G D++  + ++DLR  + PL +M+ G
Sbjct: 190 VLHLSYTSPSTGAKNHLSVVEWHPSNSTKIATATGNDNDPVILVWDLRNAKAPLQAMSQG 249

Query: 300 HEDSVTSLEFSPHQDGLLTSSGSDRRIIMWD 330
           H   + SL++    + LL SSG D    +W+
Sbjct: 250 HSKGILSLDWCKQDENLLLSSGRDNTCALWN 280

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 59/241 (24%), Positives = 109/241 (45%), Gaps = 24/241 (9%)

Query: 112 KIKIVRKF-KHEQEVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFS---- 166
           ++K V K  KH   V   ++  +  N++ + +  G ++I+D N K    G +  FS    
Sbjct: 93  ELKSVAKISKHTTPVNTLKFNAKQDNVLCSGDSRGEIFIWDIN-KITSSGYVP-FSPGVA 150

Query: 167 -YHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTST------ANKSPSQTFDVHTDIVN 219
               +  Y LA+N +++    SA   G  ++WD+ +       +  SPS     H  +V 
Sbjct: 151 MTPIDEVYSLAWNQSLAHVFASAGSSGYTSIWDLKAKKEVLHLSYTSPSTGAKNHLSVV- 209

Query: 220 DCKWHEFQSSLFGTVS---EDNTLIIHDTNSDRA-IQKLSV--SSAFNTLAFSKRSENLL 273
             +WH   S+   T +    D  +++ D  + +A +Q +S   S    +L + K+ ENLL
Sbjct: 210 --EWHPSNSTKIATATGNDNDPVILVWDLRNAKAPLQAMSQGHSKGILSLDWCKQDENLL 267

Query: 274 AAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFN 333
            ++G D+   L++ +  QK L       +     +F+P    L  S+  D +I +  L N
Sbjct: 268 LSSGRDNTCALWNPQTAQK-LSQFPTRGNWCFKTKFAPEAPDLFASASLDNKIQVQTLQN 326

Query: 334 I 334
           +
Sbjct: 327 L 327

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 41/81 (50%), Gaps = 2/81 (2%)

Query: 254 LSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQ 313
           ++ S+ FN L +S   +N + A   D+ +  +   +  K +  ++ H   V +L+F+  Q
Sbjct: 59  ITASAKFNDLDWSP--DNSILAGALDNGIVEFFSPKELKSVAKISKHTTPVNTLKFNAKQ 116

Query: 314 DGLLTSSGSDRRIIMWDLFNI 334
           D +L S  S   I +WD+  I
Sbjct: 117 DNVLCSGDSRGEIFIWDINKI 137

>NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340
          Length = 515

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 43/168 (25%), Positives = 80/168 (47%), Gaps = 15/168 (8%)

Query: 176 AFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVS 235
           AF P  S ++++ + D T  +WD  +   ++P  T   HT+ V    W      +  T S
Sbjct: 150 AFAPNSSSRMVTGAGDNTARIWDCDT---QTPKATLTGHTNWVLCVSWCP-NGEVIATGS 205

Query: 236 EDNTLIIHDTNSDRAIQ-------KLSVSSAFNTLAFSKRSEN-LLAAAGTDSNVYLYDL 287
            DNT+ + +  S + +        K   S A+  +   K  E   LA+A  D  + ++D 
Sbjct: 206 MDNTIRLWEGKSGKPVGDALRGHLKWITSLAWEPIHLVKAGEQPRLASASKDGTIKIWDT 265

Query: 288 RRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIG 335
            R +  L++++GH +SV+ +++     G+L S   D+ +  WD+ + G
Sbjct: 266 SR-RVCLYTLSGHTNSVSCIKWGGQ--GILYSGSHDKTVRAWDMNSEG 310

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 62/244 (25%), Positives = 99/244 (40%), Gaps = 63/244 (25%)

Query: 184 QLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIH 243
           +L SAS DGT+ +WD   T+ +    T   HT+ V+  KW   Q  L+ + S D T+   
Sbjct: 250 RLASASKDGTIKIWD---TSRRVCLYTLSGHTNSVSCIKWGG-QGILY-SGSHDKTVRAW 304

Query: 244 DTNSD-RAIQKLSVSSAF-NTLAFSK---------------------------------- 267
           D NS+ R I  L   + + N L+ S                                   
Sbjct: 305 DMNSEGRCINVLKSHAHWVNHLSLSTDYALRVGPFDHTGVEPTSPEDARDKALKNYEKVV 364

Query: 268 ----RSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDG-LLTSSGS 322
               R E L+  A  D  ++L++  +  KPL  M GH+  V  + FSP  DG  + S+  
Sbjct: 365 KKNGRVEELMVTASDDFTMFLWNPLKSTKPLGRMTGHQKLVNHVAFSP--DGRYIVSASF 422

Query: 323 DRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENV 382
           D  I +W            D  DG  +      GH + V + + +++   L+ S  ++  
Sbjct: 423 DNSIKLW------------DGRDG--KFISTFRGHVASVYQVAWSADCR-LLVSCSKDTT 467

Query: 383 LQIW 386
           L++W
Sbjct: 468 LKVW 471

 Score = 35.4 bits (80), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 73/155 (47%), Gaps = 11/155 (7%)

Query: 178 NPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSED 237
           N  V   +++ASDD T+ LW+   +    P      H  +VN   +         + S D
Sbjct: 367 NGRVEELMVTASDDFTMFLWNPLKSTK--PLGRMTGHQKLVNHVAFSP-DGRYIVSASFD 423

Query: 238 NTLIIHDTNSDRAIQKLS--VSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLH 295
           N++ + D    + I      V+S +  +A+S     LL +   D+ + ++D+ R +K   
Sbjct: 424 NSIKLWDGRDGKFISTFRGHVASVYQ-VAWSADCR-LLVSCSKDTTLKVWDV-RTRKLSV 480

Query: 296 SMAGHEDSVTSLEFSPHQDG-LLTSSGSDRRIIMW 329
            + GH+D V ++++S   DG  + S G D+ + +W
Sbjct: 481 DLPGHKDEVFTVDWS--VDGKRVCSGGKDKMVRIW 513

>Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa]
           {ON} YDL195W (SEC31) - Component (p150) of COPII coat of
           secretory pathway vesicles [contig 161] FULL
          Length = 1296

 Score = 57.0 bits (136), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 91/210 (43%), Gaps = 22/210 (10%)

Query: 139 ATLNGA---GIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQLLSASDDGTVA 195
           + L GA   G+V  F  +    ++ +IA  + H      + FN      L S    G + 
Sbjct: 75  SVLTGALDNGVVEFFSPS----EYKSIAKLAQHSTPVKTVRFNAKQHNVLCSGGSKGEIY 130

Query: 196 LWDVTS--TANKSP--SQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAI 251
           +WD     T   +P    T     D +    W++ Q  +F +        I D  + + +
Sbjct: 131 IWDANKIETPGYAPFVPGTAMTPMDEIYSLAWNQNQGHVFASAGSSGFASIWDLKAKKEV 190

Query: 252 QKLSVSSAF----NTLAFSK----RSENLLAAAGTDSN--VYLYDLRRLQKPLHSMA-GH 300
             LS +S+     N L+  +     S  +  A+G+DS+  + ++DLR    PL +++ GH
Sbjct: 191 IHLSHTSSITGQKNQLSIVEWHPNNSTRIATASGSDSDPSILVWDLRNANVPLQTLSQGH 250

Query: 301 EDSVTSLEFSPHQDGLLTSSGSDRRIIMWD 330
              V SL++    + LL SSG D   ++W+
Sbjct: 251 TKGVLSLDWCKQDETLLLSSGRDNSCVLWN 280

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 90/187 (48%), Gaps = 13/187 (6%)

Query: 154 IKEKDHGAIASFSYHKENGYGLAFNPTVSGQL-LSASDDGTVALWDVTSTANKSPSQTFD 212
           +K  ++   A+F++  E    LA   T SG +    S D T+ +W + S    +P  +  
Sbjct: 2   VKLAEYPRTATFAWSHERSPLLATG-TASGTIDADFSSDSTLEIWSLLSPHEATPQGSVS 60

Query: 213 VHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSD-RAIQKLSV-SSAFNTLAFSKRSE 270
                 ND  W    S L G +  DN ++   + S+ ++I KL+  S+   T+ F+ +  
Sbjct: 61  ADAKF-NDLDWSYDNSVLTGAL--DNGVVEFFSPSEYKSIAKLAQHSTPVKTVRFNAKQH 117

Query: 271 NLLAAAGTDSNVYLYDLRRLQKPLHS--MAGHE----DSVTSLEFSPHQDGLLTSSGSDR 324
           N+L + G+   +Y++D  +++ P ++  + G      D + SL ++ +Q  +  S+GS  
Sbjct: 118 NVLCSGGSKGEIYIWDANKIETPGYAPFVPGTAMTPMDEIYSLAWNQNQGHVFASAGSSG 177

Query: 325 RIIMWDL 331
              +WDL
Sbjct: 178 FASIWDL 184

>Ecym_8061 Chr8 complement(131761..135447) [3687 bp, 1228 aa] {ON}
           similar to Ashbya gossypii ADR090W
          Length = 1228

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 52/209 (24%), Positives = 85/209 (40%), Gaps = 19/209 (9%)

Query: 137 IIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQLLSASDDGTVAL 196
           I+A     G+V  F    K ++  ++A    H      L FN   S  L+S    G + +
Sbjct: 76  ILAGALDNGVVEFF----KPEELRSVAKVKKHTTAVQTLRFNAKQSNVLVSGGSQGEIYV 131

Query: 197 WDVTSTANK--SPSQTFDVHTDI--VNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQ 252
           WD    A +  SP       T I  V    W++  + +F +        I D  + + + 
Sbjct: 132 WDTNKIATQGYSPFGPGVAMTPIEEVQSLAWNQTLAHVFASAGSSGFASIWDLKAKKEVI 191

Query: 253 KLSVSSAFNTLA--------FSKRSENLLAAAGTDSN--VYLYDLRRLQKPLHSMA-GHE 301
            LS +S  + L             S  +  A G D+   + ++DLR    PL  ++ GH 
Sbjct: 192 HLSYTSPTSGLKNQLSVVEWHPSNSTKVATATGNDNEPVILVWDLRNSNAPLKVLSQGHS 251

Query: 302 DSVTSLEFSPHQDGLLTSSGSDRRIIMWD 330
             + SL++    D L+ SSG D   I+W+
Sbjct: 252 KGILSLDWCQQDDKLMISSGRDNTCILWN 280

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 73/160 (45%), Gaps = 14/160 (8%)

Query: 180 TVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNT 239
           TV     SAS   T+ LW V S   ++P Q   V     ND +W +  S L G +  DN 
Sbjct: 31  TVDADFSSAS---TLELWSVLSRDARTP-QGMIVADAKFNDLEWSKDGSILAGAL--DNG 84

Query: 240 LI-IHDTNSDRAIQKLSV-SSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSM 297
           ++        R++ K+   ++A  TL F+ +  N+L + G+   +Y++D  ++    +S 
Sbjct: 85  VVEFFKPEELRSVAKVKKHTTAVQTLRFNAKQSNVLVSGGSQGEIYVWDTNKIATQGYSP 144

Query: 298 AGHE------DSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
            G        + V SL ++     +  S+GS     +WDL
Sbjct: 145 FGPGVAMTPIEEVQSLAWNQTLAHVFASAGSSGFASIWDL 184

>YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}
           SOF1Essential protein required for biogenesis of 40S
           (small) ribosomal subunit; has similarity to the beta
           subunit of trimeric G-proteins and the splicing factor
           Prp4p
          Length = 489

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 61/133 (45%), Gaps = 3/133 (2%)

Query: 188 ASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNS 247
           A+    + LWDV       P        D +   K+++ ++ +  +   DN+++++D  +
Sbjct: 195 ATGGAKIHLWDVNRL---KPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLRT 251

Query: 248 DRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSL 307
           +   QK+  +   N + ++         A  D N Y YD+R L + L+    H  +V  +
Sbjct: 252 NSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNVFKDHVSAVMDV 311

Query: 308 EFSPHQDGLLTSS 320
           +FSP  D ++T S
Sbjct: 312 DFSPTGDEIVTGS 324

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 57/210 (27%), Positives = 95/210 (45%), Gaps = 51/210 (24%)

Query: 134 SPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAF--------NPTVSGQ- 184
           S N +AT +  G++  ++ + +E+      SF  H     GL           P +  Q 
Sbjct: 79  SLNKLATGSADGVIKYWNMSTREE----FVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQN 134

Query: 185 -LLSASDDGTVALW--DVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLI 241
            +LS SDD TV LW  +V   +NK+ S                            DN  +
Sbjct: 135 FMLSCSDDKTVKLWSINVDDYSNKNSS----------------------------DNDSV 166

Query: 242 IHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHE 301
              TN +  I+     SAF  +  S R  +  A  G  + ++L+D+ RL KP+  ++   
Sbjct: 167 ---TNEEGLIRTFDGESAFQGID-SHRENSTFATGG--AKIHLWDVNRL-KPVSDLSWGA 219

Query: 302 DSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
           D++TSL+F+ ++  +L S+GSD  I+++DL
Sbjct: 220 DNITSLKFNQNETDILASTGSDNSIVLYDL 249

>NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201
          Length = 475

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 52/242 (21%), Positives = 95/242 (39%), Gaps = 61/242 (25%)

Query: 136 NIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPT-VSGQ-----LLSAS 189
           N +AT +  G+V  ++ + +E+    + SF  H     GL   P  +S Q     +LS S
Sbjct: 81  NKLATGSADGVVKYWNMSTREE----LCSFKAHYGLITGLCVTPEHLSKQKNENFMLSCS 136

Query: 190 DDGTVALWDVTSTANKSPSQTFDVHT---------------------------------- 215
           DD TV LW V S    +     D++T                                  
Sbjct: 137 DDKTVKLWSVNSEDYANLKNAEDINTASGLLKTYYSDFAFQGIDHHRSKSNFVTGGAKIQ 196

Query: 216 -----------------DIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSS 258
                            D ++  K+++ ++ +  +   DN+L+++D  ++   QK+  + 
Sbjct: 197 LWDSNRSKPLTDLSWGADNISTVKFNQNETDILASAGSDNSLVLYDLRTNSPTQKIVQTM 256

Query: 259 AFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLT 318
             N + ++         A  D N Y YD+R + + L+    H  +V  ++FSP  D ++T
Sbjct: 257 RTNAICWNPMEAFNFVVANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFSPTGDEIVT 316

Query: 319 SS 320
            S
Sbjct: 317 GS 318

>KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} similar
           to uniprot|P42841 Saccharomyces cerevisiae YNL317W PFS2
           Integral subunit of the pre-mRNA cleavage and
           polyadenylation factor (CPF) complex plays an essential
           role in mRNA 3'-end formation by bridging different
           processing factors and thereby promoting the assembly of
           the processing complex
          Length = 452

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 53/220 (24%), Positives = 91/220 (41%), Gaps = 17/220 (7%)

Query: 168 HKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQ 227
           H E    ++F+PT   + +S SDD  + +W+    +N    +    H   V  C WH  +
Sbjct: 164 HMECVREISFSPT-DQKFVSCSDDNVLKIWNF---SNGQQERVLSGHHWDVKSCDWHP-K 218

Query: 228 SSLFGTVSEDNTLIIHDTNSDRAIQK-LSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYD 286
             L  + S+DN +   D  S   +   L       +  F  +  NLL+    D    +YD
Sbjct: 219 MGLIVSGSKDNLIKFWDPRSGSCVSTMLGFKHTIISTKFQPKQGNLLSVISKDKTCKVYD 278

Query: 287 LRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDG 346
           +R+  K L S+    D +T L++ P  + + T    D  I  +DL     E QP+     
Sbjct: 279 IRQQAKELFSVRDDVDYMT-LQWHPIDETVFTVGCYDGSIKHFDL---SQENQPNKPTHN 334

Query: 347 VPELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENVLQIW 386
           +P        H   V   ++ S +  +M S  ++  ++ W
Sbjct: 335 IPY------AHEKCVTSLAY-SPIGHIMASASKDRTIRFW 367

>Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {ON}
           complement(61507..62967) [1461 nt, 487 aa]
          Length = 486

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 81/173 (46%), Gaps = 20/173 (11%)

Query: 177 FNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSE 236
           +NP  +  L+S+S D T  +WD+ S +N   +Q    H   V D K+    + LF +   
Sbjct: 230 WNPIDTNLLISSSIDTTCIVWDLQS-SNYVRTQLI-AHDSEVFDVKFLAHSTQLFASCGG 287

Query: 237 DNTL------------IIHDTNSDR-----AIQKLSVSSAFNTLAFSKRSENLLAAAGTD 279
           D ++            II+++NSD+             SA   L  S    N++A    D
Sbjct: 288 DGSVRVFDLRSLAHSTIIYESNSDQNGSDTLTDNEKSPSALLRLQPSPSDPNVMATFALD 347

Query: 280 S-NVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
           S ++ + D+R    P+ ++ GH  +V  +++ P +  +L S G D +++ WDL
Sbjct: 348 SKSILILDMRNPGSPVLTLEGHSAAVNQIKWHPKKSNVLLSCGDDCQVLYWDL 400

 Score = 43.1 bits (100), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 62/262 (23%), Positives = 100/262 (38%), Gaps = 43/262 (16%)

Query: 26  MMYDFVSETRLTWPSLTVQWLPTEMQPRE-VDGQQLLRQELLIGTLTTDNEPNYLKIAAI 84
           + +D V+E  + +P   +QWLP+  QPR+       LR   L    ++  E   L +   
Sbjct: 142 LSWDKVAEHNIIYPVSNIQWLPSVQQPRKFATSSDSLRIWSLNEEDSSLTEQVNLSLCKY 201

Query: 85  D-----LPENVTSSKP----------------------SVSDDAKENELSHRQSKIKIVR 117
           +     L +N TSS                        S S D        + S     +
Sbjct: 202 NDQHHSLSKNTTSSSDILGQFPPVTSFHWNPIDTNLLISSSIDTTCIVWDLQSSNYVRTQ 261

Query: 118 KFKHEQEVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYG-LA 176
              H+ EV   +++  S  + A+  G G V +FD  ++   H  I   S   +NG   L 
Sbjct: 262 LIAHDSEVFDVKFLAHSTQLFASCGGDGSVRVFD--LRSLAHSTIIYESNSDQNGSDTLT 319

Query: 177 FNPTVSGQLL----SASDDGTVALWDVTSTA--------NKSPSQTFDVHTDIVNDCKWH 224
            N      LL    S SD   +A + + S +          SP  T + H+  VN  KWH
Sbjct: 320 DNEKSPSALLRLQPSPSDPNVMATFALDSKSILILDMRNPGSPVLTLEGHSAAVNQIKWH 379

Query: 225 EFQSSLFGTVSEDNTLIIHDTN 246
             +S++  +  +D  ++  D N
Sbjct: 380 PKKSNVLLSCGDDCQVLYWDLN 401

>Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W
           (REAL)
          Length = 489

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 65/142 (45%), Gaps = 4/142 (2%)

Query: 188 ASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNS 247
           A+    + LWDV       P        D +   ++++ ++ +  +   DN+++++D  +
Sbjct: 195 ATGGAKIHLWDVNRL---KPISNLSWGADNITSVRFNQNETDILASTGSDNSIVLYDLRT 251

Query: 248 DRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSL 307
           +   QK+  +   N + ++         A  D N Y YD+R L + L     H  +V  +
Sbjct: 252 NSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLTVFKDHVSAVMDV 311

Query: 308 EFSPHQDGLLTSSGSDRRIIMW 329
           +FSP  D ++T S  D+ I M+
Sbjct: 312 DFSPTGDEIVTGS-YDKSIRMY 332

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/191 (23%), Positives = 91/191 (47%), Gaps = 34/191 (17%)

Query: 168 HKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVND-C----K 222
           H++  Y +A N     +L + S DG +  W++++   +    +F  H  ++   C     
Sbjct: 66  HRDGIYAIAKNYGSLNKLATGSADGVIKYWNMST---REEFVSFKAHYGLITGLCVTQPH 122

Query: 223 WHEFQS-----SLFGTVSEDNTLIIHD-----------------TNSDRAIQKLSVSSAF 260
           +H+ +S     +   + S+D T+ +                   TN +  ++     SAF
Sbjct: 123 FHDKKSDWKNQNFMLSCSDDKTVKLWSINVDDYSNKRSSDNDSVTNEEGLVRTFDGESAF 182

Query: 261 NTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSS 320
             +  S R  +  A  G  + ++L+D+ RL KP+ +++   D++TS+ F+ ++  +L S+
Sbjct: 183 QGID-SHRENSTFATGG--AKIHLWDVNRL-KPISNLSWGADNITSVRFNQNETDILAST 238

Query: 321 GSDRRIIMWDL 331
           GSD  I+++DL
Sbjct: 239 GSDNSIVLYDL 249

>ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 482

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 47/241 (19%), Positives = 92/241 (38%), Gaps = 60/241 (24%)

Query: 136 NIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQ------LLSAS 189
           N +AT +G G+V  ++ +  E+    + SF  H     GL  +P ++ +      +LS  
Sbjct: 81  NKMATGSGDGVVKFWNMSSSEE----LCSFKAHYGIVTGLCVSPVLASKNKNLQYMLSCG 136

Query: 190 DDGTVALWDVTS------------------------------------------------ 201
           DD TV LW V +                                                
Sbjct: 137 DDKTVKLWSVDTDDYADVKDDQNLNTRGLLKTFYGDHSFQGIDHHRSNSAFVTGGAQIQL 196

Query: 202 --TANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSA 259
             T+    +       D +   K+++  S++  +   DN+++++D  ++   QK+     
Sbjct: 197 WDTSRSKSTSNLSWGADNITSVKFNQNDSNILASTGSDNSIVLYDLRTNSPTQKIVQQMR 256

Query: 260 FNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTS 319
            N+L ++            D N Y YD+R++ + L+    H  +V  ++F+P  D ++T 
Sbjct: 257 TNSLCWNPMEPFNFVTGNEDHNAYYYDMRKMNRALNVFKDHVSAVMDVDFAPTGDEIVTG 316

Query: 320 S 320
           S
Sbjct: 317 S 317

>SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]
           {ON} highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 476

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 50/246 (20%), Positives = 90/246 (36%), Gaps = 69/246 (28%)

Query: 136 NIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQ----------L 185
           N +AT +G G+V  ++ + +E+    + SF  H    YGL     V+ Q          +
Sbjct: 81  NKLATASGDGVVKYWNMSTREE----LCSFKAH----YGLVTGLCVTPQHLSKNKNENYM 132

Query: 186 LSASDDGTVALWDVTS-------------------------------------------- 201
           LS  DD  + LW V S                                            
Sbjct: 133 LSCGDDKMIKLWSVNSDDFSSTRDNDELNTGDGLLKTFHGEYAFQSIDHHRTKSTFVTGG 192

Query: 202 -------TANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKL 254
                  T    P        D V   K+++ ++ +  +   DN+++++D  ++   QK+
Sbjct: 193 AQIELWDTGRSKPVSNLSWGADNVTSVKFNQNETDILASTGSDNSVVLYDLRTNSPTQKI 252

Query: 255 SVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQD 314
             +   N + ++         A  D N Y YD+R + + L+    H  +V  ++FSP  D
Sbjct: 253 VQTMRTNAICWNPMEAFNFVIANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFSPTGD 312

Query: 315 GLLTSS 320
            ++T S
Sbjct: 313 EIVTGS 318

>Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa]
           {ON} YCR072C - Protein required for cell viability
           [contig 17] FULL
          Length = 514

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 75/168 (44%), Gaps = 15/168 (8%)

Query: 176 AFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVS 235
           AF P  SG++++ S D T  +WD  +    +P  T   H + V    W      L  T S
Sbjct: 149 AFAPHTSGRMVTGSGDNTARIWDCNT---NTPMYTLKGHFNWVLCVAWCP-DGELIATGS 204

Query: 236 EDNTLIIHDTNSD-------RAIQKLSVSSAFNTLAFSKRSEN-LLAAAGTDSNVYLYDL 287
            DNT+ + D+N         R   K   S  +  +   K  +   LA+A  D  + ++D 
Sbjct: 205 MDNTIRLWDSNKGESYGEALRGHAKWITSLTWEPMHLVKAGDQPRLASASKDGTIKIWDT 264

Query: 288 RRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIG 335
            R    L +++GH +SV+ +++     G+L S   D+ I  WD+   G
Sbjct: 265 TRRVCVL-TLSGHTNSVSCVKWGGR--GILYSGSHDKTIRAWDMAAGG 309

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 60/266 (22%), Positives = 103/266 (38%), Gaps = 63/266 (23%)

Query: 184 QLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIH 243
           +L SAS DGT+ +WD T    +    T   HT+ V+  KW      +  + S D T+   
Sbjct: 249 RLASASKDGTIKIWDTT---RRVCVLTLSGHTNSVSCVKWG--GRGILYSGSHDKTIRAW 303

Query: 244 DT----------------------NSDRAI---------------QKLSVSSAFNTLAFS 266
           D                       N+D A+               ++    +  N    +
Sbjct: 304 DMAAGGKCINILKSHAHWINHLSLNTDYALRVGAFDHTGEKPSSPEEARAKALKNYEKIA 363

Query: 267 KRS---ENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDG-LLTSSGS 322
           K++   E L+  A  D  +YL+D  +  KP+  M GH+  V  + FSP  DG  + S+  
Sbjct: 364 KKNGQLEELMVTASDDFTMYLWDPLKASKPITRMTGHQKLVNHVAFSP--DGRYIVSASF 421

Query: 323 DRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENV 382
           D  I +WD  N                      GH + V + + +S+   L+ S  ++  
Sbjct: 422 DNSIKLWDGRN--------------GTFIATFRGHVASVYQVAWSSDCR-LLVSCSKDTT 466

Query: 383 LQIWKPANKIVRPPQPPADFDITTLE 408
           L++W    K +    P  + ++ T++
Sbjct: 467 LKVWDVRTKKLSVDLPGHNDEVYTVD 492

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 11/48 (22%), Positives = 24/48 (50%)

Query: 284 LYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
           ++ +R + +   ++AGH  ++    F+PH  G + +   D    +WD 
Sbjct: 125 VFKVRPVTRSSSAIAGHGSTILCSAFAPHTSGRMVTGSGDNTARIWDC 172

>SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 398

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 84/175 (48%), Gaps = 12/175 (6%)

Query: 166 SYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKW-- 223
           S+  EN + L   P  +  LL++  +G + L D  +         F  H+  +++ K   
Sbjct: 10  SFGCEN-WCLQLQPLYNRGLLTSLSNGHIHLVDWCT---GEIIHEFAAHSASISNLKVLN 65

Query: 224 HEFQSS-LFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAA---AGTD 279
           +EF +S LF + S+D+  I  D  +   +  L    +   L+   R + L      +G D
Sbjct: 66  NEFTNSDLFASASKDSVKIF-DVRTSSCVATLHNDKSAPFLSLDSRHDMLACGTELSGVD 124

Query: 280 SNVYLYDLRRLQKPLHSMA-GHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFN 333
           + +++YD+++L KPL S    H D +T  +F P   G+L S  +D  + ++DL N
Sbjct: 125 AELHIYDIKKLSKPLRSFVDSHHDDITDTKFHPGDPGVLMSGSTDGYVNIYDLTN 179

>Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]
           {ON} YNL317W (PFS2) - Polyadenylation Factor I subunit
           [contig 124] FULL
          Length = 451

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 54/237 (22%), Positives = 99/237 (41%), Gaps = 20/237 (8%)

Query: 168 HKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQ 227
           H +   G++F+ T S + ++ SDD  + +W+ ++   +S   T   H   V  C WH   
Sbjct: 166 HTQCIRGISFSGTDS-KFVTCSDDNILKIWNFSNGQQES---TLSGHHWDVRSCDWHP-T 220

Query: 228 SSLFGTVSEDNTLIIHDTNSDRAIQK-LSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYD 286
             L  + S+DN + + D  + + I   L       +  F     N+LA    D +  ++D
Sbjct: 221 MGLIASGSKDNLVKLWDPRAGQCISTILGCKHTIISTKFQPTKGNMLAVISKDKSCRIFD 280

Query: 287 LRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDG 346
           +R+  K L ++   E    SL + P  + + T    D  +  +DL      Q+P D+  G
Sbjct: 281 IRQNMKEL-AVYRDESDYMSLTWHPINESMFTVGCYDGSMKHFDLL-----QEPQDSSSG 334

Query: 347 VPELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENVLQIWKPANKIVRPPQPPADFD 403
                 +   H   +   ++N  V  ++ S  ++  ++ W  A      P  P  FD
Sbjct: 335 C--FHNIPYAHDKCITSLAYNP-VGHILASASKDRTIRFWTRAR-----PYDPNSFD 383

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 67/149 (44%), Gaps = 9/149 (6%)

Query: 185 LLSASDDGTVALWDVTSTANKSPSQTFD-VHTDIVNDCKWHEFQSSLFGTVSEDNTLIIH 243
           L+S   DGT+ +W      N +  +  D  HT  +    +    S  F T S+DN L I 
Sbjct: 140 LISGDSDGTIKIWQ----PNFNMVKVLDEAHTQCIRGISFSGTDSK-FVTCSDDNILKIW 194

Query: 244 DTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSN-VYLYDLRRLQKPLHSMAGHED 302
           + ++ +    LS    ++  +        L A+G+  N V L+D R  Q  + ++ G + 
Sbjct: 195 NFSNGQQESTLS-GHHWDVRSCDWHPTMGLIASGSKDNLVKLWDPRAGQC-ISTILGCKH 252

Query: 303 SVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
           ++ S +F P +  +L     D+   ++D+
Sbjct: 253 TIISTKFQPTKGNMLAVISKDKSCRIFDI 281

>NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {ON}
           Anc_8.288
          Length = 1145

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 69/138 (50%), Gaps = 3/138 (2%)

Query: 196 LWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNS-DRAIQKL 254
           +W++  T++ +       H+  + D  ++     +  T S D  +   D  S  R     
Sbjct: 98  IWNLARTSSDAIDHVLHGHSRAITDINFNPENPDILATCSVDTYVHAWDMRSPHRPFYTT 157

Query: 255 SV-SSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQ 313
           S   S  + + ++ +  N+LA+A ++ ++Y++DLR    PLH + GH+ SV S++F+  +
Sbjct: 158 SAWRSGASQVKWNYKDSNILASAHSN-DIYIWDLRMGSTPLHKLVGHDSSVNSIDFNRFK 216

Query: 314 DGLLTSSGSDRRIIMWDL 331
              + SS +D  +  WD+
Sbjct: 217 SSEIMSSSNDGTVKFWDI 234

 Score = 38.5 bits (88), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 47/225 (20%), Positives = 89/225 (39%), Gaps = 23/225 (10%)

Query: 121 HEQEVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPT 180
           H + +T   + P++P+I+AT +    V+ +D       H    + S  +     + +N  
Sbjct: 116 HSRAITDINFNPENPDILATCSVDTYVHAWDM---RSPHRPFYTTSAWRSGASQVKWNYK 172

Query: 181 VSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTL 240
            S  L SA  +  + +WD+      +P      H   VN   ++ F+SS   + S D T+
Sbjct: 173 DSNILASAHSN-DIYIWDL--RMGSTPLHKLVGHDSSVNSIDFNRFKSSEIMSSSNDGTV 229

Query: 241 IIHDTNSDRAIQKLSVSSAF-----NTLAFSKRSENLLAAAGTDSNVYLYDLRRLQ---- 291
              D +        +VS+ F       L F      ++   G  + VYL  L+  +    
Sbjct: 230 KFWDISKGSDNCTSTVSTDFPIWRGRYLPFGN-GFCIMPQEGGGNAVYLSTLKEQENLNE 288

Query: 292 -------KPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMW 329
                  +P++S  GH + V    +   Q   L  +  + +++ W
Sbjct: 289 SNKLTKLQPIYSFKGHSERVIDFLWRSRQPSDLMVNDCEFQLVTW 333

>KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {ON}
           Anc_3.259 YDR030C
          Length = 369

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 60/233 (25%), Positives = 98/233 (42%), Gaps = 32/233 (13%)

Query: 185 LLSASDDGTVALWDVTSTA-------NKSPSQTFDVHTDI--VNDCKWHEFQSSLFGTVS 235
            L+ +++GTV+LW++ +T        NK    +   H+ +  +ND KW+     +F T  
Sbjct: 64  FLAGNNNGTVSLWNLDNTLSTSHILNNKLARTSTKPHSHLFGINDMKWYSIDDGMFFTCG 123

Query: 236 EDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNV-YLYDLRRLQKPL 294
            D  + + DTN    +Q L     FN+  F   + N       D     L DLR +   +
Sbjct: 124 NDKFVKLWDTNKFINVQDLE----FNSNLFQMDTANQFILVTLDDYYPRLIDLRNMNLGI 179

Query: 295 HSMAGHEDSVT-SLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMM 353
                H +S T   + +P +D L+ SS +D  I +WD+            Y  + E    
Sbjct: 180 TIFGKHLNSKTLCCKINPVRDNLIASSDNDGMIRIWDV---------RMNYRSIEEW--- 227

Query: 354 HGGHRSPVNEFSHNSNVPWLMCSVEEENVLQIWK-PANKIVRPPQPPADFDIT 405
              H   +N+   N N   L+ S   +  +QIW+ P N+     Q   D +IT
Sbjct: 228 -KAHSRSINDMVWNDNGTKLI-STGVDGKIQIWREPFNET--QGQLIGDINIT 276

>Kwal_14.1710 s14 (433526..435250) [1725 bp, 574 aa] {ON} YGL116W
           (CDC20) - anaphase promoting complex subunit [contig
           237] FULL
          Length = 574

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 59/236 (25%), Positives = 106/236 (44%), Gaps = 32/236 (13%)

Query: 137 IIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQLLSASDDGTVAL 196
           +IAT + +G ++I D  ++ K+H  ++++  HK    G+A+ P    QL S S+D TVA+
Sbjct: 333 LIATGSKSGEIHIND--VRIKNH-IVSTWEEHKGEVCGIAYRPD-GLQLASGSNDNTVAI 388

Query: 197 WDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIH-----------DT 245
           WD  ++    P      HT  V    W    S+L  T        IH             
Sbjct: 389 WDTRTSL---PQHIKRQHTAAVKALAWSPDISNLLATGGGQTDKHIHFWNTTTGARTGSI 445

Query: 246 NSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSN---VYLYDLR-RLQKPLHSMAGHE 301
           N+   +  L    ++N+ A  +    ++A  G   N   +Y YD + ++ + +H+   HE
Sbjct: 446 NTGSQVSSLHWGQSYNSNAIQRE---IVATGGIPENAVSIYNYDTKFKVAEIVHA---HE 499

Query: 302 DSVTSLEFSPHQDG-LLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGG 356
             + S + SP  DG +L + G D  +  + +F     ++P    DG   + +++ G
Sbjct: 500 ARICSSQLSP--DGTVLATVGGDENLKFYKVFEP-RRKRPQGVCDGESLMGLLNVG 552

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 60/144 (41%), Gaps = 11/144 (7%)

Query: 191 DGTVALWDVTSTAN-KSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDR 249
           +G   +WDV S ++ ++      V    +    W E   +L  T S+   + I+D     
Sbjct: 299 EGNTEIWDVDSMSHVRTMRSGLGVR---IGSQSWLE---TLIATGSKSGEIHINDVRIKN 352

Query: 250 AIQKLSVSSAFNTLAFSKRSENLLAAAGTDSN-VYLYDLRRLQKPLHSMAGHEDSVTSLE 308
            I              + R + L  A+G++ N V ++D  R   P H    H  +V +L 
Sbjct: 353 HIVSTWEEHKGEVCGIAYRPDGLQLASGSNDNTVAIWDT-RTSLPQHIKRQHTAAVKALA 411

Query: 309 FSPHQDGLLTSSG--SDRRIIMWD 330
           +SP    LL + G  +D+ I  W+
Sbjct: 412 WSPDISNLLATGGGQTDKHIHFWN 435

>KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5.201
           YLL011W
          Length = 480

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 60/128 (46%), Gaps = 5/128 (3%)

Query: 194 VALWDVTSTANKS-PSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQ 252
           + LWD    +N+S P        D +   K+++ +  +  +   DN ++++D  ++   Q
Sbjct: 194 IHLWD----SNRSKPISNLSWGADNITSVKFNQNEVDILASTGSDNAIVLYDLRTNSPTQ 249

Query: 253 KLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPH 312
           K+  +   N + ++         A  D N Y YD+R + + LH    H  +V  ++FSP 
Sbjct: 250 KIIQTMRTNAICWNPMEAFNFVIANEDHNAYYYDMRNMSRALHVFKDHVSAVMDVDFSPT 309

Query: 313 QDGLLTSS 320
            D ++T S
Sbjct: 310 GDEIVTGS 317

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 85/189 (44%), Gaps = 24/189 (12%)

Query: 162 IASFSY-HKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVND 220
           I    Y H++  Y +A N     +L S S DG +  W++++   +    +F  H  +V  
Sbjct: 59  IGQLGYGHRDGVYTIAKNYNNLNKLASGSADGIIKYWNMST---REEFVSFKAHYGLVTG 115

Query: 221 -CKWHEFQS-----SLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLA 274
            C   E  S     +   +  +D T+ +   N+D     +   +  NT    K      A
Sbjct: 116 LCVTPEHTSKNKNENFMLSCGDDKTVKLWSVNND-DFSNVKSDAELNTEGLLKTFYGEHA 174

Query: 275 AAGTD------------SNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGS 322
             G D            + ++L+D  R  KP+ +++   D++TS++F+ ++  +L S+GS
Sbjct: 175 FQGIDHHREASTFVTGGAQIHLWDSNR-SKPISNLSWGADNITSVKFNQNEVDILASTGS 233

Query: 323 DRRIIMWDL 331
           D  I+++DL
Sbjct: 234 DNAIVLYDL 242

>TBLA0F02140 Chr6 complement(526982..530884) [3903 bp, 1300 aa] {ON}
           Anc_7.310 YDL195W
          Length = 1300

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/208 (23%), Positives = 90/208 (43%), Gaps = 27/208 (12%)

Query: 145 GIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTAN 204
           G+V +F  N K+    +I   S H  +   + FN      L S S +G + +WD+    N
Sbjct: 84  GMVELFKTNSKDT-LKSIKKLSKHGTSVTTVNFNAKQENVLASGSKNGEIFIWDL----N 138

Query: 205 KSPSQTFDVHTDI-----------VNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQK 253
           K   Q+ D ++ +           +    W++  S +F +    +   I D  + + +  
Sbjct: 139 KCIDQSNDSYSPLTPGMAMTPVEEITSLAWNQSLSHVFASAGNTSYASIWDLKAKKEVIH 198

Query: 254 LSVSSAFNTLA--------FSKRSENLLAAAGTDSN--VYLYDLRRLQKPLHSMA-GHED 302
           LS +S  ++L           + S  +  A+ +D+   + ++DLR    PL  +  G+  
Sbjct: 199 LSYTSPSSSLKPQLSVVEWHPENSTRVATASNSDNEPIILIWDLRNANTPLQILENGNSK 258

Query: 303 SVTSLEFSPHQDGLLTSSGSDRRIIMWD 330
            + SL++  H   LL SSG D   ++W+
Sbjct: 259 GILSLDWCKHDSNLLLSSGRDNTAVLWN 286

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 91/194 (46%), Gaps = 21/194 (10%)

Query: 154 IKEKDHGAIASFSYHKENGYGLAFNPTVSGQL-LSASDDGTVALWDVTSTANKSPSQTFD 212
           +K  ++   A+F++ + N        T SG +    S D T+ LW + ST   +P  + +
Sbjct: 2   VKLAEYSRTATFAWSR-NKIPTLVTGTASGTVDADFSSDSTLELWSLLSTDKLNPVVSVE 60

Query: 213 VHTDIVNDCKWHEFQSSLFGTVSEDNTLI-IHDTNSD---RAIQKLSV-SSAFNTLAFSK 267
            +    ND  W      + G +  DN ++ +  TNS    ++I+KLS   ++  T+ F+ 
Sbjct: 61  ANAKF-NDIDWSIDNKYIAGAL--DNGMVELFKTNSKDTLKSIKKLSKHGTSVTTVNFNA 117

Query: 268 RSENLLAAAGTDSNVYLYDLRRL----------QKPLHSMAGHEDSVTSLEFSPHQDGLL 317
           + EN+LA+   +  ++++DL +             P  +M   E+ +TSL ++     + 
Sbjct: 118 KQENVLASGSKNGEIFIWDLNKCIDQSNDSYSPLTPGMAMTPVEE-ITSLAWNQSLSHVF 176

Query: 318 TSSGSDRRIIMWDL 331
            S+G+     +WDL
Sbjct: 177 ASAGNTSYASIWDL 190

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 57/251 (22%), Positives = 106/251 (42%), Gaps = 25/251 (9%)

Query: 105 ELSHRQSK--IKIVRKF-KHEQEVTRARYMPQSPNIIATLNGAGIVYIFDRN-IKEKDHG 160
           EL    SK  +K ++K  KH   VT   +  +  N++A+ +  G ++I+D N   ++ + 
Sbjct: 87  ELFKTNSKDTLKSIKKLSKHGTSVTTVNFNAKQENVLASGSKNGEIFIWDLNKCIDQSND 146

Query: 161 AIASFSYHK-----ENGYGLAFNPTVSGQLLSASDDGTVALWDVTST------ANKSPSQ 209
           + +  +        E    LA+N ++S    SA +    ++WD+ +       +  SPS 
Sbjct: 147 SYSPLTPGMAMTPVEEITSLAWNQSLSHVFASAGNTSYASIWDLKAKKEVIHLSYTSPSS 206

Query: 210 TFDVHTDIVNDCKWHEFQSSLFGTVS-EDNTLII-----HDTNSDRAIQKLSVSSAFNTL 263
           +      +V   +WH   S+   T S  DN  II      + N+   I +   S    +L
Sbjct: 207 SLKPQLSVV---EWHPENSTRVATASNSDNEPIILIWDLRNANTPLQILENGNSKGILSL 263

Query: 264 AFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSD 323
            + K   NLL ++G D+   L++     K L       +     +F+P    L   +  D
Sbjct: 264 DWCKHDSNLLLSSGRDNTAVLWNPEE-GKELTQYPSRSNWCFKTKFAPEAPDLFACASFD 322

Query: 324 RRIIMWDLFNI 334
            ++ +  L N+
Sbjct: 323 GKVEIQTLQNL 333

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 43/98 (43%), Gaps = 10/98 (10%)

Query: 292 KPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELF 351
           K +  ++ H  SVT++ F+  Q+ +L S   +  I +WDL       Q +D+Y       
Sbjct: 98  KSIKKLSKHGTSVTTVNFNAKQENVLASGSKNGEIFIWDLNK--CIDQSNDSYSP----- 150

Query: 352 MMHGGHRSPVNEFSH---NSNVPWLMCSVEEENVLQIW 386
           +  G   +PV E +    N ++  +  S    +   IW
Sbjct: 151 LTPGMAMTPVEEITSLAWNQSLSHVFASAGNTSYASIW 188

>TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {ON}
           Anc_5.201 YLL011W
          Length = 473

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/139 (23%), Positives = 69/139 (49%), Gaps = 6/139 (4%)

Query: 194 VALWDVTSTANKS-PSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQ 252
           + LWD    +N+S P        D V + K+++ +  +  +   DN+++++D  ++   Q
Sbjct: 194 IELWD----SNRSNPISNLSWGADNVTNVKFNQNEHDILASTGSDNSIVLYDLRTNSPTQ 249

Query: 253 KLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPH 312
           K+  +   N+L ++         A  D N Y YD+R + + L+    H  +V  ++FSP 
Sbjct: 250 KIVQTMRTNSLCWNPMEAFNFVTANEDQNSYYYDMRYMSRALNVFKDHVSAVMDVDFSPT 309

Query: 313 QDGLLTSSGSDRRIIMWDL 331
              ++T S  D+ I ++++
Sbjct: 310 GQEIVTGS-YDKTIRIYNI 327

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 82/191 (42%), Gaps = 41/191 (21%)

Query: 168 HKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQ 227
           H++  Y +A N     +L SAS DG +  W++++   +    +F  H  +V         
Sbjct: 66  HRDGVYHIAKNYNNLNKLASASADGIIKYWNMST---REEYASFKAHYGLVTGL------ 116

Query: 228 SSLFGTVSEDNTLIIHDTNSDRAIQKLSVSS---------------AFNTLAFSKRSENL 272
                 VSE N   +     D+ I+  S+ S                 N L  +  S+N 
Sbjct: 117 --CVTPVSEKNKQFMLSAGDDKMIKLWSIESDDFADNKNEDDNDNNTSNGLIKTFYSQN- 173

Query: 273 LAAAGTDSN------------VYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSS 320
            A  G D +            + L+D  R   P+ +++   D+VT+++F+ ++  +L S+
Sbjct: 174 -AIQGLDHHRIDPTFVTGGPMIELWDSNR-SNPISNLSWGADNVTNVKFNQNEHDILAST 231

Query: 321 GSDRRIIMWDL 331
           GSD  I+++DL
Sbjct: 232 GSDNSIVLYDL 242

>TDEL0A07400 Chr1 complement(1292494..1295199) [2706 bp, 901 aa]
           {ON} Anc_6.325 YCR057C
          Length = 901

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 91/185 (49%), Gaps = 9/185 (4%)

Query: 168 HKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQ 227
           H ++   L ++P  S ++++A++DG + +WDV S        T + HT  V   ++ +  
Sbjct: 332 HFDSLNALTYSPDGS-RVVTAAEDGKIKVWDVISGF---CLVTLEGHTSSVTAVQFAKRG 387

Query: 228 SSLFGTVSEDNTLIIHDTNSDRAIQKLSVSS--AFNTLAFSKRSENLLAAAGTDSNVYLY 285
             LF + S D T+   D    R  +  + +    FN LA     E + A +    +++++
Sbjct: 388 QVLF-SASLDGTVRAWDLIRYRNFRVFTAAERIQFNCLAVDPSGECVCAGSVDSFDIHVW 446

Query: 286 DLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYD 345
            ++  Q  L +++GHE  V+ L FS  ++ +L S+  D+ I +W +F    + +P D Y 
Sbjct: 447 SVQTSQ-LLDTLSGHEGPVSCLSFS-QENSVLASASWDKTIRIWSIFGRSQQVEPIDVYS 504

Query: 346 GVPEL 350
            V  L
Sbjct: 505 DVLAL 509

>KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {ON}
           Anc_5.201 YLL011W
          Length = 485

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 62/135 (45%), Gaps = 3/135 (2%)

Query: 186 LSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDT 245
           L  +    + LWD   +   +P        D +   K+++ ++ +  +   DN+++++D 
Sbjct: 193 LFVTGGAKIELWDNNRS---TPLTNLSWGADNITSLKFNQSETDIVASAGSDNSVVLYDL 249

Query: 246 NSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVT 305
            ++   QK+  S   N + ++         A  D N Y YD+R + + L+    H  +V 
Sbjct: 250 RTNSPTQKIVQSMRTNAICWNPMEPFNFVVANEDHNAYYYDMRNMSRSLNVFKDHVSAVM 309

Query: 306 SLEFSPHQDGLLTSS 320
            ++FSP  D ++T S
Sbjct: 310 DVDFSPTGDEIVTGS 324

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 49/204 (24%), Positives = 85/204 (41%), Gaps = 43/204 (21%)

Query: 136 NIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNP---TVSG-----QLLS 187
           N +AT +G G++  ++ + +E+      SF  H     GL   P   +V G      +LS
Sbjct: 81  NKLATASGDGVIKYWNMSTREE----YVSFKGHYGLVTGLCVTPEGLSVGGLSNQNHMLS 136

Query: 188 ASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNS 247
             DD T+ LW +                   ND          F  +  D  LI     S
Sbjct: 137 CGDDKTIKLWSIN------------------NDD---------FANIKSDEELITKTNGS 169

Query: 248 DRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSL 307
              ++      AF  +    R + L    G  + + L+D  R   PL +++   D++TSL
Sbjct: 170 GALLKTFYGEHAFQGIDHH-REKPLFVTGG--AKIELWDNNR-STPLTNLSWGADNITSL 225

Query: 308 EFSPHQDGLLTSSGSDRRIIMWDL 331
           +F+  +  ++ S+GSD  ++++DL
Sbjct: 226 KFNQSETDIVASAGSDNSVVLYDL 249

>Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {ON}
           YKR036C (REAL)
          Length = 645

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 55/233 (23%), Positives = 101/233 (43%), Gaps = 52/233 (22%)

Query: 185 LLSASDDGTVALWDVTST----ANKSPSQ------------TFDVHTDIVNDCKWHEFQS 228
           L++ S D T+ +WD+  +    +++SP +             F++H+D +       F S
Sbjct: 380 LITGSKDATLKMWDLNLSKELYSDQSPLKQNAEEVVTPCLHNFELHSDEITAL---SFDS 436

Query: 229 SLFGTVSEDNTLIIHDTNSDRAIQKLS--VSSAFNTLAFSKRSEN--------------- 271
               + S+D  ++  D  + + +Q+L   V+  +N    S RS N               
Sbjct: 437 EALISGSKDRKILHWDLVTGKCVQQLDLIVTPTYNDTKVSARSANNSTSVLGSEAPMIGA 496

Query: 272 ------LLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRR 325
                  LA+   D  V L+DLR + KP+ ++ GH D +TSL+F   +   L +   D  
Sbjct: 497 LQCYNSALASGTKDGVVRLWDLR-IGKPVRALEGHTDGITSLKFDSEK---LVTGSMDNS 552

Query: 326 IIMWDL-----FNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPWL 373
           + +WDL      ++ A   P  + D   +L  + G + + VN F+   +  W+
Sbjct: 553 VRIWDLRTSSIIDVIAYDLPITSLDFDDKLITV-GANETGVNVFNMERDEHWM 604

>Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}
           similar to Ashbya gossypii AFL157C
          Length = 435

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 62/265 (23%), Positives = 108/265 (40%), Gaps = 58/265 (21%)

Query: 125 VTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHK---ENGYGLAFNPTV 181
           V+R ++MP S   +AT + +  ++     +KE+ + ++  +        NG+ L   P V
Sbjct: 110 VSRIQWMPMSSEKLATCSDSLRIWSLGDQLKEQVNLSLVKYGKGVGDVANGHTLGKLPPV 169

Query: 182 SG---------QLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFG 232
           +           +LS+S D T  +WD+ ++ N   +Q    H   V D K+    S+LF 
Sbjct: 170 TSFDWNSIDTNIILSSSIDTTCTVWDLQAS-NYVKTQLI-AHDSEVFDAKFLTQSSNLFA 227

Query: 233 TVSEDNTLIIHD---------------------------------------TNSDRAIQK 253
           +   D ++ + D                                        N + A   
Sbjct: 228 SCGGDGSVRVFDLRCLAHSTIIYEPQSQIQTHTPSQIQLSAQGHDDGHARKNNQNAAETS 287

Query: 254 LSVSS----AFNTLAFSKRSENLLAAAGTDSNVYL-YDLRRLQKPLHSMAGHEDSVTSLE 308
           L+VSS    A   L  S    N+LA    DSNV +  D+R    P+ ++ GH  ++  L 
Sbjct: 288 LAVSSLESQALLRLEPSPFDPNILATIQQDSNVVIILDMRYPGSPILTLNGHYCALNQLR 347

Query: 309 FSPHQDGLLTSSGSDRRIIMWDLFN 333
           + P +  +L + G D +I+ WDL +
Sbjct: 348 WHPSKPNVLATCGDDCQILYWDLLD 372

>TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {ON}
           Anc_6.340 YCR072C
          Length = 515

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 46/183 (25%), Positives = 85/183 (46%), Gaps = 16/183 (8%)

Query: 163 ASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCK 222
           A+ + H       +F P  S ++++ + D T  +WD  +   ++P  T   HT+ V    
Sbjct: 137 AAIAGHGSTILCSSFAPHTSSRMVTGAGDNTARIWDCDT---QTPMVTLSGHTNWVLCVA 193

Query: 223 WHEFQSSLFGTVSEDNTLIIHDTNSD-------RAIQKLSVSSAFNTLAFSKRSEN-LLA 274
           W      L  T S DNT+ + +  +        R  QK   S ++  L   K  E   LA
Sbjct: 194 WSP-DGELIATGSMDNTIRLWEGKNGKPFGEAMRGHQKWITSLSWEPLHLVKAGERPKLA 252

Query: 275 AAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNI 334
            +  D  + ++D  R +  L++++GH +SV+ +++      LL S   D+ + +WD+ N+
Sbjct: 253 TSSKDGTIKVWDTGR-RVCLYTLSGHVNSVSCVKWGGKN--LLYSGSHDKTVRVWDM-NL 308

Query: 335 GAE 337
           G +
Sbjct: 309 GGK 311

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 56/244 (22%), Positives = 98/244 (40%), Gaps = 63/244 (25%)

Query: 184 QLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIH 243
           +L ++S DGT+ +WD   T  +    T   H + V+  KW     +L  + S D T+ + 
Sbjct: 250 KLATSSKDGTIKVWD---TGRRVCLYTLSGHVNSVSCVKWG--GKNLLYSGSHDKTVRVW 304

Query: 244 DTNSDRA-----------IQKLSVSSAF--------------------------NTLAFS 266
           D N               +  LS+S+ +                          N    +
Sbjct: 305 DMNLGGKCINILKSHAHWVNHLSLSTDYALRVGPFDHTGIMPATPEEARAKALKNYEKVA 364

Query: 267 KRS---ENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDG-LLTSSGS 322
           KR+   E L+  A  D  ++L++  +  KP+  M GH+  V  + FSP  DG  + S+  
Sbjct: 365 KRNGSDEELMVTASDDFTMFLWNPSKSTKPISRMTGHQKLVNHVAFSP--DGRYIVSASF 422

Query: 323 DRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENV 382
           D  I +W            D+ DG  +      GH + V + + +S+   L+ S  ++  
Sbjct: 423 DNSIKLW------------DSRDG--KFITTFRGHVASVYQVAWSSDCR-LLASCSKDTS 467

Query: 383 LQIW 386
           L++W
Sbjct: 468 LKVW 471

>Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 61/250 (24%), Positives = 97/250 (38%), Gaps = 63/250 (25%)

Query: 178 NPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSED 237
            P    +L S+S DGT+ +WD   + N+    T   HT+ V+  KW      L  + S D
Sbjct: 244 KPGSKPRLASSSKDGTIKIWD---SVNRVCQYTLSGHTNSVSCVKWG--GQGLLYSGSHD 298

Query: 238 NTLIIHDTNSD-RAIQ------------KLSVSSAFNTLAF------------------- 265
            T+ + D NS  R I              LS   A    AF                   
Sbjct: 299 RTVRVWDMNSQGRCINILKSHAHWVNHLSLSTDYALRVGAFDHTGKKPATSEEAQKKALE 358

Query: 266 --------SKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDG-L 316
                   +  SE ++  A  D  ++L++  +  KP+  M GH+  V  + FSP  DG  
Sbjct: 359 NYEKICKKNGSSEEMMVTASDDFTMFLWNPLKSTKPIARMTGHQKLVNHVAFSP--DGRY 416

Query: 317 LTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPWLMCS 376
           + S+  D  I +W            D  DG  +      GH + V + + +S+   L+ S
Sbjct: 417 IVSASFDNSIKLW------------DGRDG--KFISTFRGHVASVYQVAWSSDCR-LLVS 461

Query: 377 VEEENVLQIW 386
             ++  L++W
Sbjct: 462 CSKDTTLKVW 471

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 80/169 (47%), Gaps = 17/169 (10%)

Query: 176 AFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVS 235
           AF P  S ++++ + D T  +WD  +   ++P  T   H + V    W      +  T S
Sbjct: 150 AFAPHTSSRMVTGAGDNTARIWDCDT---QTPMHTLKGHFNWVLCVSWSP-DGEVIATGS 205

Query: 236 EDNTLIIHDTNSD-------RAIQKLSVSSAFNTLAFSK-RSENLLAAAGTDSNVYLYD- 286
            DNT+ + +  +        R   K     ++  +   K  S+  LA++  D  + ++D 
Sbjct: 206 MDNTIRLWNPKTGECLGDALRGHSKWITCLSWEPIHLVKPGSKPRLASSSKDGTIKIWDS 265

Query: 287 LRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIG 335
           + R+ +  ++++GH +SV+ +++     GLL S   DR + +WD+ + G
Sbjct: 266 VNRVCQ--YTLSGHTNSVSCVKWGGQ--GLLYSGSHDRTVRVWDMNSQG 310

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 71/148 (47%), Gaps = 11/148 (7%)

Query: 185 LLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHD 244
           +++ASDD T+ LW+   +    P      H  +VN   +         + S DN++ + D
Sbjct: 374 MVTASDDFTMFLWNPLKSTK--PIARMTGHQKLVNHVAFSP-DGRYIVSASFDNSIKLWD 430

Query: 245 TNSDRAIQKLS--VSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHED 302
               + I      V+S +  +A+S     LL +   D+ + ++D+ R +K    + GH+D
Sbjct: 431 GRDGKFISTFRGHVASVYQ-VAWSSDCR-LLVSCSKDTTLKVWDV-RTRKLSVDLPGHQD 487

Query: 303 SVTSLEFSPHQDG-LLTSSGSDRRIIMW 329
            V ++++S   DG  + S G D+ + +W
Sbjct: 488 EVYTVDWS--VDGKRVCSGGKDKMVRLW 513

>KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.283
           YNL035C
          Length = 399

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 87/199 (43%), Gaps = 14/199 (7%)

Query: 162 IASFSYHKENGYGLAFNPTVSGQLLSASDDGTVAL--WDVTSTANKSPSQTFDVHTDIVN 219
           I S+ +  EN +     P     +L++  +G V L  W    + NK  S    ++   + 
Sbjct: 7   IGSYFFGSEN-WCFQIQPLYKAGILTSLSNGEVHLMDWKSNKSINKFKSDETAINALQIV 65

Query: 220 DCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAA--- 276
           +  WH    + F T S  + + + D  S+  I  +        L+   R + +       
Sbjct: 66  NTDWH--NETRFITASM-HAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELK 122

Query: 277 GTDSNVYLYDLRRLQKPLHSMA-GHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIG 335
           G D+ ++++DLR+L  P  S+   H D +TS++F P    +L S  +D    ++DL    
Sbjct: 123 GVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDL---- 178

Query: 336 AEQQPDDAYDGVPELFMMH 354
           ++++ DD+   V     +H
Sbjct: 179 SQEEEDDSLHQVINFTSIH 197

>NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {ON}
           Anc_5.201 YLL011W
          Length = 479

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/128 (22%), Positives = 62/128 (48%), Gaps = 5/128 (3%)

Query: 194 VALWDVTSTANKS-PSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQ 252
           + LWD    +N+S P        D +   K+++ ++ +F +   DN+++++D  ++   Q
Sbjct: 195 IQLWD----SNRSTPLSNLSWGADNITTVKFNQNETDIFASAGSDNSIVLYDLRTNSPTQ 250

Query: 253 KLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPH 312
           K+  +   N + ++            D N Y YD+R + + ++    H  +V  ++FSP 
Sbjct: 251 KIVQTMRTNAICWNPMEAFNFVIGNEDHNAYYYDMRNMSRAINVFKDHVSAVMDVDFSPT 310

Query: 313 QDGLLTSS 320
            D ++T S
Sbjct: 311 GDEIVTGS 318

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/184 (22%), Positives = 89/184 (48%), Gaps = 26/184 (14%)

Query: 168 HKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVND-CKWHEF 226
           H++  Y +A N     +L + S DG +  W++++   +    +F  H  ++   C   E 
Sbjct: 66  HRDGVYVIAKNYRNLNKLATGSADGVIKYWNMST---RDEVCSFKAHYGLITGLCVTPEH 122

Query: 227 QS-----SLFGTVSEDNTLIIHDTNSDRAI-----QKLSVSSA-----FNTLAFS----K 267
            S     +   + S+D T+ +   NS+  +     ++L+ +S      ++ +AF      
Sbjct: 123 LSKNKNDNFMLSCSDDKTVKLWSVNSEDYVNLKDDEQLNTTSGLLKTFYSDIAFQGIDHH 182

Query: 268 RSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRII 327
           RS +     G  + + L+D  R   PL +++   D++T+++F+ ++  +  S+GSD  I+
Sbjct: 183 RSNSNFVTGG--AQIQLWDSNR-STPLSNLSWGADNITTVKFNQNETDIFASAGSDNSIV 239

Query: 328 MWDL 331
           ++DL
Sbjct: 240 LYDL 243

>Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 61/250 (24%), Positives = 97/250 (38%), Gaps = 63/250 (25%)

Query: 178 NPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSED 237
            P    +L S+S DGT+ +WD   T ++    T   HT+ V+  KW      L  + S D
Sbjct: 244 KPGSKPRLASSSKDGTIKIWD---TVSRVCQYTMSGHTNSVSCVKWG--GQGLLYSGSHD 298

Query: 238 NTLIIHDTNSD-RAIQ------------KLSVSSAFNTLAF------------------- 265
            T+ + D NS  R I              LS   A    AF                   
Sbjct: 299 RTVRVWDMNSQGRCINILKSHAHWVNHLSLSTDYALRVGAFDHTGQKPTSPEDAQKKALA 358

Query: 266 --------SKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDG-L 316
                   +  SE ++  A  D  ++L++  +  KP+  M GH+  V  + FSP  DG  
Sbjct: 359 NYEKICKKNGNSEEMMVTASDDFTIFLWNPLKSTKPIARMTGHQKLVNHVAFSP--DGRY 416

Query: 317 LTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPWLMCS 376
           + S+  D  I +W            D  DG  +      GH + V + + +S+   L+ S
Sbjct: 417 IVSASFDNSIKLW------------DGRDG--KFISTFRGHVASVYQVAWSSDCR-LLVS 461

Query: 377 VEEENVLQIW 386
             ++  L++W
Sbjct: 462 CSKDTTLKVW 471

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 81/169 (47%), Gaps = 17/169 (10%)

Query: 176 AFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVS 235
           AF P  S ++++ + D T  +WD  +   ++P  T   H + V    W      +  T S
Sbjct: 150 AFAPHTSSRMVTGAGDNTARIWDCDT---QTPMHTLKGHFNWVLCVAWSP-DGEVIATGS 205

Query: 236 EDNTLIIHDTNSD-------RAIQKLSVSSAFNTLAFSK-RSENLLAAAGTDSNVYLYD- 286
            DNT+ + D  +        R   K   S ++  +   K  S+  LA++  D  + ++D 
Sbjct: 206 MDNTIRLWDPKTGECLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDT 265

Query: 287 LRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIG 335
           + R+ +  ++M+GH +SV+ +++     GLL S   DR + +WD+ + G
Sbjct: 266 VSRVCQ--YTMSGHTNSVSCVKWGGQ--GLLYSGSHDRTVRVWDMNSQG 310

>SAKL0F11506g Chr6 complement(894080..895786) [1707 bp, 568 aa] {ON}
           similar to uniprot|P21304 Saccharomyces cerevisiae
           YLR196W PWP1
          Length = 568

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 79/171 (46%), Gaps = 9/171 (5%)

Query: 166 SYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDI-VNDCKWH 224
           ++H +    L+ N      L S S D TV LWD+ +    +      +H +  V+  +WH
Sbjct: 276 THHTDAVLSLSHNRHFRAVLASTSADHTVKLWDLNNGI--AARSIASIHNNKNVSSSQWH 333

Query: 225 EFQSSLFGTVSEDNTLIIHDTN--SDRAIQKL-SVSSAFNTLAFSKRSENLLAAAGTDSN 281
               S+  T   D+ + + D     D A+ K  SV +     +    SEN++       N
Sbjct: 334 STDGSILLTGGYDSRVAVSDVRIADDSAMSKYWSVMAGEEIESVRFASENVIMCGTDSGN 393

Query: 282 VYLYDLRRLQ--KPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRII-MW 329
           VY +D+R  +  KPL ++  H+  ++SL+ + H   +L +S    +++ +W
Sbjct: 394 VYSFDIRNGEGSKPLWTLKAHDAGISSLDVNQHVPNMLATSAMGEKVVKLW 444

>YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integral
           subunit of the pre-mRNA cleavage and polyadenylation
           factor (CPF) complex; plays an essential role in mRNA
           3'-end formation by bridging different processing
           factors and thereby promoting the assembly of the
           processing complex
          Length = 465

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 92/216 (42%), Gaps = 18/216 (8%)

Query: 121 HEQEVTRARYMPQSPNIIATLNGAGIVYIFDRN---IKEKDHGAIASFSYHKENGYGLAF 177
           H+  VT  +Y   S  +I+  +  G++ I+  N   +KE D       + H E+   +AF
Sbjct: 134 HDSAVTTMKYSHDSDWMISG-DADGMIKIWQPNFSMVKEID-------AAHTESIRDMAF 185

Query: 178 NPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSED 237
           +   S + ++ SDD  + +W+ +   N    +    H   V  C WH  +  L  + S+D
Sbjct: 186 SSNDS-KFVTCSDDNILKIWNFS---NGKQERVLSGHHWDVKSCDWHP-EMGLIASASKD 240

Query: 238 NTLIIHDTNSDRAIQK-LSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHS 296
           N + + D  S   I   L          F     NLL A   D +  ++D+R   K L  
Sbjct: 241 NLVKLWDPRSGNCISSILKFKHTVLKTRFQPTKGNLLMAISKDKSCRVFDIRYSMKELMC 300

Query: 297 MAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLF 332
           +    D +T LE+ P  + + T +  D  +  +DL 
Sbjct: 301 VRDETDYMT-LEWHPINESMFTLACYDGSLKHFDLL 335

>KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]
           {ON} similar to uniprot|P42841 Saccharomyces cerevisiae
           YNL317W PFS2 Integral subunit of the pre-mRNA cleavage
           and polyadenylation factor (CPF) complex plays an
           essential role in mRNA 3'-end formation by bridging
           different processing factors and thereby promoting the
           assembly of the processing complex
          Length = 451

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 56/237 (23%), Positives = 101/237 (42%), Gaps = 20/237 (8%)

Query: 168 HKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQ 227
           H +   G++F+ T S + ++ SDD  + +W+ ++   +S   T   H   V  C WH   
Sbjct: 166 HTQCIRGISFSGTDS-KFVTCSDDNILKIWNFSNGQQES---TLTGHHWDVRSCDWHPTM 221

Query: 228 SSLFGTVSEDNTLIIHDTNSDRAIQK-LSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYD 286
             L  + S+DN + + D  S + I   L       +  F     N+LA    D +  ++D
Sbjct: 222 G-LIASGSKDNLIKLWDPRSGQCISTILGCKHTIISTKFQPTKGNMLAVISKDKSCRVFD 280

Query: 287 LRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDG 346
           +R+  K L ++   E    SL + P  + + T    D  +  +DL      Q+P D+  G
Sbjct: 281 IRQNMKEL-AVYRDESDYMSLTWHPINESIFTVGCYDGSMKHFDLM-----QEPQDSSSG 334

Query: 347 VPELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENVLQIWKPANKIVRPPQPPADFD 403
                 +   H   +   ++N  V  ++ S  ++  ++ W  +    RP  P A FD
Sbjct: 335 C--FHNIPYAHDKCITSLAYNP-VGHILASASKDRTIRFWTRS----RPLDPNA-FD 383

>Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 63/249 (25%), Positives = 98/249 (39%), Gaps = 63/249 (25%)

Query: 179 PTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDN 238
           P    +L S+S DGT+ +WD   T ++    T   HT+ V+  KW      L  + S D 
Sbjct: 245 PGSKPRLASSSKDGTIKIWD---TVSRVCQYTMSGHTNSVSCVKWG--GQGLLYSGSHDR 299

Query: 239 TLIIHDTNSD-RAIQ------------KLSVSSAFNTLAF---SKR-------------- 268
           T+ + D NS  R I              LS   A    AF    KR              
Sbjct: 300 TVRVWDINSQGRCINILKSHAHWVNHLSLSTDYALRVGAFDHTGKRPSTPEDAQKKALEN 359

Query: 269 ----------SENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDG-LL 317
                     SE ++  A  D  ++L++  +  KP+  M GH+  V  + FSP  DG  +
Sbjct: 360 YEKICKKNGNSEEMMVTASDDFTMFLWNPLKSTKPVARMTGHQKLVNHVAFSP--DGRYI 417

Query: 318 TSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPWLMCSV 377
            S+  D  I +W            D  DG  +      GH + V + + +S+   L+ S 
Sbjct: 418 VSASFDNSIKLW------------DGRDG--KFISTFRGHVASVYQVAWSSDCR-LLVSC 462

Query: 378 EEENVLQIW 386
            ++  L++W
Sbjct: 463 SKDTTLKVW 471

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 81/169 (47%), Gaps = 17/169 (10%)

Query: 176 AFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVS 235
           AF P  S ++++ + D T  +WD  +   ++P  T   H + V    W      +  T S
Sbjct: 150 AFAPHTSSRMVTGAGDNTARIWDCDT---QTPMHTLKGHYNWVLCVSWSP-DGEVIATGS 205

Query: 236 EDNTLIIHDTNSD-------RAIQKLSVSSAFNTLAFSK-RSENLLAAAGTDSNVYLYD- 286
            DNT+ + D  +        R   K   S ++  +   K  S+  LA++  D  + ++D 
Sbjct: 206 MDNTIRLWDPKTGECLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDT 265

Query: 287 LRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIG 335
           + R+ +  ++M+GH +SV+ +++     GLL S   DR + +WD+ + G
Sbjct: 266 VSRVCQ--YTMSGHTNSVSCVKWGGQ--GLLYSGSHDRTVRVWDINSQG 310

>NDAI0J01040 Chr10 (238940..240136) [1197 bp, 398 aa] {ON} Anc_8.316
           YDR142C
          Length = 398

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 104/206 (50%), Gaps = 33/206 (16%)

Query: 143 GAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTST 202
           G G + +FD N+++     IA F  HK+      +N       LS+S DG V +W   ST
Sbjct: 81  GDGSLRLFDINLQKY---PIAIFKEHKKEVLSCNWNLINKNLFLSSSWDGDVKVW---ST 134

Query: 203 ANKSPSQTFD-VHTD---IVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSS 258
           A ++   T   +HTD   IVN       +S++  +++  +  I+H  ++  AI++   S+
Sbjct: 135 ARQASLITLSPIHTDPTAIVNT------KSNINPSLNNVSQPILHPRST--AIRQPVTSA 186

Query: 259 AF------NTL---AFSKRSENLLAAAGTDSNVYLYDLRR----LQKPLHSMAGHEDSVT 305
           +       N +    FS    N++A     S + L+DLR+    +Q+ + + +G+E    
Sbjct: 187 SMQGNDNKNCIYQAQFSPHDPNIVACCSGTSYLTLFDLRQPTPNVQRGILTQSGYE--TL 244

Query: 306 SLEFSPHQDGLLTSSGSDRRIIMWDL 331
           +L+F+ ++  ++ +SG D+ I MWD+
Sbjct: 245 TLDFNKYRSHIIATSGVDKAIKMWDM 270

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 46/227 (20%), Positives = 82/227 (36%), Gaps = 49/227 (21%)

Query: 125 VTRARYMPQSPNIIATLNGAGIVYIFD--RNIKEKDHGAIASFSYHKENGYGLAFNPTVS 182
           + +A++ P  PNI+A  +G   + +FD  +       G +    Y       L FN   S
Sbjct: 197 IYQAQFSPHDPNIVACCSGTSYLTLFDLRQPTPNVQRGILTQSGYET---LTLDFNKYRS 253

Query: 183 GQLLSASDDGTVALWD-----------------VTSTANKSP-SQTFDVHTDIVNDCKWH 224
             + ++  D  + +WD                 + S   + P ++  + H   V   KW 
Sbjct: 254 HIIATSGVDKAIKMWDMRFIPSTFSPQSTSTTPILSRRQQEPINEIINAHDLAVKTIKWS 313

Query: 225 EFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYL 284
              S+L  + S D T     T  D + Q  + +   N+L                     
Sbjct: 314 PHHSNLMVSTSYDMTC---KTWMDISYQNGTSNGRTNSL--------------------- 349

Query: 285 YDLRRLQKPLHSMAGHEDSVTSLEFSP-HQDGLLTSSGSDRRIIMWD 330
            D +R    L  M  H +    +++S   Q G + S+G D  + +W+
Sbjct: 350 -DPQRRNGCLAIMDKHSEFAFGVDWSLWGQPGFIASTGWDGNVFIWN 395

>KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {ON}
           highly similar to uniprot|P25382 Saccharomyces
           cerevisiae YCR072C Protein required for cell viability
          Length = 514

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 62/244 (25%), Positives = 96/244 (39%), Gaps = 63/244 (25%)

Query: 184 QLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIH 243
           +L SAS DGT+ +WD   TA +    T   HT+ V+  KW      +  + S D T+   
Sbjct: 249 RLASASKDGTIKIWD---TARRVCLFTLSGHTNSVSCVKWG--GRGVLYSGSHDKTIRAW 303

Query: 244 DTNSDRA-----------IQKLSVSS--AFNTLAF------------------------- 265
           D N+              I  LS+S+  A    AF                         
Sbjct: 304 DMNAGGKCINILKSHAHWINHLSLSTDYALRVGAFDHTGKKPSSPEEARAKALENYEKIA 363

Query: 266 --SKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDG-LLTSSGS 322
             + + E L+  A  D  +YL+D  +  KP+  M GH+  V  + FSP  DG  + S+  
Sbjct: 364 KKNGKLEELMVTASDDFTMYLWDPIKSTKPITRMTGHQKLVNHVAFSP--DGRYIVSASF 421

Query: 323 DRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENV 382
           D  I +W            D  DG         GH + V + + +S+   L+ S  ++  
Sbjct: 422 DNSIKLW------------DGRDGT--FIATFRGHVASVYQVAWSSDCR-LLVSCSKDTT 466

Query: 383 LQIW 386
           L++W
Sbjct: 467 LKVW 470

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 79/170 (46%), Gaps = 16/170 (9%)

Query: 176 AFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVS 235
           AF P  S ++++ + D T  +WD  +    +P QT   H + V    W      L  T S
Sbjct: 149 AFAPHTSSRMVTGAGDNTARIWDCNTN---TPMQTLKGHFNWVLCVAWSP-DGELIATGS 204

Query: 236 EDNTLIIHDT-------NSDRAIQKLSVSSAFNTLAFSKRSEN-LLAAAGTDSNVYLYDL 287
            DNT+ +  +       ++ R   K   S ++  +   K  +   LA+A  D  + ++D 
Sbjct: 205 MDNTIRLWQSEKGENFGDALRGHSKWITSLSWEPIHLVKPGDKPRLASASKDGTIKIWDT 264

Query: 288 RRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAE 337
            R +  L +++GH +SV+ +++     G+L S   D+ I  WD+ N G +
Sbjct: 265 AR-RVCLFTLSGHTNSVSCVKWGGR--GVLYSGSHDKTIRAWDM-NAGGK 310

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 73/149 (48%), Gaps = 13/149 (8%)

Query: 185 LLSASDDGTVALWD-VTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIH 243
           +++ASDD T+ LWD + ST    P      H  +VN   +         + S DN++ + 
Sbjct: 373 MVTASDDFTMYLWDPIKST---KPITRMTGHQKLVNHVAFSP-DGRYIVSASFDNSIKLW 428

Query: 244 DTNSDRAIQKLS--VSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHE 301
           D      I      V+S +  +A+S     LL +   D+ + ++D+ R +K    + GH+
Sbjct: 429 DGRDGTFIATFRGHVASVYQ-VAWSSDCR-LLVSCSKDTTLKVWDV-RTKKLSVDLPGHK 485

Query: 302 DSVTSLEFSPHQDG-LLTSSGSDRRIIMW 329
           D V ++++S   DG  + S+G D+ + +W
Sbjct: 486 DEVYTVDWS--VDGKRVCSAGKDKMVRIW 512

>KNAG0B02580 Chr2 (501215..502957) [1743 bp, 580 aa] {ON} Anc_7.356
           YLR196W
          Length = 580

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 79/168 (47%), Gaps = 10/168 (5%)

Query: 166 SYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFD-VHTDI-VNDCKW 223
           ++H +    LA N      L S S D TV LWD+    N S  ++FD +H+   V+  +W
Sbjct: 276 THHTDAVLSLAHNKLFRSVLASTSADHTVKLWDLN---NASVVRSFDSIHSGKNVSASEW 332

Query: 224 HEFQSSLFGTVSEDNTLIIHDTNSDRA---IQKLSVSSAFNTLAFSKRSENLLAAAGTDS 280
           H+   S+  T   D+ + + D  S+ A    +  SVSS     + +   EN++       
Sbjct: 333 HQSNGSILLTAGYDSRIALTDVRSNDAKNLSKYWSVSSGEEIESATFVDENIILCGTDTG 392

Query: 281 NVYLYDLRR--LQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRI 326
           NVY +D+R     K + ++  H+  +++L  +    GLLT+     ++
Sbjct: 393 NVYSFDIRNNAESKSVWTLKAHDSGISALAVNKFVPGLLTTGAMGDKV 440

>YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}
           RSA4WD-repeat protein involved in ribosome biogenesis;
           may interact with ribosomes; required for maturation and
           efficient intra-nuclear transport or pre-60S ribosomal
           subunits, localizes to the nucleolus
          Length = 515

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 61/250 (24%), Positives = 97/250 (38%), Gaps = 63/250 (25%)

Query: 178 NPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSED 237
            P    +L S+S DGT+ +WD   T ++    T   HT+ V+  KW      L  + S D
Sbjct: 244 KPGSKPRLASSSKDGTIKIWD---TVSRVCQYTMSGHTNSVSCVKWG--GQGLLYSGSHD 298

Query: 238 NTLIIHDTNSD-RAIQ------------KLSVSSAFNTLAF------------------- 265
            T+ + D NS  R I              LS   A    AF                   
Sbjct: 299 RTVRVWDINSQGRCINILKSHAHWVNHLSLSTDYALRIGAFDHTGKKPSTPEEAQKKALE 358

Query: 266 --------SKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDG-L 316
                   +  SE ++  A  D  ++L++  +  KP+  M GH+  V  + FSP  DG  
Sbjct: 359 NYEKICKKNGNSEEMMVTASDDYTMFLWNPLKSTKPIARMTGHQKLVNHVAFSP--DGRY 416

Query: 317 LTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPWLMCS 376
           + S+  D  I +W            D  DG  +      GH + V + + +S+   L+ S
Sbjct: 417 IVSASFDNSIKLW------------DGRDG--KFISTFRGHVASVYQVAWSSDCR-LLVS 461

Query: 377 VEEENVLQIW 386
             ++  L++W
Sbjct: 462 CSKDTTLKVW 471

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 82/169 (48%), Gaps = 17/169 (10%)

Query: 176 AFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVS 235
           AF P  S ++++ + D T  +WD  +   ++P  T   H + V    W      +  T S
Sbjct: 150 AFAPHTSSRMVTGAGDNTARIWDCDT---QTPMHTLKGHYNWVLCVSWSP-DGEVIATGS 205

Query: 236 EDNTLIIHDTNSDRAI-------QKLSVSSAFNTLAFSK-RSENLLAAAGTDSNVYLYD- 286
            DNT+ + D  S + +        K   S ++  +   K  S+  LA++  D  + ++D 
Sbjct: 206 MDNTIRLWDPKSGQCLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDT 265

Query: 287 LRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIG 335
           + R+ +  ++M+GH +SV+ +++     GLL S   DR + +WD+ + G
Sbjct: 266 VSRVCQ--YTMSGHTNSVSCVKWGGQ--GLLYSGSHDRTVRVWDINSQG 310

>Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa]
           {ON} complement(166721..169273) [2553 nt, 851 aa]
          Length = 850

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 57/233 (24%), Positives = 113/233 (48%), Gaps = 20/233 (8%)

Query: 126 TRARYMPQSPNIIATLNGAGIVYIF----DRNIK---EKDHGAIASFSYHKENGYGLAFN 178
           T   ++  S  + +T   AG  Y+     D+ ++    +D   + S+  H++  + + F+
Sbjct: 566 TCKTFIGHSGTVYSTSFSAGDEYLLSASEDKTVRLWSVQDDKPLVSYKGHEKPVWDVEFS 625

Query: 179 PTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDN 238
           P+ +    +AS+D T  LW   S     P +    H + V+   +H     +F T S D 
Sbjct: 626 PSCNNLFATASNDQTARLW---SCDRVYPLRVMAGHLNDVDCVSFHSNGRYIF-TGSSDK 681

Query: 239 TLIIHDTNSDRAIQK-LSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSM 297
           T+ + D N+  +++  +  +S   +L+ S   +  ++    D  + ++D+   +K L +M
Sbjct: 682 TVRMWDINTGDSVRLFMGHNSTVTSLSVSPDGK-WISTGSDDGIITIWDIGSGRK-LKNM 739

Query: 298 AGH-EDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQ---QPDDAYDG 346
            GH + S+ SL ++P +  LL S G+D+ + +WDL N G  +    P++ Y G
Sbjct: 740 RGHGKSSIHSLSYNP-EGTLLVSGGADQSVRVWDL-NKGTFEPSLTPEEVYQG 790

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 60/123 (48%), Gaps = 17/123 (13%)

Query: 264 AFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSD 323
           +FS   E LL+A+  D  V L+ ++   KPL S  GHE  V  +EFSP  + L  ++ +D
Sbjct: 581 SFSAGDEYLLSAS-EDKTVRLWSVQD-DKPLVSYKGHEKPVWDVEFSPSCNNLFATASND 638

Query: 324 RRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENVL 383
           +   +W             + D V  L +M  GH + V+  S +SN  ++     ++ V 
Sbjct: 639 QTARLW-------------SCDRVYPLRVM-AGHLNDVDCVSFHSNGRYIFTGSSDKTV- 683

Query: 384 QIW 386
           ++W
Sbjct: 684 RMW 686

>Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C
           (REAL)
          Length = 523

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 64/333 (19%), Positives = 124/333 (37%), Gaps = 87/333 (26%)

Query: 22  SNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLRQELLIGTLTTDNEPNYLKI 81
           SN  + ++ V +  + +P   +QW+P+++ PR++                          
Sbjct: 160 SNDLLSWENVVDADVVYPVSKIQWVPSQLHPRKL-------------------------- 193

Query: 82  AAIDLPENVTSSKPSVSDDAKENELSHRQSKIKIVRKFKHEQEVTRARYMPQSPNIIATL 141
                         + SD  +   ++H +      R+F+ +  ++  +Y  Q P   A  
Sbjct: 194 -------------ATCSDSLRIWNVNHEE------RQFQEQINLSLCKYNRQHPANPAAT 234

Query: 142 NGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTS 201
           +   ++  F           I SF +          N   +  ++S+S D T  +WD+ S
Sbjct: 235 DDMKVIGTFP---------PITSFDW----------NMVDTNLIISSSIDTTCIVWDLQS 275

Query: 202 TANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDT---------------- 245
           +           H   V D ++    + LF +   D ++ + D                 
Sbjct: 276 S--HYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPASS 333

Query: 246 ----NSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSN-VYLYDLRRLQKPLHSMAGH 300
               N+D        S A   L  S    N+LA    +SN + + D+R  + P+ ++ GH
Sbjct: 334 APGLNADTTTPASKGSDALLRLEPSPYDPNVLATFAAESNKIIILDMRNPESPILNLEGH 393

Query: 301 EDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFN 333
             SV  +++ P +  +L S G D +++ WDL N
Sbjct: 394 SSSVNEIKWHPTKRNVLLSCGDDCQVLYWDLNN 426

>KNAG0B02800 Chr2 (537056..540979) [3924 bp, 1307 aa] {ON} Anc_7.310
           YDL195W gene spans a gap in the genome sequence
          Length = 1307

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 52/225 (23%), Positives = 91/225 (40%), Gaps = 52/225 (23%)

Query: 120 KHEQEVTRARYMPQSPNIIATLNGAGIVYIFDRN---IKEKDHGAIASFSYHKENGYGLA 176
           KH   VT+AR+     NI+AT +  G + I+D N    K +  G +++++          
Sbjct: 108 KHAGAVTQARFHSLQSNILATGDSKGGILIWDTNKCLTKAQGGGVVSTYT---------- 157

Query: 177 FNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSE 236
                   +L A              ANKS  +        V    W++ Q+ +F + + 
Sbjct: 158 -------PMLPA--------------ANKSSEEP-------VQCLAWNKKQAHIFASTNS 189

Query: 237 DNTLIIHDTNSDRAIQKLSVSSAFNTLA--------FSKRSENLLAAAGTDSN--VYLYD 286
            +   I D  + + +  LS +S    L            +S  +    G D+   V ++D
Sbjct: 190 TSFASIWDLKAKKDVLHLSYTSPLTGLKPQLSVVEWHPDQSTYVATGTGNDTGPVVVVWD 249

Query: 287 LRRLQKPLHSM-AGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWD 330
           LR    PL  +  GH   + SL++    + LL SSG D  +++W+
Sbjct: 250 LRNANTPLQELTGGHSKGILSLDWCQQDETLLLSSGRDNSVVLWN 294

>ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability
          Length = 515

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 80/177 (45%), Gaps = 15/177 (8%)

Query: 163 ASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCK 222
           A+ + H       AF P  S ++++ + D T  +WD    A ++P      H++ V    
Sbjct: 137 AAIAGHGSTILCSAFAPDTSSRMVTGAGDNTARIWDC---ATQTPLSVLKGHSNWVLCVA 193

Query: 223 WHEFQSSLFGTVSEDNTLIIHDTNSD-------RAIQKLSVSSAFNTLAFSKRSEN-LLA 274
           W      L  T S DNT+ + ++ +        +   K   S  +  L      +   LA
Sbjct: 194 WSP-DGELIATGSMDNTIRLWESKAGKPWGDAMKGHSKWITSLTWEPLHLVAAGDKPRLA 252

Query: 275 AAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
           +A  D  + ++D  R +  L++++GH +SV+ +++     GLL +   D+ I +WD+
Sbjct: 253 SASKDGTIKIWDASR-RTCLYTLSGHTNSVSCVKWG--GQGLLYTGSHDKTIRVWDI 306

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 57/244 (23%), Positives = 96/244 (39%), Gaps = 63/244 (25%)

Query: 184 QLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIH 243
           +L SAS DGT+ +WD +    ++   T   HT+ V+  KW      L  T S D T+ + 
Sbjct: 250 RLASASKDGTIKIWDAS---RRTCLYTLSGHTNSVSCVKWG--GQGLLYTGSHDKTIRVW 304

Query: 244 DTNSDRA-----------IQKLSVSSAF-----------------------------NTL 263
           D  +              +  LS+S+ +                               +
Sbjct: 305 DIKAGGKCINILKSHAHWVNHLSLSTDYAIRVGPFGPDGKASPSPQEARDIAKKNYEKVV 364

Query: 264 AFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDG-LLTSSGS 322
             S + E L+  A  D  ++L++  +  KPL  M GH+  V  + FSP  DG  + S+  
Sbjct: 365 RKSGQVEELMVTASDDFTMFLWNPLKSAKPLARMTGHQKLVNHVAFSP--DGRYIVSASF 422

Query: 323 DRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENV 382
           D  I +W            D  DG  +      GH + V + + +S+   L+ S  ++  
Sbjct: 423 DNSIKLW------------DGRDG--KFIATFRGHVASVYQVAWSSDCR-LLVSCSKDTT 467

Query: 383 LQIW 386
           L++W
Sbjct: 468 LKVW 471

>NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283
          Length = 389

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 54/206 (26%), Positives = 95/206 (46%), Gaps = 20/206 (9%)

Query: 171 NGYGLAFNPTVSGQ--LLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKW--HEF 226
           N + L   P   G   LL++  +G V   D ++       Q +++    +ND +   H  
Sbjct: 16  NNWALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTTI---QKYNISETSINDLQLINHNP 72

Query: 227 QSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGT-----DSN 281
            SS   T +  N++ I D +S + +   ++ S  N    S  S + L A GT     D+ 
Sbjct: 73  TSSPLFTTATSNSVKIFDIHSTKEVA--TIHSQGNVPFPSLDSRHGLLACGTELKGVDAA 130

Query: 282 VYLYDLRRLQKPLHSMA-GHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQP 340
           +Y+YD+R+  +P+ S+   H D VT L++ P+   +L S  +D    ++DL    +E + 
Sbjct: 131 IYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDL----SEAEE 186

Query: 341 DDAYDGVPELFMMHG-GHRSPVNEFS 365
           +D+   V     +H  G  SP   F+
Sbjct: 187 EDSLHQVINFASIHSCGWLSPRRIFT 212

>Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {ON}
           YPL151C (REAL)
          Length = 451

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 45/157 (28%), Positives = 79/157 (50%), Gaps = 8/157 (5%)

Query: 176 AFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVS 235
           A +P  +   ++ S+D T+ +WD+ S   K    T   H   V D    +    LF +VS
Sbjct: 146 AIDPVDNEWFVTGSNDTTMKVWDLASGKLKV---TLTGHVMTVRDIAVSDRHPYLF-SVS 201

Query: 236 EDNTLIIHDTNSDRAIQKLSVS-SAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPL 294
           ED T+   D   ++ I+      S   T++    + +L+A AG DS V L+D+ R + P+
Sbjct: 202 EDKTVKCWDLEKNQIIRDYHGHLSGVRTVSIHP-TLDLIATAGRDSVVKLWDI-RTRVPV 259

Query: 295 HSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
            ++ GH+  +  +E +P  D  + SS +D  + +WD+
Sbjct: 260 ITLVGHKGPINQVECAP-VDPQIVSSSTDATVRLWDI 295

>SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some
           similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 660

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 52/217 (23%), Positives = 96/217 (44%), Gaps = 17/217 (7%)

Query: 175 LAFNPTVSGQLLS-ASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGT 233
           + F+P   G+ L+  ++D  + +WD+++   K    T   H   +    +      L  +
Sbjct: 384 VCFSP--DGKFLATGAEDKLIRIWDLST---KRIVMTLQGHEQDIYSLDYFPSGDKLV-S 437

Query: 234 VSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYD------L 287
            S D T+ I D  + +    LS+     T+A S      +AA   D  + ++D      +
Sbjct: 438 GSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTLRVWDSETGFLV 497

Query: 288 RRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGS-DRRIIMWDLFNIGAEQQPDDAYDG 346
            RL        GH+DSV S+ F+  +DG    SGS DR + +W+L N G+  + +D+   
Sbjct: 498 ERLDSENELGTGHKDSVYSVVFT--RDGQGVVSGSLDRSVKLWNLHNTGSSSK-NDSKPT 554

Query: 347 VPELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENVL 383
                + + GH+  V   +   N  +++   ++  VL
Sbjct: 555 AATCEVTYTGHKDFVLSVATTQNDKYILSGSKDRGVL 591

>Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON}
           (100720..102258) [1539 nt, 513 aa]
          Length = 512

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 62/244 (25%), Positives = 102/244 (41%), Gaps = 63/244 (25%)

Query: 184 QLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIH 243
           +L ++S DGT+ +WD T    +  + T   HT  V+  KW   Q+ L+ + S D T+ + 
Sbjct: 247 RLATSSKDGTIKIWDTT---RRVCTMTLSGHTSSVSCVKWGG-QNFLY-SGSHDKTVRVW 301

Query: 244 D-TNSDRAIQ----------KLSVSSAF--------------------------NTLAFS 266
           D  NS R I            LS+S+ +                          N    +
Sbjct: 302 DMKNSGRCINILKNHAHWVNHLSLSTDYALRVGPFDYTGEQPATPEIAKAKALKNYEKVA 361

Query: 267 KRSEN---LLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGL-LTSSGS 322
           KR+     L+  A  D  ++L+D  R  KP+  M GH+  V  + FSP  DG  + S+  
Sbjct: 362 KRNGKETELMVTASDDFTMFLWDPLRTTKPIARMTGHQKLVNHVAFSP--DGRHIVSASF 419

Query: 323 DRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENV 382
           D  I +W            D+ DG  +      GH + V + + +S+   L+ S  ++  
Sbjct: 420 DNSIKLW------------DSRDG--KFITTFRGHVASVYQVAWSSDCR-LLVSCSKDTT 464

Query: 383 LQIW 386
           L++W
Sbjct: 465 LKVW 468

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 73/168 (43%), Gaps = 15/168 (8%)

Query: 176 AFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVS 235
           AF P  S ++++ + D T  +WD  +   ++P  T   H + V    W      L  T S
Sbjct: 147 AFAPHTSSRMVTGAGDNTARIWDCDT---QTPMATLTGHHNWVLCVSWSP-DGELIATGS 202

Query: 236 EDNTLIIHDTNSD-------RAIQKLSVSSAFNTLAFSKRSEN-LLAAAGTDSNVYLYDL 287
            DNT+ + ++ +        R   K   S ++  +      E   LA +  D  + ++D 
Sbjct: 203 MDNTVRLWESKTGKPFGDALRGHGKWITSLSWEPIHLVTPGERPRLATSSKDGTIKIWDT 262

Query: 288 RRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIG 335
            R    + +++GH  SV+ +++       L S   D+ + +WD+ N G
Sbjct: 263 TRRVCTM-TLSGHTSSVSCVKWGGQN--FLYSGSHDKTVRVWDMKNSG 307

>KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.340
           YCR072C
          Length = 515

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 85/171 (49%), Gaps = 18/171 (10%)

Query: 176 AFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVS 235
           AF P  S ++++ + D T  +WD  +   ++P  T   H + V    W      +  T S
Sbjct: 150 AFAPHTSSRMVTGAGDNTARIWDCDT---QTPMTTLTGHQNWVLCVSWSP-DGEIIATGS 205

Query: 236 EDNTLIIHDTNSDRAIQ-------KLSVSSAFNTLAFSKRSEN-LLAAAGTDSNVYLYD- 286
            DNT+ + +++  + +        K   S ++  L   K  E   LA+A  D  + ++D 
Sbjct: 206 MDNTIRLWESDRGKPLGEPLRGHLKWITSLSWEPLHLVKAGEKPRLASASKDGTIKIWDT 265

Query: 287 LRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAE 337
           +RR+   +++++GH +SV+ +++     G+L S   D+ + +WD+ N+G +
Sbjct: 266 VRRVC--VYTLSGHTNSVSCVKWG--GQGVLYSGSHDKTVRVWDM-NLGGK 311

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 59/244 (24%), Positives = 97/244 (39%), Gaps = 63/244 (25%)

Query: 184 QLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIH 243
           +L SAS DGT+ +WD   T  +    T   HT+ V+  KW   Q  L+ + S D T+ + 
Sbjct: 250 RLASASKDGTIKIWD---TVRRVCVYTLSGHTNSVSCVKWGG-QGVLY-SGSHDKTVRVW 304

Query: 244 DTNSDRA-----------IQKLSVSSAF-----------------------------NTL 263
           D N               +  LS+S+ +                               +
Sbjct: 305 DMNLGGKCINILKNHAHWVNHLSLSTDYALRRGPFDHTGTKMASPEEAREKALKNYEKVV 364

Query: 264 AFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDG-LLTSSGS 322
             +  +E L+  A  D  ++L++  +  KPL  M GH+  V  + FSP  DG  + S+  
Sbjct: 365 KKNGTTEELMVTASDDFTMFLWNPLKSNKPLARMTGHQKLVNHVAFSP--DGRYIVSASF 422

Query: 323 DRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENV 382
           D  I +W            D  DG  +      GH S V + + +S+   L+ S  ++  
Sbjct: 423 DNSIKLW------------DGRDG--KFLSTFRGHVSSVYQVAWSSDCR-LLVSCSKDTT 467

Query: 383 LQIW 386
           L++W
Sbjct: 468 LKVW 471

 Score = 37.4 bits (85), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 75/155 (48%), Gaps = 11/155 (7%)

Query: 178 NPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSED 237
           N T    +++ASDD T+ LW+    +NK P      H  +VN   +         + S D
Sbjct: 367 NGTTEELMVTASDDFTMFLWNPLK-SNK-PLARMTGHQKLVNHVAFSP-DGRYIVSASFD 423

Query: 238 NTLIIHDTNSDRAIQKLS--VSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLH 295
           N++ + D    + +      VSS +  +A+S     LL +   D+ + ++D+ R +K   
Sbjct: 424 NSIKLWDGRDGKFLSTFRGHVSSVYQ-VAWSSDCR-LLVSCSKDTTLKVWDV-RTRKLSV 480

Query: 296 SMAGHEDSVTSLEFSPHQDG-LLTSSGSDRRIIMW 329
            + GH+D V ++++S   DG  + S G D+ I +W
Sbjct: 481 DLPGHQDEVYTVDWS--VDGKRVCSGGKDKMIRLW 513

>CAGL0B01529g Chr2 (137174..138283) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P39108 Saccharomyces cerevisiae
           YDR142c PAS7 peroxisomal import protein -peroxin
          Length = 369

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 65/248 (26%), Positives = 103/248 (41%), Gaps = 54/248 (21%)

Query: 128 ARYMPQSPNIIAT-------LNGAGIVYIF--DRN--IKEKDHGAIASFSYHKENGYGLA 176
            +Y P   NI+A        L G G ++I   D N  +KEK+     SF   K+  +  A
Sbjct: 14  VQYSPYYDNILAVNTGSNFGLVGNGKLFILEIDNNGVVKEKN-----SF-LTKDCLFDSA 67

Query: 177 FNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSE 236
           +N     Q++ A  DG++ L+D  +T  K P   F  H+  V  C W+    S F + S 
Sbjct: 68  WNELKPNQVVVAQGDGSLRLFD--TTLQKFPIAMFHEHSKEVYSCNWNLVSKSNFVSSSW 125

Query: 237 DNTLIIHDTNSDRAIQKLS-----VSSAFNTL------------------------AFSK 267
           D  + I   N   ++   S     VS A + L                         FS 
Sbjct: 126 DGQVKIWSPNRKASLITFSPHPIDVSRALDNLPEVSQRDKLSPNQVAQNRNCIYQATFSP 185

Query: 268 RSENLLAAAGTDSNVYLYDLRRLQKPLHS----MAGHEDSVTSLEFSPHQDGLLTSSGSD 323
             +NL+     +S V L+DLR  Q P ++    +A       S +F+ ++  ++ +SG D
Sbjct: 186 HDDNLILCCAGNSYVTLFDLR--QNPGNNQKNFIAHRGKGALSCDFNKYRPNIIATSGVD 243

Query: 324 RRIIMWDL 331
             I +WD+
Sbjct: 244 NSIGIWDI 251

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 50/238 (21%), Positives = 96/238 (40%), Gaps = 48/238 (20%)

Query: 135 PNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQLLSASDDGTV 194
           PN +    G G + +FD  +++     IA F  H +  Y   +N       +S+S DG V
Sbjct: 73  PNQVVVAQGDGSLRLFDTTLQKF---PIAMFHEHSKEVYSCNWNLVSKSNFVSSSWDGQV 129

Query: 195 ALW----------------DVTSTANKSP--SQTFDVHTDIVNDCKWHEFQSSLFGTVSE 236
            +W                DV+   +  P  SQ   +  + V   +   +Q++   +  +
Sbjct: 130 KIWSPNRKASLITFSPHPIDVSRALDNLPEVSQRDKLSPNQVAQNRNCIYQATF--SPHD 187

Query: 237 DNTLIIHDTNSDRAIQKLSVSSAFN-------------TLAFSKRSENLLAAAGTDSNVY 283
           DN ++    NS   +  L  +   N             +  F+K   N++A +G D+++ 
Sbjct: 188 DNLILCCAGNSYVTLFDLRQNPGNNQKNFIAHRGKGALSCDFNKYRPNIIATSGVDNSIG 247

Query: 284 LYDLRRL-----QKPLHS-------MAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMW 329
           ++D+R L     Q+   +       +  H+ +V  + +SPH   +L S+  D    +W
Sbjct: 248 IWDIRMLPNSSNQQGFQTGTLVNEIVNAHDLAVKKVCWSPHHSDILLSTSYDMSCKIW 305

>ZYRO0F05808g Chr6 complement(479060..482908) [3849 bp, 1282 aa]
           {ON} similar to uniprot|P38968 Saccharomyces cerevisiae
           YDL195W SEC31 involved in protein transport from
           endoplasmic reticulum to Golgi Component (p150) of COPII
           coat of secretory pathway vesicles
          Length = 1282

 Score = 53.1 bits (126), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 50/211 (23%), Positives = 86/211 (40%), Gaps = 19/211 (9%)

Query: 137 IIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQLLSASDDGTVAL 196
           IIA     G V +F  N       + A F  HK       FN      L +    G + +
Sbjct: 76  IIAGALDNGSVELFSYNADSLK--SEAKFQRHKTTAKVARFNAKQFNVLATGGTKGEIFI 133

Query: 197 WDVTSTA----NKSPSQTFDVHTDI--VNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRA 250
           WDV        + +P    +  T +  +    W++  + +F +    +   I D  + + 
Sbjct: 134 WDVNKCLENPNDYTPLTPGNSMTPVEEITSLAWNQSLAHVFASAGSTSYASIWDLKAKKE 193

Query: 251 IQKLSVSSAFNTLA--------FSKRSENLLAAAGTDSN--VYLYDLRRLQKPLHSMA-G 299
           +  LS +S    L           K S  +  A G+D++  + ++DLR    PL  ++ G
Sbjct: 194 VIHLSYTSPNTGLKAPLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPLQVLSQG 253

Query: 300 HEDSVTSLEFSPHQDGLLTSSGSDRRIIMWD 330
           H   V SL++    + LL SSG D  +++W+
Sbjct: 254 HSKGVLSLDWCNQDENLLLSSGRDNTVVLWN 284

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 38/76 (50%), Gaps = 10/76 (13%)

Query: 265 FSKRSENLLAAAGTDSNVYLYDLRRLQK---------PLHSMAGHEDSVTSLEFSPHQDG 315
           F+ +  N+LA  GT   ++++D+ +  +         P +SM   E+ +TSL ++     
Sbjct: 114 FNAKQFNVLATGGTKGEIFIWDVNKCLENPNDYTPLTPGNSMTPVEE-ITSLAWNQSLAH 172

Query: 316 LLTSSGSDRRIIMWDL 331
           +  S+GS     +WDL
Sbjct: 173 VFASAGSTSYASIWDL 188

>YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           and nucleus; similar to the petunia WD repeat protein
           an11; overexpression causes a cell cycle delay or arrest
          Length = 523

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 68/302 (22%), Positives = 122/302 (40%), Gaps = 58/302 (19%)

Query: 117 RKFKHEQEVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLA 176
           R+F+ +  ++  +Y  Q P   A  +   ++  F           I SF +         
Sbjct: 210 RQFQEQINLSLCKYNRQHPANPAAADDMKVIGTFP---------PITSFDW--------- 251

Query: 177 FNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSE 236
            N   +  ++S+S D T  +WD+ S+           H   V D ++    + LF +   
Sbjct: 252 -NTVDTNLIISSSIDTTCIVWDLQSS--HYVKTQLIAHDSEVFDVRFLTKSTQLFASCGG 308

Query: 237 DNTLIIHDTNS--------DRAIQKLSVSSAFNTLAFSKRSE------------NLLAAA 276
           D ++ + D  S        +     +S ++A      SK S+            N+LA  
Sbjct: 309 DGSVRVFDLRSLAHSTIIYEPPSSSVSGATAGTITPSSKGSDALLRLEPSPYDPNVLATF 368

Query: 277 GTDSN-VYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL---- 331
             DSN + + D+R  + P+ ++ GH  SV  +++ P +  +L S G D +++ WDL    
Sbjct: 369 AADSNKIIILDMRNPESPILNLQGHGSSVNGIKWHPTKRNVLLSCGDDCQVLYWDLNSSF 428

Query: 332 --FNIGAEQQPD------DAYDGVPELFMMHGGHRSPVNE--FSHNSNVPWLMCSVEEEN 381
              N    + P       +  DG  E  M  GG  S +NE   S N+N   +  ++E  N
Sbjct: 429 MEINAAGSKSPSIHGTSLEDPDGDTE--MTDGGAGSGLNEDPLSLNNNSKQVCKTLETPN 486

Query: 382 VL 383
           ++
Sbjct: 487 MM 488

>TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa]
           {ON} Anc_6.340 YCR072C
          Length = 515

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 59/244 (24%), Positives = 96/244 (39%), Gaps = 63/244 (25%)

Query: 184 QLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIH 243
           +L SAS DGT+ +WD   T+ +    T   HT+ V+  KW      L  + S D T+ + 
Sbjct: 250 RLASASKDGTIKIWD---TSRRVCIYTLSGHTNSVSCVKWG--GQGLLYSGSHDKTVRVW 304

Query: 244 DTNSDRA-----------IQKLSVSSAF--------------------------NTLAFS 266
           D N               +  LS+S+ +                          N    +
Sbjct: 305 DMNVGGKCINILKSHAHWVNHLSLSTEYALRVGPFDHTATKFTSAEEARKKALENYEKIA 364

Query: 267 KR---SENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDG-LLTSSGS 322
           KR   +E L+  A  D  ++L+D  +  KPL  + GH+  V  + FSP  DG  + S+  
Sbjct: 365 KRNGKAEELIVTASDDFTMFLWDPTKSGKPLARLTGHQKLVNHVAFSP--DGRFIVSASF 422

Query: 323 DRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENV 382
           D  I +WD  N                      GH + V + + +S+   L+ S  ++  
Sbjct: 423 DNSIKLWDGRN--------------GTFISTFRGHVASVYQVAWSSDCR-LLVSCSKDTT 467

Query: 383 LQIW 386
           L++W
Sbjct: 468 LKVW 471

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 80/169 (47%), Gaps = 16/169 (9%)

Query: 177 FNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSE 236
           F P  S ++++ + D T  +WD  +   ++P  T   H + V    W         T S 
Sbjct: 151 FAPHTSSRMVTGAGDNTARVWDCDT---QTPMATLSGHQNWVLCVAWSP-DGETIATGSM 206

Query: 237 DNTLIIHDTNSDRAI-------QKLSVSSAFNTLAFSKRSEN-LLAAAGTDSNVYLYDLR 288
           D T+ + D+ + + +       QK   S  +  L   K  +   LA+A  D  + ++D  
Sbjct: 207 DCTVRLWDSKAGQPLGDALKGHQKWITSLVWEPLHLVKPGDKPRLASASKDGTIKIWDTS 266

Query: 289 RLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAE 337
           R +  +++++GH +SV+ +++     GLL S   D+ + +WD+ N+G +
Sbjct: 267 R-RVCIYTLSGHTNSVSCVKWGGQ--GLLYSGSHDKTVRVWDM-NVGGK 311

>YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON}
           Putative protein of unknown function with similarity to
           proteins containing WD-40 domains; green fluorescent
           protein (GFP)-fusion protein localizes to the nucleus;
           YNL035C is not an essential gene
          Length = 389

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 82/184 (44%), Gaps = 20/184 (10%)

Query: 162 IASFSYHKENGYG-----LAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTD 216
           +AS+S  + N +G     L   P+    LL+   +G + L D ++  +    Q       
Sbjct: 1   MASYSLVESNSFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWSTGKS---VQKIKASET 57

Query: 217 IVNDCK--WHEFQSS-LFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLL 273
            +ND K    +F +  L  + S D   +     +DR  Q   + +  N+   S  S + L
Sbjct: 58  AINDMKVIGSDFSAGHLVSSASIDAVKVFDIRTNDRIAQ---IQNEANSPFISLDSRHGL 114

Query: 274 AAAGT-----DSNVYLYDLRRLQKPLHSMA-GHEDSVTSLEFSPHQDGLLTSSGSDRRII 327
            A GT     D+ VY+YD+R+   PL S+   H D VT ++F P    +L S  +D    
Sbjct: 115 LACGTELQGIDAAVYIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTN 174

Query: 328 MWDL 331
           ++DL
Sbjct: 175 IYDL 178

>SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1140

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/140 (22%), Positives = 73/140 (52%), Gaps = 9/140 (6%)

Query: 196 LWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLS 255
           +W+++  +  +       H   + D  +H     +  T S D  ++  D    R+ Q+  
Sbjct: 95  VWNLSRNSTNAIEHILHGHFRAITDINFHPHHPEILATCSVDTYVLAWDM---RSPQRPY 151

Query: 256 VSSA-----FNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFS 310
            S++      + + ++ R+ N++A++ +D +V ++DLR+   PL+++ GHE SV +++F+
Sbjct: 152 YSTSEWRAGASQVKWNFRNSNIMASSHSD-HVCIWDLRKGCTPLYTLQGHEGSVNNIDFN 210

Query: 311 PHQDGLLTSSGSDRRIIMWD 330
             ++  + SS +D  +  WD
Sbjct: 211 KAKETEIMSSSNDGTVKFWD 230

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 11/37 (29%), Positives = 20/37 (54%)

Query: 295 HSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
           H + GH  ++T + F PH   +L +   D  ++ WD+
Sbjct: 108 HILHGHFRAITDINFHPHHPEILATCSVDTYVLAWDM 144

>SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability
          Length = 515

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 78/170 (45%), Gaps = 16/170 (9%)

Query: 176 AFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVS 235
           AF P  S ++++ + D T  +WD  +   ++P  T   H + V    W      L  T S
Sbjct: 150 AFAPHTSSRMITGAGDNTARIWDCNT---QTPMSTLKGHFNWVLCVSWSP-DGELIATGS 205

Query: 236 EDNTLIIHDTNSD-------RAIQKLSVSSAFNTLAFSKRSEN-LLAAAGTDSNVYLYDL 287
            DNT+ + + N         R   K   S ++  +   K  +   LA+A  D  + ++D 
Sbjct: 206 MDNTIRLWEGNKGQPVGDALRGHGKWITSLSWEPIHLVKPGQKPRLASASKDGTIKIWDT 265

Query: 288 RRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAE 337
            R +  L +++GH  SV+ +++     G+L S   D+ I  WD+ N+G +
Sbjct: 266 TR-RVCLITLSGHTSSVSCIKWGGQ--GVLYSGSHDKTIRAWDM-NLGGK 311

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 62/244 (25%), Positives = 96/244 (39%), Gaps = 63/244 (25%)

Query: 184 QLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIH 243
           +L SAS DGT+ +WD T    +    T   HT  V+  KW   Q  L+ + S D T+   
Sbjct: 250 RLASASKDGTIKIWDTT---RRVCLITLSGHTSSVSCIKWGG-QGVLY-SGSHDKTIRAW 304

Query: 244 DTN-SDRAIQ------------KLSVSSAFNTLAF------------------------S 266
           D N   + I              LS   A    AF                        +
Sbjct: 305 DMNLGGKCINILKSHAHWVNHLSLSTDYALRIGAFDHTSEKPSTPEEAQKRALKNYEKIA 364

Query: 267 KRS---ENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGL-LTSSGS 322
           KR+   E L+  A  D  +YL++  +  KP+  M GH+  V  + FSP  DG  + S+  
Sbjct: 365 KRNGEVEELMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSP--DGRHIVSASF 422

Query: 323 DRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENV 382
           D  I +W            +  DG  +      GH + V + + +S+   L+ S  ++  
Sbjct: 423 DNSIKLW------------NGRDG--KFISTFRGHVASVYQVAWSSDCR-LLVSCSKDTT 467

Query: 383 LQIW 386
           L++W
Sbjct: 468 LKVW 471

 Score = 33.9 bits (76), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 74/155 (47%), Gaps = 11/155 (7%)

Query: 178 NPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSED 237
           N  V   +++ASDD T+ LW+   +    P      H  +VN   +      +  + S D
Sbjct: 367 NGEVEELMVTASDDFTMYLWNPLKSTK--PITRMTGHQKLVNHVAFSPDGRHIV-SASFD 423

Query: 238 NTLIIHDTNSDRAIQKLS--VSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLH 295
           N++ + +    + I      V+S +  +A+S     LL +   D+ + ++D+ + +K   
Sbjct: 424 NSIKLWNGRDGKFISTFRGHVASVYQ-VAWSSDCR-LLVSCSKDTTLKVWDV-KTKKLAV 480

Query: 296 SMAGHEDSVTSLEFSPHQDG-LLTSSGSDRRIIMW 329
            + GH+D V ++++S   DG  + S G D+ + +W
Sbjct: 481 DLPGHKDEVYTVDWS--VDGKRVCSGGKDKMVRLW 513

>CAGL0K09284g Chr11 (915766..918501) [2736 bp, 911 aa] {ON} highly
           similar to uniprot|P25635 Saccharomyces cerevisiae
           YCR057c PWP2 periodic tryptophan protein
          Length = 911

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 91/173 (52%), Gaps = 11/173 (6%)

Query: 175 LAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTV 234
           L ++P  S ++++A++DG + +WDV S    +   TF+ HT  V   ++ +    LF + 
Sbjct: 347 LTYSPDGS-RVVTAAEDGKIKVWDVASGFCLA---TFEEHTSAVTAVQFAKKGQVLF-SA 401

Query: 235 SEDNTLIIHDTNSDRAIQKLSVSS--AFNTLAFSKRSENLLAAAGTDS-NVYLYDLRRLQ 291
           S D T+   D    R  +  + +    F  LA     E +++A  TDS +V+++ ++  Q
Sbjct: 402 SLDGTVRAWDLIRYRNFRVFTATERVQFTCLAVEPSGE-VVSAGSTDSFDVFVWSVQTGQ 460

Query: 292 KPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAY 344
             L +++GHE  V+ L FS  ++ +L S+  D+ I +W +F    + +P + +
Sbjct: 461 -LLDTLSGHEGPVSCLAFS-MENAVLASASWDKTIRIWSIFGRSQQVEPLEVF 511

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 40/184 (21%), Positives = 78/184 (42%), Gaps = 23/184 (12%)

Query: 168 HKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQ 227
           H++   G  FN T   ++ + S DG V  W+  S A K      D+  + ++   W   +
Sbjct: 190 HRDYVLGAYFNST-QEKIYTISKDGAVFTWEYISKAQKEGLDEEDLEDEDLSKLSWRITK 248

Query: 228 SSLFGTVS----------EDNTLIIHDTNSDR---------AIQKLSVS-SAFNTLAFSK 267
            + F                N LI+  +N +           +Q+LS+  +  NT++ + 
Sbjct: 249 KNFFYANQAKVKCCTFHINSNLLIVGFSNGEFRLYEMPEFVMVQQLSMGQNPVNTVSVNN 308

Query: 268 RSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRII 327
             E L   +     + +Y+ +  +  +    GH D+  SL +SP    ++T++  D +I 
Sbjct: 309 SGEWLAFGSSKLGQLLVYEWQS-ESYILKQQGHFDATNSLTYSPDGSRVVTAA-EDGKIK 366

Query: 328 MWDL 331
           +WD+
Sbjct: 367 VWDV 370

>TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON}
           Anc_6.276 YPL247C Two N bases added to fix a frameshift
           that can't be corrected using the reads.
          Length = 447

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 53/206 (25%), Positives = 87/206 (42%), Gaps = 28/206 (13%)

Query: 177 FNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSE 236
           +NPT    L+S+S D T  +WD+ S AN   +Q    H   V D ++    + LF +   
Sbjct: 218 WNPTDPNLLISSSIDTTCIVWDLQS-ANYIKTQLI-AHDSEVFDVRFLTQSTQLFASCGG 275

Query: 237 D-------------NTLIIHDTNSDRA--IQKLSVSSAFNTLAFSKRSENLLAAAGTDSN 281
           D             +T+I   T  D A  +   +V  A   L  S    N++A    DS+
Sbjct: 276 DGSVRVFDLRCLAHSTIIYEPTIPDGAPDLPSPTVPPALLRLEPSPFDPNVIATFAIDSS 335

Query: 282 -VYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL--------- 331
            V + D+R    PL ++  H   +  +++ P +  +L S+  D +++ WDL         
Sbjct: 336 KVLILDMRSPGSPLLTLEAHTAPINQIKWHPTRRNVLLSASDDCQVLYWDLNTHLDSEST 395

Query: 332 FNIGAEQQPDDAYDGVPELFMMHGGH 357
            +   + QPD      P +F   GG 
Sbjct: 396 KDTTPDSQPDSTVQK-PAMFYASGGQ 420

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 62/278 (22%), Positives = 107/278 (38%), Gaps = 74/278 (26%)

Query: 26  MMYDFVSETRLTWPSLTVQWLPTEMQPREV------------------------------ 55
           + +D V+E  +T+P  T+QW P   QPR                                
Sbjct: 129 LSWDRVAECNVTFPVSTIQWQPARAQPRTFATCSDSLXXFWSLTEDETAIQEQINLSLCK 188

Query: 56  -------DGQQLLRQELLIGTLT-------TDNEPNYLKIAAIDLPENVTSSKPSVSDDA 101
                   G++L+    ++G L           +PN L  ++ID       +   V D  
Sbjct: 189 HNKQQSEKGKELVGTNGVLGELPPITSFHWNPTDPNLLISSSID-------TTCIVWDLQ 241

Query: 102 KENELSHRQSKIKIVRKFKHEQEVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGA 161
             N +     K +++    H+ EV   R++ QS  + A+  G G V +FD  ++   H  
Sbjct: 242 SANYI-----KTQLI---AHDSEVFDVRFLTQSTQLFASCGGDGSVRVFD--LRCLAHST 291

Query: 162 IASFSYHKENGYGLAFNPTVSGQLL----SASDDGTVALWDVTST--------ANKSPSQ 209
           I  +     +G     +PTV   LL    S  D   +A + + S+        +  SP  
Sbjct: 292 II-YEPTIPDGAPDLPSPTVPPALLRLEPSPFDPNVIATFAIDSSKVLILDMRSPGSPLL 350

Query: 210 TFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNS 247
           T + HT  +N  KWH  + ++  + S+D  ++  D N+
Sbjct: 351 TLEAHTAPINQIKWHPTRRNVLLSASDDCQVLYWDLNT 388

>Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W
           (REAL)
          Length = 469

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 91/216 (42%), Gaps = 18/216 (8%)

Query: 121 HEQEVTRARYMPQSPNIIATLNGAGIVYIFDRN---IKEKDHGAIASFSYHKENGYGLAF 177
           H+  VT  +Y      +I+  +  G++ I+  N   +KE D       + H E+   +AF
Sbjct: 136 HDSAVTTMKYSHDGDWMISG-DADGMIKIWQPNFSMVKEID-------AAHTESIRDMAF 187

Query: 178 NPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSED 237
           +   S + ++ SDD  + +W+    +N    +    H   V  C WH  +  L  + S+D
Sbjct: 188 SSNDS-KFVTCSDDNILKIWNF---SNGKQERVLSGHHWDVKSCDWHP-EMGLIASASKD 242

Query: 238 NTLIIHDTNSDRAIQK-LSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHS 296
           N + + D  S   I   L          F     NLL A   D +  ++D+R   K L  
Sbjct: 243 NLVKLWDPRSGNCISSILKFKHTVLKTRFQPTKGNLLMAISKDKSCRVFDIRYSMKELMC 302

Query: 297 MAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLF 332
           +    D +T LE+ P  + + T +  D  +  +DL 
Sbjct: 303 VRDETDYMT-LEWHPINESMFTLACYDGSLKHFDLL 337

>TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa]
           {ON} Anc_6.340 YCR072C
          Length = 514

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 63/244 (25%), Positives = 99/244 (40%), Gaps = 63/244 (25%)

Query: 184 QLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIH 243
           +L SAS DGT+ +WD T    +    T   HT  V+  +W   Q+ L+ T S D T+ + 
Sbjct: 249 RLASASKDGTIKVWDTT---GRVCLYTLSGHTSSVSCVRWGG-QNMLY-TGSHDKTIRVW 303

Query: 244 DTNSD-RAIQKL-SVSSAFNTLAFSK---------------------------------- 267
           D NS+ R I  L S +   N L+ S                                   
Sbjct: 304 DMNSNGRCINILKSHAHWVNHLSLSTDYALRIGPFDHSGAKPAIAEEARDKALKNYEKIV 363

Query: 268 ----RSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGL-LTSSGS 322
                +E L+  A  D  ++L++  +  KPL  M GH+  V  + FSP  DG  + S+  
Sbjct: 364 KKNGHTEELMVTASDDFTMFLWNPLKSTKPLARMTGHQKLVNHVAFSP--DGRHIVSASF 421

Query: 323 DRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENV 382
           D  I +W            D  DG  +      GH + V + + +S+   L+ S  ++  
Sbjct: 422 DNSIKLW------------DGRDG--KFISTFRGHVASVYQVAWSSDCR-LLVSCSKDTT 466

Query: 383 LQIW 386
           L++W
Sbjct: 467 LKVW 470

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 78/168 (46%), Gaps = 15/168 (8%)

Query: 176 AFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVS 235
           AF P  S ++++ + D T  LWD  +   ++P  T   H++ V    W    + +  T S
Sbjct: 149 AFAPNSSSRMVTGAGDNTARLWDCDT---QTPMATLSGHSNWVLCVAWSP-DAEVIATGS 204

Query: 236 EDNTLIIHD-------TNSDRAIQKLSVSSAFNTLAFSKRSEN-LLAAAGTDSNVYLYDL 287
            DNT+ + +        +S R   K   S A+  L   K  +   LA+A  D  + ++D 
Sbjct: 205 MDNTIRLWNGINGKPIGDSLRGHSKWITSLAWEPLHLVKVGQKPRLASASKDGTIKVWDT 264

Query: 288 RRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIG 335
              +  L++++GH  SV+ + +      +L +   D+ I +WD+ + G
Sbjct: 265 TG-RVCLYTLSGHTSSVSCVRWGGQN--MLYTGSHDKTIRVWDMNSNG 309

>TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {ON}
           Anc_2.283 YNL035C
          Length = 413

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 87/196 (44%), Gaps = 15/196 (7%)

Query: 173 YGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKW--HEFQSSL 230
           + L   P  S  LL +S +G+V L D  S    S  + F+V    +N  +   ++F++  
Sbjct: 16  WCLELKPLYSRGLLCSSSNGSVNLIDWNS---PSIIKKFEVGETNINSLRVINNDFENGC 72

Query: 231 FGTVSEDNTLIIHDT-NSDRAIQKLSVSSAFNTLAFSKRSENLLAAA---GTDSNVYLYD 286
               +   ++ I+D  N D  +  +        L+   R + L+      G D+ +++YD
Sbjct: 73  IFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELTGVDAEMFIYD 132

Query: 287 LRRLQKPLHSMA-GHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYD 345
           +R   KP+ +    H D +T ++F P    +L S  +D    ++DL    A++  D+A  
Sbjct: 133 VRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDL----AQEDEDEALH 188

Query: 346 GVPELFMMHG-GHRSP 360
            V     +H  G  SP
Sbjct: 189 QVINYASIHSCGWLSP 204

>KAFR0L01520 Chr12 complement(278754..280508) [1755 bp, 584 aa] {ON}
           Anc_7.356 YLR196W
          Length = 584

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 81/172 (47%), Gaps = 11/172 (6%)

Query: 166 SYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHE 225
           S+H +    L+ N      L S S D TV LWD+ S  N + S     +   V+  +WH 
Sbjct: 286 SHHTDAVLSLSHNKHFRAVLASTSADHTVKLWDLNS-GNAARSMASIHNNKNVSSSQWHH 344

Query: 226 FQSSLFGTVSEDNTLIIHD---TNSDRAIQKLSVSSA--FNTLAFSKRSENLLAAAGTDS 280
              S+  T   D+ + + D   +N +   +  SVS+     T+ F+   EN++ A     
Sbjct: 345 GNGSILLTGGYDSRIALTDVRISNENEMSKYWSVSNGEEVETVIFA--DENIILAGTDSG 402

Query: 281 NVYLYDLRR--LQKPLHSMAGHEDSVTSLEFSPHQDGLL-TSSGSDRRIIMW 329
           N+Y +D+R     KP+ ++  H+  ++SL  +    GL+ T +  ++ + +W
Sbjct: 403 NIYSFDIRNNAGSKPVWTLKAHDAGISSLSVNNFIPGLMSTGAMGEKAVKLW 454

>Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {ON}
           YPL151C (REAL)
          Length = 451

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 79/157 (50%), Gaps = 8/157 (5%)

Query: 176 AFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVS 235
           A +P  +   ++ S+D T+ +WD+ +   K+   T   H   V D    +    LF +VS
Sbjct: 146 AIDPVDNEWFVTGSNDTTMKVWDLATGKLKT---TLAGHVMTVRDIAVSDRHPYLF-SVS 201

Query: 236 EDNTLIIHDTNSDRAIQKLSVS-SAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPL 294
           ED T+   D   +  I+      S   T++    + +L+A AG DS V L+D+ R + P+
Sbjct: 202 EDKTVKCWDLEKNHIIRDYYGHLSGVRTVSIHP-TLDLIATAGRDSVVKLWDI-RTRMPV 259

Query: 295 HSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
            ++ GH+  +  ++ +P  D  + SS +D  + +WD+
Sbjct: 260 ITLVGHKGPINQVQCTP-VDPQIVSSSTDATVRLWDI 295

>AAR078W Chr1 (483989..485677) [1689 bp, 562 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR196W (PWP1)
          Length = 562

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 53/183 (28%), Positives = 85/183 (46%), Gaps = 13/183 (7%)

Query: 166 SYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFD-VHT-DIVNDCKW 223
           ++H +    LA N      L S S D TV LWD+    +   +++ D VH+   V+  +W
Sbjct: 268 THHTDAVLSLAHNRHFRAVLASTSADHTVKLWDLN---HGRAARSLDAVHSATAVSSSQW 324

Query: 224 HEFQSSLFGTVSEDNTLIIHDTN--SDRAIQKL-SVSSAFNTLAFSKRSENLLAAAGTDS 280
           H    S+  T   D+ + + D    +D  + K   V       + +  SE +   AGTDS
Sbjct: 325 HPSDGSILLTAGYDSRVALSDVRIANDAGMSKYWKVMKGEEIESATFVSETVF-LAGTDS 383

Query: 281 -NVYLYDLRRLQ--KPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRII-MWDLFNIGA 336
            NVY +DLR  +   PL ++  H+  ++SL  SP    +L +S    ++I +W     GA
Sbjct: 384 GNVYSFDLRNGEDSAPLWTLNAHDSGISSLSVSPSIPNMLVTSAMGEKVIKLWKTPAEGA 443

Query: 337 EQQ 339
             Q
Sbjct: 444 SAQ 446

>TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {ON}
           Anc_3.25 YNL317W
          Length = 459

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 66/285 (23%), Positives = 116/285 (40%), Gaps = 36/285 (12%)

Query: 121 HEQEVTRARYMPQSPNIIATLNGAGIVYIFDRN---IKEKDHGAIASFSYHKENGYGLAF 177
           H+  VT   Y   + + + + +  G + I+  N   +KE D         H E    +AF
Sbjct: 127 HDTSVTAMEY-SHAGDWMISGDADGTIKIWQPNFNMVKELDKA-------HTECIRDIAF 178

Query: 178 NPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSED 237
           +   S + ++ SDD  + +W+ +   N    +T   H   V  C WH  +  L  + S+D
Sbjct: 179 SKNDS-KFVTCSDDNILKIWNFS---NGKQERTLSGHHWDVKSCDWHP-EMGLIVSASKD 233

Query: 238 NTLIIHDTNSDRAIQKL-SVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHS 296
           N + + D  S + +  L +         F     NLLAA   D +  ++D+R   K L  
Sbjct: 234 NLIKLWDPRSGQCVSTLLNFKHTVLKTKFQPTKGNLLAAISKDKSCRVFDIRYHMKELTV 293

Query: 297 MAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLF-NIGAEQQPDDAYDGVPELFMMHG 355
           +    D +T L + P  + + T +  D  I  +D+  N+   QQ            ++  
Sbjct: 294 IRDEVDYMT-LLWHPTNESMFTIASYDGAIKHFDILQNLEEPQQ------------VIPY 340

Query: 356 GHRSPVNEFSHNSNVPWLMCSVEEENVLQIWKPANKIVRPPQPPA 400
            H   +   S+N  V  ++ S  ++  ++ W  A    RP  P A
Sbjct: 341 AHDKCITSLSYNP-VGHILASAAKDRTIRFWTRA----RPVDPNA 380

 Score = 30.4 bits (67), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 47/94 (50%), Gaps = 16/94 (17%)

Query: 297 MAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGG 356
           M  H+ SVT++E+S H    + S  +D  I +W         QP+  ++ V EL   H  
Sbjct: 124 MQAHDTSVTAMEYS-HAGDWMISGDADGTIKIW---------QPN--FNMVKELDKAHTE 171

Query: 357 HRSPVNEFSHNSNVPWLMCSVEEENVLQIWKPAN 390
               +  FS N +  ++ CS  ++N+L+IW  +N
Sbjct: 172 CIRDI-AFSKNDS-KFVTCS--DDNILKIWNFSN 201

>YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON}
           PRP46Member of the NineTeen Complex (NTC) that contains
           Prp19p and stabilizes U6 snRNA in catalytic forms of the
           spliceosome containing U2, U5, and U6 snRNAs
          Length = 451

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 81/158 (51%), Gaps = 8/158 (5%)

Query: 175 LAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTV 234
           +A +P  +   ++ S+D T+ +WD+ +   K+   T   H   V D    +    LF +V
Sbjct: 145 VAIDPVDNEWFITGSNDTTMKVWDLATGKLKT---TLAGHVMTVRDVAVSDRHPYLF-SV 200

Query: 235 SEDNTLIIHDTNSDRAIQKLSVS-SAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKP 293
           SED T+   D   ++ I+      S   T++    + +L+A AG DS + L+D+ R + P
Sbjct: 201 SEDKTVKCWDLEKNQIIRDYYGHLSGVRTVSIHP-TLDLIATAGRDSVIKLWDM-RTRIP 258

Query: 294 LHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
           + ++ GH+  +  ++ +P  D  + SS +D  + +WD+
Sbjct: 259 VITLVGHKGPINQVQCTP-VDPQVVSSSTDATVRLWDV 295

>CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035c
          Length = 376

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 74/167 (44%), Gaps = 12/167 (7%)

Query: 171 NGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSL 230
           N + L   P  +G L S S  G V L  +    + S   +F V    +N     + Q +L
Sbjct: 13  NNWCLKLQPVHNGILTSVSS-GEVHLLGL----DLSKQDSFKVGETSINALSRVDGQENL 67

Query: 231 FGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAA----GTDSNVYLYD 286
           F   S  N + + D   ++ +  L   +  N L+       +LA      G D++++L+D
Sbjct: 68  FAA-SNGNKVKVFDLRENKEVATLEQENGANVLSLGS-GHGMLAYGSEQQGVDAHLHLFD 125

Query: 287 LRRLQKPLHSMA-GHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLF 332
           +R   KP+ S    H+D +TS+ F P    +L S  +D    ++DL 
Sbjct: 126 IRNWSKPVRSFVDSHQDDITSIAFHPADANVLLSGSTDGYTNVYDLL 172

>ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} similar
           to uniprot|Q12523 Saccharomyces cerevisiae YPL247C
           Hypothetical ORF
          Length = 506

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 76/353 (21%), Positives = 136/353 (38%), Gaps = 89/353 (25%)

Query: 26  MMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLRQELLIGTLTTDNEPNYLKIAAID 85
           + +D V+E  +T+P  T+QW P+   PR                  +D+    L+I +  
Sbjct: 150 LSWDRVAECNVTFPVSTIQWQPSMTHPRRF-------------ATCSDS----LRIWSF- 191

Query: 86  LPENVTSSKPSVSDDAKENELSHRQSKIKIVRKFKHEQEVTRARYMPQSPNIIATLNGAG 145
                           +E      Q  + + +  K +Q  +R         + A   G+G
Sbjct: 192 ---------------CEEERNLQEQINLSLCKYDKQQQGASR---------VNAAAGGSG 227

Query: 146 IVYIFDRNIKEKDHGAIASF----SYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTS 201
            +    R   ++  G I       S+H        +NP     L+S+S D T  +WD+ S
Sbjct: 228 SI----RTNPQQQQGLIGELPPITSFH--------WNPVDPNLLISSSIDTTCIVWDLQS 275

Query: 202 TANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTL------------IIHDTNSDR 249
           + N   +Q    H   V D ++    + LF +   D ++            II++  S  
Sbjct: 276 S-NYVRTQLI-AHDSEVYDVRFLTQTTQLFSSCGGDGSVRVFDLRCLAHSTIIYEPPSSP 333

Query: 250 AIQKLSVSSAFNT------------LAFSKRSENLLAAAGTDS-NVYLYDLRRLQKPLHS 296
           A  + + ++  ++            L  S    N++A    DS  V + D+R    P+  
Sbjct: 334 ATLQPTTAAGSSSAADSDTGVPLLRLEPSPFDPNVIATFAIDSPRVLILDMRNPGSPVLV 393

Query: 297 MAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFN--IG--AEQQPDDAYD 345
           + GH  +V  + + P +  +L S   D +++ WDL N  +G   +Q PD A D
Sbjct: 394 LEGHSAAVNQMRWHPSKRNVLLSCADDCQVLYWDLNNYIMGHPTDQDPDHAVD 446

>TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}
           Anc_7.534 YPR178W
          Length = 465

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 59/218 (27%), Positives = 97/218 (44%), Gaps = 21/218 (9%)

Query: 121 HEQEVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPT 180
           HE+ V   R+ P     IA+ +      ++D    E +H  +    + KE  + LAF   
Sbjct: 264 HERRVAGCRFHPFG-RYIASASFDNTWRLWD---AETNHELLLQEGHGKEV-FCLAFQSD 318

Query: 181 VSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKW--HEFQSSLFGTVSEDN 238
            S  L SA  D T  +WD+ S    + +     HT  +    W    F+ +   T S D 
Sbjct: 319 GS-LLCSAGLDCTGMIWDIRSG---NCAMVLSGHTKPIYSVDWSPRGFEVA---TASGDG 371

Query: 239 TLIIHD---TNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLH 295
           T+ I D   TN  + +  L+ +S  + + F K +   L + G D N+ +Y      K + 
Sbjct: 372 TVNIWDIRKTNQPQVL--LAHNSIVSGIRFEKHNGKFLMSCGYDKNINVYSGDSWNK-IT 428

Query: 296 SMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFN 333
            + GH D + +L+   H DG + S+G DR +  W++ N
Sbjct: 429 ILKGHTDKILALDLGTH-DGSVVSAGWDRSVKSWNVDN 465

>KLLA0F05159g Chr6 (506007..509702) [3696 bp, 1231 aa] {ON} similar
           to uniprot|P38968 Saccharomyces cerevisiae YDL195W SEC31
           involved in protein transport from endoplasmic reticulum
           to Golgi Component (p150) of COPII coat of secretory
           pathway vesicles
          Length = 1231

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 52/209 (24%), Positives = 90/209 (43%), Gaps = 19/209 (9%)

Query: 137 IIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQLLSASDDGTVAL 196
           IIA     G+V  FD     K   ++A    H+     L FN   +  L+S    G + +
Sbjct: 76  IIAGALENGVVEFFD----PKALKSVAKIHKHQGPVKTLKFNAKQNNVLVSGGTQGEIFV 131

Query: 197 WDVT--STANKSPSQTFDVHTDI--VNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQ 252
           WD     +++ SP      +T I  V+   W++  + +F + S      + D  + + + 
Sbjct: 132 WDSNKIGSSDYSPFSAGISNTPIDEVSSLSWNQSLAHVFASASSSGYASVWDLKAKKQVL 191

Query: 253 KLSVSSA-------FNTLAFSKRSENLLAAAG---TDSNVYLYDLRRLQKPLHSMA-GHE 301
            L+ SS+          + +   S  ++A A    T+  V  +DLR    PL  ++ GH 
Sbjct: 192 HLNHSSSTTGIKVPLTVVDWHPTSSTIIATASSSDTEPLVLTWDLRNAHVPLKVLSQGHS 251

Query: 302 DSVTSLEFSPHQDGLLTSSGSDRRIIMWD 330
             V SL++    + LL SSG D   ++W+
Sbjct: 252 KGVLSLDWCKQDENLLLSSGRDNTSVLWN 280

 Score = 38.5 bits (88), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 57/238 (23%), Positives = 106/238 (44%), Gaps = 25/238 (10%)

Query: 115 IVRKFKHEQEVTRARYMPQSPNIIATLNGAGIVYIFDRN-IKEKDHGAIASFSYHKENG- 172
           + +  KH+  V   ++  +  N++ +    G ++++D N I   D+   + FS    N  
Sbjct: 97  VAKIHKHQGPVKTLKFNAKQNNVLVSGGTQGEIFVWDSNKIGSSDY---SPFSAGISNTP 153

Query: 173 ----YGLAFNPTVSGQLLSASDDGTVALWDVTSTA-----NKSPSQT-FDVHTDIVNDCK 222
                 L++N +++    SAS  G  ++WD+ +       N S S T   V   +V+   
Sbjct: 154 IDEVSSLSWNQSLAHVFASASSSGYASVWDLKAKKQVLHLNHSSSTTGIKVPLTVVD--- 210

Query: 223 WHEFQSSLFGTVSEDNT----LIIHDTNSDRAIQKLSV--SSAFNTLAFSKRSENLLAAA 276
           WH   S++  T S  +T    L     N+   ++ LS   S    +L + K+ ENLL ++
Sbjct: 211 WHPTSSTIIATASSSDTEPLVLTWDLRNAHVPLKVLSQGHSKGVLSLDWCKQDENLLLSS 270

Query: 277 GTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNI 334
           G D+   L++ +     L   A   + V   +F+P    L  S+  D +I++  L N+
Sbjct: 271 GRDNTSVLWNPQE-GSILTQFAPRGNWVFKSKFAPEAPDLFASASFDSKIVVQTLQNL 327

 Score = 37.4 bits (85), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 41/77 (53%), Gaps = 2/77 (2%)

Query: 260 FNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTS 319
           FN L +S   + ++A A  +  V  +D + L K +  +  H+  V +L+F+  Q+ +L S
Sbjct: 65  FNDLDWSG-DDKIIAGALENGVVEFFDPKAL-KSVAKIHKHQGPVKTLKFNAKQNNVLVS 122

Query: 320 SGSDRRIIMWDLFNIGA 336
            G+   I +WD   IG+
Sbjct: 123 GGTQGEIFVWDSNKIGS 139

 Score = 37.4 bits (85), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 30/138 (21%), Positives = 58/138 (42%), Gaps = 3/138 (2%)

Query: 154 IKEKDHGAIASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDV 213
           +K  ++   A+FS+  +    LA  P         S   T+ LW + S     PS +  V
Sbjct: 2   VKLAEYPRTATFSWSHDRVPVLATGPASGAIDADFSSTSTLELWSLLSFDGSKPSGSV-V 60

Query: 214 HTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSV-SSAFNTLAFSKRSENL 272
                ND  W      + G + E+  +   D  + +++ K+        TL F+ +  N+
Sbjct: 61  ADGKFNDLDWSGDDKIIAGAL-ENGVVEFFDPKALKSVAKIHKHQGPVKTLKFNAKQNNV 119

Query: 273 LAAAGTDSNVYLYDLRRL 290
           L + GT   ++++D  ++
Sbjct: 120 LVSGGTQGEIFVWDSNKI 137

>KAFR0L01320 Chr12 complement(244228..247950) [3723 bp, 1240 aa]
           {ON} Anc_7.310 YDL195W
          Length = 1240

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 48/210 (22%), Positives = 90/210 (42%), Gaps = 22/210 (10%)

Query: 140 TLNGA---GIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQLLSASDDGTVAL 196
           T+ GA   GI+ +F   +      ++A  + H  +   L FN      L+S S+ G + +
Sbjct: 76  TIAGALDNGIIELF--YLSNDQLTSVAKLTTHTSSVKTLKFNSKQENVLVSGSNKGEIFV 133

Query: 197 WDVTSTANKS---PSQTFDVHTDI--VNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAI 251
           WD T+ A ++   P       T +  +    W++  + +F +        I D  + + +
Sbjct: 134 WD-TNKAKQTDYVPMTPGTAMTPLEEITSLSWNQSLAHVFASAGATVYASIWDLKAKKEV 192

Query: 252 QKLSVSSAFNTLA--------FSKRSENLLAAAGTDSN--VYLYDLRRLQKPLHSM-AGH 300
             LS +S    L             S  +  A G D++  + ++DLR    PL  +  GH
Sbjct: 193 IHLSYTSPATGLKSQLSVVEWHPNNSTRVATATGNDNDPSILVWDLRNANTPLQVLDQGH 252

Query: 301 EDSVTSLEFSPHQDGLLTSSGSDRRIIMWD 330
              + SL++    + L+ SSG D  +++W+
Sbjct: 253 SKGIISLDWCHEDESLMLSSGRDNTVLLWN 282

>KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {ON}
           Anc_8.288 YDR128W
          Length = 1159

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 72/150 (48%), Gaps = 6/150 (4%)

Query: 185 LLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHD 244
           ++S S+   + +W++   ++ +       H+  + D  ++     +  T S D  +   D
Sbjct: 86  IVSTSNQKAI-IWNLNKPSSNAIEYALHGHSRAITDINFNSQHPDILATCSIDTYVHAWD 144

Query: 245 TNSDRA--IQKLSVSSAFNTLAFSKRSENLLAAA-GTDSNVYLYDLRRLQKPLHSMAGHE 301
             S         S  S+ + + ++ +  N+LA++ G D  V+++DLR    PLH + GH 
Sbjct: 145 MRSPHRPFYTTSSWRSSASQVKWNFKDSNILASSHGND--VFIWDLRHGSTPLHKLTGHN 202

Query: 302 DSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
             V S++FS  ++  + SS +D  +  WDL
Sbjct: 203 SGVNSIDFSRFEENKIMSSSNDGTVKFWDL 232

 Score = 34.3 bits (77), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 69/164 (42%), Gaps = 9/164 (5%)

Query: 132 PQSPN-IIATLNGAGIVYIFDRNIKEKDHGAIA-SFSYHKENGYGLAFNPTVSGQLLSAS 189
           P  P+ I++T N   I++    N+ +    AI  +   H      + FN      L + S
Sbjct: 80  PAKPHWIVSTSNQKAIIW----NLNKPSSNAIEYALHGHSRAITDINFNSQHPDILATCS 135

Query: 190 DDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDR 249
            D  V  WD+ S     P  T        +  KW+   S++  +   ++  I    +   
Sbjct: 136 IDTYVHAWDMRSP--HRPFYTTSSWRSSASQVKWNFKDSNILASSHGNDVFIWDLRHGST 193

Query: 250 AIQKLSV-SSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQK 292
            + KL+  +S  N++ FS+  EN + ++  D  V  +DL + +K
Sbjct: 194 PLHKLTGHNSGVNSIDFSRFEENKIMSSSNDGTVKFWDLSKEEK 237

>Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}
           YPL247C (REAL)
          Length = 526

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 76/376 (20%), Positives = 136/376 (36%), Gaps = 109/376 (28%)

Query: 22  SNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLRQELLIGTLTTDNEPNYLKI 81
           SN  + +D V E  + +P   +QW P+++ PR++                +D+    L+I
Sbjct: 160 SNDLLSWDSVVEADVVYPVSRIQWAPSQLHPRKL-------------ATCSDS----LRI 202

Query: 82  AAIDLPENVTSSKPSVSDDAKENELSHRQSKIKIVRKFKHEQEVTRARYMPQSPNIIATL 141
             ++  E                            R+F+ +  ++  +Y  Q P   AT 
Sbjct: 203 WNVNPEE----------------------------RQFQEQINLSLCKYNRQHPTSTATT 234

Query: 142 NGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTS 201
               ++  F           I SF +          N   +  ++S+S D T  +WD+ S
Sbjct: 235 EDMKVIGTFP---------PITSFDW----------NTVDTNLIISSSIDTTCIVWDLQS 275

Query: 202 TANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSV----- 256
           +           H   V D ++    + LF +   D ++ + D    R++   ++     
Sbjct: 276 S--HYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFDL---RSLAHSTIIYEPP 330

Query: 257 --------------------SSAFNTLAFSKRSENLLAAAGTDSN-VYLYDLRRLQKPLH 295
                               S A   L  S    N+LA    DSN + + D+R  + P+ 
Sbjct: 331 SSSSSSSAPAAGTTTPSSDGSYALLRLEPSPYDPNVLATFAADSNKIIILDMRNPESPIL 390

Query: 296 SMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNI------------GAEQQPDDA 343
           ++ GH  SV  +++ P +  +L S   D +++ WDL N             GA   P + 
Sbjct: 391 TLEGHSSSVNEIKWHPTKRNVLLSCSDDCQVLYWDLNNSFMEINGGSVKSPGASGTPLED 450

Query: 344 YDGVPELFMMHGGHRS 359
            DG  +  M  GG  S
Sbjct: 451 TDG--DTVMADGGEGS 464

>Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C
           (REAL)
          Length = 451

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 80/157 (50%), Gaps = 8/157 (5%)

Query: 176 AFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVS 235
           A +P  +   ++ S+D T+ +WD+ +   ++   T   H   V D    +    LF +VS
Sbjct: 146 AIDPVNNEWFITGSNDTTMKVWDLATGKLRT---TLAGHVMTVRDIAISDRHPYLF-SVS 201

Query: 236 EDNTLIIHDTNSDRAIQKLSVS-SAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPL 294
           ED T+   D   ++ I+      S   T++    + +L+A AG DS + L+D+ R + P+
Sbjct: 202 EDKTVKCWDLEKNQIIRDYYGHLSGVRTVSIHP-TLDLIATAGRDSVIKLWDI-RTRVPV 259

Query: 295 HSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
            ++ GH+  +  ++ +P  D  + SS +D  + +WD+
Sbjct: 260 ITLVGHKGPINQVQCTP-VDPQIVSSSTDATVRLWDV 295

>NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {ON}
           Anc_2.283 YNL035C
          Length = 397

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 59/206 (28%), Positives = 90/206 (43%), Gaps = 20/206 (9%)

Query: 171 NGYGLAFNP--TVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKW--HEF 226
           N +   F P    +G LLS S+ G +   D  +  +K   Q+  V    +ND K    +F
Sbjct: 17  NNWCFKFQPLDKANGLLLSLSN-GEIHCLDFGTCQSK---QSIRVSNLSINDLKILNSDF 72

Query: 227 QS-SLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAA----GTDSN 281
              SLF T + ++  I    +++  I  L        L+   R   LLA      G D+ 
Sbjct: 73  HCGSLFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSR-HGLLAMGTELQGVDAQ 131

Query: 282 VYLYDLRRLQKPLHSMA-GHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQP 340
           + +YD+R+   PL S+   H D VT+L+F P    +L S  +D    ++DL     +Q  
Sbjct: 132 INIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL----TQQDE 187

Query: 341 DDAYDGVPELFMMHG-GHRSPVNEFS 365
           DDA   V     +H  G  SP   F+
Sbjct: 188 DDALHQVMNYASIHSCGWLSPNRIFT 213

>Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 82/183 (44%), Gaps = 18/183 (9%)

Query: 162 IASFSYHKENGYG-----LAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTD 216
           ++S+S  + N +G     L   P+    LL+   +G + L D  S  +    Q       
Sbjct: 1   MSSYSLVESNSFGSENWCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSL---QKIKASET 57

Query: 217 IVNDCKW--HEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLA 274
            +ND K    +F +    + +  + + + D  ++  + K  + +  N+   S  S + L 
Sbjct: 58  SINDLKVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAK--IHNEANSPFISLDSRHGLL 115

Query: 275 AAGT-----DSNVYLYDLRRLQKPLHSMA-GHEDSVTSLEFSPHQDGLLTSSGSDRRIIM 328
           A GT     D+ VY+YD+RR   PL S+   H D VT ++F P    +L S  +D    +
Sbjct: 116 ACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNI 175

Query: 329 WDL 331
           +DL
Sbjct: 176 YDL 178

>Kpol_530.25 s530 (67445..69169) [1725 bp, 574 aa] {ON}
           (67445..69169) [1725 nt, 575 aa]
          Length = 574

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 82/172 (47%), Gaps = 11/172 (6%)

Query: 166 SYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTS-TANKSPSQTFDVHTDI-VNDCKW 223
           ++H +    LA N      L S S D TV LWD+ S TA +S +    +H++  V+  +W
Sbjct: 283 THHTDAVLSLAHNKHFRSVLASTSADHTVKLWDLNSGTAARSIAS---IHSNKNVSASEW 339

Query: 224 HEFQSSLFGTVSEDNTLIIHD---TNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDS 280
           H    S+  T   D+ L + D   ++     +  SV       A +  SENL+       
Sbjct: 340 HMSHGSILLTGGYDSRLALTDVRISDESNMSKYWSVMGGEEIEAATFASENLILCGTDSG 399

Query: 281 NVYLYDLRRLQ--KPLHSMAGHEDSVTSLEFSPHQDGLL-TSSGSDRRIIMW 329
           NVY +D+R  +  KP+ ++  H+  +++L  +    G++ T +  ++ + +W
Sbjct: 400 NVYSFDIRNNEGSKPVWTLKAHDAGISTLNCNKFIPGMMSTGAMGEKAVKLW 451

>Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 77/173 (44%), Gaps = 12/173 (6%)

Query: 166 SYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKW-- 223
           S+  EN + L   P     LL+   +G + L D  +     P Q        +ND K   
Sbjct: 11  SFGSEN-WCLKLQPAYKHGLLTGLSNGEICLLDWNT---GKPLQKIRASETAINDMKIID 66

Query: 224 HEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAA----GTD 279
            +F +    + +  +++ + D  S+  + K++  +    L+   R   LLA      G D
Sbjct: 67  SDFVAGNLISSASIDSVKVFDIRSNDCVAKINNETNSPFLSLDSR-HGLLACGTELQGID 125

Query: 280 SNVYLYDLRRLQKPLHSMA-GHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
           + +++YD+R+   PL S+   H D VT ++F P    +L S  +D    ++DL
Sbjct: 126 AAIHIYDVRKWDAPLRSLVDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDL 178

>Ecym_2808 Chr2 (1568103..1569500) [1398 bp, 465 aa] {ON} similar to
           Ashbya gossypii AEL269C
          Length = 465

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 84/172 (48%), Gaps = 11/172 (6%)

Query: 162 IASF-SYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVND 220
           + SF + H     GL ++PT +  LLS   D  V    +T+    S ++  D H   V  
Sbjct: 216 VKSFDNVHSGKVCGLDWHPTAN-SLLSGGADNLVK---ITNLDQGSCAELKD-HVGRVCK 270

Query: 221 CKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQ-KLSVSSAFNTLAFSKRSENLLAAAGTD 279
            K+H        + S D T I+ D     AIQ +   S    TL F +   +LLA+ G D
Sbjct: 271 VKFHP-SGKFAASASFDMTWILWDLEKALAIQLQEGHSREVFTLGF-QTDGSLLASGGLD 328

Query: 280 SNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
           S   ++DLR   +P+ ++ GH+  +  L++SP+   + T+SG D  I +WDL
Sbjct: 329 SIGLIWDLRS-GEPIMNLVGHQKPIYGLDWSPNGYQVATASG-DGSIKIWDL 378

>KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa]
           {ON} Anc_4.122 YGL003C
          Length = 568

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 82/169 (48%), Gaps = 12/169 (7%)

Query: 170 ENGYGLAFNPTVSGQLLS-ASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQS 228
           EN Y  + N   SG  L+    +G V ++DV     K   +T   H+D V    W+ +  
Sbjct: 303 ENEY-TSLNWVGSGSHLAVGQSNGIVEIFDVNK---KKCIRTMLGHSDRVACLSWNSY-- 356

Query: 229 SLFGTVSEDNTLIIHDTNS-DRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDL 287
            +  + S D+ ++  D  S D   +K+   S           EN L + G D+ V +YD 
Sbjct: 357 -ILTSGSRDHNILHRDVRSPDPFFEKIESHSQEVCGLKWNVDENKLVSGGNDNIVNVYD- 414

Query: 288 RRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSG--SDRRIIMWDLFNI 334
           R   KP  +M  H+ +V +L++S H+ G+L + G  +DR + +W++ N+
Sbjct: 415 RTSTKPFMTMTEHKAAVKALDWSSHKRGILATGGGTADRHLKIWNVNNM 463

>NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {ON}
           Anc_6.276 YPL247C
          Length = 524

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 80/172 (46%), Gaps = 22/172 (12%)

Query: 177 FNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSE 236
           +NP  +  L+S+S D T  +WD+ S +N   +Q    H   V D ++    + LF +   
Sbjct: 256 WNPIDTNLLISSSIDTTCIIWDLES-SNYVKTQLI-AHDSEVFDVRFLTQSTQLFASCGG 313

Query: 237 DNTLIIHDTNSDRAIQKLSV----------------SSAFNTLAFSKRSENLLAAAGTDS 280
           D ++ + D    R++   ++                S+A   L  S    N++A    DS
Sbjct: 314 DGSVRVFDL---RSLAHSTIIYEPPAQMDPSSSAAASNALLRLEPSPHDPNIVATFAADS 370

Query: 281 N-VYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
           N + + D+R  + P+ ++ GH  S+  +++ P +  +L S   D +++ WDL
Sbjct: 371 NKIIILDMRNPETPVLTLQGHSSSLNQIKWHPTERNILLSCADDCQVLYWDL 422

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 54/277 (19%), Positives = 101/277 (36%), Gaps = 65/277 (23%)

Query: 26  MMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLRQELLIGTLTTDNEP--------- 76
           + +D ++E  +T+    +QWLP+  +PR++       + L I TL  +N           
Sbjct: 158 LTWDKITECNVTYSISKMQWLPSHPKPRKLATSS---ESLRIWTLNDENNTLNETINLSL 214

Query: 77  -NYLKIAAIDLPENVTSSKPSVSDDAKENELSH--------------------------- 108
             Y K   +++    T+S   +SD    + L                             
Sbjct: 215 CKYKKQHHMNIKAVATNSGNPLSDAVPNDILGEFPPITSFHWNPIDTNLLISSSIDTTCI 274

Query: 109 ----RQSKIKIVRKFKHEQEVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIAS 164
                 S     +   H+ EV   R++ QS  + A+  G G V +FD  ++   H  I  
Sbjct: 275 IWDLESSNYVKTQLIAHDSEVFDVRFLTQSTQLFASCGGDGSVRVFD--LRSLAHSTII- 331

Query: 165 FSYHKENGYGLAFNPTVSGQLLS--------------ASDDGTVALWDVTSTANKSPSQT 210
             Y        + +   S  LL               A+D   + + D+ +   ++P  T
Sbjct: 332 --YEPPAQMDPSSSAAASNALLRLEPSPHDPNIVATFAADSNKIIILDMRNP--ETPVLT 387

Query: 211 FDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNS 247
              H+  +N  KWH  + ++  + ++D  ++  D NS
Sbjct: 388 LQGHSSSLNQIKWHPTERNILLSCADDCQVLYWDLNS 424

>TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.276
           YPL247C
          Length = 598

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 76/346 (21%), Positives = 139/346 (40%), Gaps = 83/346 (23%)

Query: 22  SNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLRQELLIGTLTTDNEPNYLKI 81
           SN  + ++ V+E  +T+P   +QWLP+   PR+               L T +E   L+I
Sbjct: 190 SNDLLTWEKVAECNVTYPVSNIQWLPSVPNPRK---------------LATSSE--CLRI 232

Query: 82  AAIDLPENVTSSKPSVSDDAKENELSHRQSKIKIVRKFKHEQEVTRARYMPQSPNIIATL 141
            ++D   + +    SV ++   N   H   K    +    +  ++  +Y  Q   I  + 
Sbjct: 233 WSLD---DNSMDNSSVFNNNISNNSRHNTYK----KSLTEQVNLSLCKYNEQHQIINNST 285

Query: 142 NGAGIVYIFDRNIKEKDHGAIAS-----FSYHKENGYGLAFNPTVSGQLLSASDDGTVAL 196
           N           +  K +  +        S+H        +N   +  L+S+S D T  +
Sbjct: 286 NS----------VSNKSNARLLGQLPPVTSFH--------WNSIDTNLLISSSIDTTCIV 327

Query: 197 WDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSV 256
           WD+ S +N   +Q    H   V D K+    + LF +   D ++ + D    RA+Q  ++
Sbjct: 328 WDLQS-SNYVKTQLI-AHDSEVFDVKFLIQSTQLFASCGGDGSIRVFDL---RALQHSTI 382

Query: 257 -----------------------SSAFNTLAF-------SKRSENLLAAAGTDSN-VYLY 285
                                  +S+ N+L+        S    NL+A  G D   + + 
Sbjct: 383 IYETANDLQGNNTFNNDVTTKIDNSSANSLSHALLRLEPSPTDPNLIATFGLDKKAILIL 442

Query: 286 DLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
           D+R    P+  ++GH  SV  +++ P +  +L S G D +++ WDL
Sbjct: 443 DMRNPGVPVLVLSGHSPSVNQIKWHPSKPYVLLSCGDDCQVLYWDL 488

>Kwal_23.6240 s23 complement(1503990..1506731) [2742 bp, 913 aa]
           {ON} YCR057C (PWP2) - regulatory protein [contig 16]
           FULL
          Length = 913

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 81/169 (47%), Gaps = 8/169 (4%)

Query: 184 QLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIH 243
           ++++AS+DG + +WDV S        TF  HT  V+   + +    LF + S D T+   
Sbjct: 355 RVVTASEDGKIKIWDVVSGF---CLVTFQEHTAAVSALAFAKRGQVLF-SASLDGTVRAW 410

Query: 244 DTNSDRAIQKLSVSS--AFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHE 301
           D    R  +  + +    FN LA     E + A +     V+++ ++  Q  + ++ GHE
Sbjct: 411 DLVRYRNFRTFTAAERIQFNCLAADPSGEVVCAGSVDSFAVHVWSVQTGQ-LVETLDGHE 469

Query: 302 DSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPEL 350
             V+ L FS  ++ +L S+  D+ I +W +F    + +P + Y  V  L
Sbjct: 470 GPVSCLSFS-QENSVLASASWDKTIRIWSIFGRSQQVEPLEVYADVLSL 517

>KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} similar
           to uniprot|P53197 Saccharomyces cerevisiae YGL003C CDH1
           CDC20 homolog 1 protein required for Clb2 and Ase1
           degradation
          Length = 582

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 43/64 (67%), Gaps = 3/64 (4%)

Query: 270 ENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSG--SDRRII 327
           EN LA+ G D+ VY+YD   L++P+ SM  H  +V ++ +SPH  G+L + G  +D+++ 
Sbjct: 413 ENKLASGGNDNMVYVYD-GTLRQPMLSMEEHTAAVKAMAWSPHTRGVLATGGGTADKKLK 471

Query: 328 MWDL 331
           +W++
Sbjct: 472 IWNI 475

>Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 81/185 (43%), Gaps = 22/185 (11%)

Query: 162 IASFSYHKENGYG-----LAFNPTVSGQLLSASDDGTVALWD---VTSTANKSPSQTFDV 213
           +AS+S  + N +G     L   P+    LL+   +G + L D     S  N   S+T   
Sbjct: 1   MASYSLVESNFFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASET--- 57

Query: 214 HTDIVNDCKW--HEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSEN 271
               +ND K    +F +    + +  + + + D  ++  I  +   S    L+   R   
Sbjct: 58  ---AINDLKVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSR-HG 113

Query: 272 LLAAA----GTDSNVYLYDLRRLQKPLHSMA-GHEDSVTSLEFSPHQDGLLTSSGSDRRI 326
           LLA      G D+ V++YD+R+   PL S+   H D VT ++F P    +L S  +D   
Sbjct: 114 LLACGTELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYT 173

Query: 327 IMWDL 331
            ++DL
Sbjct: 174 NIYDL 178

>KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.247
           YKR036C
          Length = 666

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 86/196 (43%), Gaps = 37/196 (18%)

Query: 162 IASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQ--------TFDV 213
           I     HK     L  + T +  ++SA  D TV LW+V        ++        TFD 
Sbjct: 401 IGELKGHKATVNSLQMDLTYN-MVISAGKDATVKLWNVDLGIESFNTERYFNPCIYTFDS 459

Query: 214 HTD-IVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVS------SAFNTL--- 263
           HTD I     +HE   S     S D T+   D  + + IQ L++           T+   
Sbjct: 460 HTDEITAISSYHENLVS----GSRDKTIRQWDLKTGKCIQILNIGFLNSQKELLGTVDPI 515

Query: 264 -------AFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGL 316
                  A   R +  LA  G D  V L+DLR + K + S++GHE+++T+L+F    D L
Sbjct: 516 RSPPPIGALQCR-DAALATGGQDGIVRLWDLR-IGKVVRSLSGHENAITALKF----DDL 569

Query: 317 LTSSGS-DRRIIMWDL 331
              +GS D+  I WDL
Sbjct: 570 HVVTGSLDKTAITWDL 585

>NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {ON}
           Anc_5.429 YDR364C
          Length = 448

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 73/169 (43%), Gaps = 14/169 (8%)

Query: 168 HKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQ 227
           H      L F P     LLS  +D  V +WD     N    + +  H+  +N   +++  
Sbjct: 154 HTNGTTSLTFLPNSGNLLLSGGNDNIVKVWDFYHKRN--LLRDYKGHSKAINSLDFND-D 210

Query: 228 SSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDL 287
            + F + S D+T+ I DT   +   KL   S  N + F   + +       +S +Y YD 
Sbjct: 211 GTNFISSSFDHTIKIWDTEQGKVKTKLHFKSTPNDVKFRPFNSSEFIVGFANSKIYHYDT 270

Query: 288 R------RLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWD 330
           R      R+Q   H M+    S+ +L+F P     ++SS  D+ + +WD
Sbjct: 271 RISENDGRVQVYDHHMS----SILALKFFPDGSKFISSS-EDKTVRIWD 314

 Score = 38.1 bits (87), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 42/96 (43%), Gaps = 14/96 (14%)

Query: 291 QKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPEL 350
           +K  ++M GH +  TSL F P+   LL S G+D  + +WD ++                L
Sbjct: 145 KKIKYAMDGHTNGTTSLTFLPNSGNLLLSGGNDNIVKVWDFYH-------------KRNL 191

Query: 351 FMMHGGHRSPVNEFSHNSNVPWLMCSVEEENVLQIW 386
              + GH   +N    N +    + S   ++ ++IW
Sbjct: 192 LRDYKGHSKAINSLDFNDDGTNFISS-SFDHTIKIW 226

>CAGL0L03201g Chr12 complement(368792..370531) [1740 bp, 579 aa]
           {ON} some similarities with uniprot|P47025 Saccharomyces
           cerevisiae YJL112w MDV1 or uniprot|P36130 Saccharomyces
           cerevisiae YKR036c CAF4 CCR4
          Length = 579

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 74/172 (43%), Gaps = 32/172 (18%)

Query: 185 LLSASDDGTVALWDVTSTANKSPSQ-------TFDVHTDIVNDCKWHEFQSSLFGTVSED 237
           L SA  D +V +WDV +  +K  +        TFD H D V          +   + S D
Sbjct: 338 LASAGKDASVKVWDVDNIVDKDGNANDNLCLATFDGHKDSVTAL---ATTGNAIVSGSND 394

Query: 238 NTLIIHDTNSDRAIQ----------------KLSVSSAFNT--LAFSKRSENLLAAAGTD 279
            TL   D  S + IQ                KL ++ +FNT  +  +   +N L     D
Sbjct: 395 KTLRHWDLGSGKCIQSIDLTIALKMVPQSVSKLDITPSFNTPLIGGADCIDNALVTGTKD 454

Query: 280 SNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
             VYL+DL R+ + + S+ GH   +TSL++   +   L +   D+   +WDL
Sbjct: 455 GIVYLWDL-RIGRVVGSLEGHRGPITSLKYMGSE---LITGSMDKSTRIWDL 502

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 66/157 (42%), Gaps = 20/157 (12%)

Query: 260 FNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTS 319
            N+LA + +   L + A  D+ + L+D+   Q  L  ++GH  +V +  F      LL S
Sbjct: 283 INSLAINAQLGVLSSTANLDNEIKLWDISTTQ-CLGVLSGHRATVNTTRFIDDTR-LLAS 340

Query: 320 SGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPWLMCSVEE 379
           +G D  + +WD+ NI    +  +A D +        GH+  V   +   N    + S   
Sbjct: 341 AGKDASVKVWDVDNI--VDKDGNANDNL--CLATFDGHKDSVTALATTGNA---IVSGSN 393

Query: 380 ENVLQIWK-PANKIVRP----------PQPPADFDIT 405
           +  L+ W   + K ++           PQ  +  DIT
Sbjct: 394 DKTLRHWDLGSGKCIQSIDLTIALKMVPQSVSKLDIT 430

>CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON}
           similar to uniprot|Q12523 Saccharomyces cerevisiae
           YPL247c
          Length = 513

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 78/185 (42%), Gaps = 27/185 (14%)

Query: 177 FNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSE 236
           +NP  +  L+S+S D T  +WD+ S+ N   +Q    H   V D ++    + LF +   
Sbjct: 243 WNPVDTNILISSSIDTTCIVWDLQSS-NYVKTQLI-AHDSEVFDVRFLTQSTQLFASCGG 300

Query: 237 DNTLIIHD---------------------TNSDRAIQKLSVSSAFNTLAFSKRSENLLAA 275
           D ++ + D                      NS R+      S A   L  S    N+LA 
Sbjct: 301 DGSVRVFDLRCLAHSTIIYEPPASEPGTGNNSSRSDSTDENSHALLRLEPSPHDPNVLAT 360

Query: 276 AGTDSN-VYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL--- 331
               SN + + D+R    PL  + GH  S+  +++ P +   L S   D +++ WD+   
Sbjct: 361 FAIASNEILILDMRNPDSPLVVLNGHSASINQIKWHPTKKNTLISCSDDCQVLFWDISSY 420

Query: 332 FNIGA 336
           F+ GA
Sbjct: 421 FDQGA 425

 Score = 33.5 bits (75), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 46/190 (24%), Positives = 74/190 (38%), Gaps = 39/190 (20%)

Query: 121 HEQEVTRARYMPQSPNIIATLNGAGIVYIFDRNI------------KEKDHGAIASFS-Y 167
           H+ EV   R++ QS  + A+  G G V +FD                E   G  +S S  
Sbjct: 278 HDSEVFDVRFLTQSTQLFASCGGDGSVRVFDLRCLAHSTIIYEPPASEPGTGNNSSRSDS 337

Query: 168 HKENGYGL------AFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDC 221
             EN + L        +P V      AS++  + + D+ +    SP    + H+  +N  
Sbjct: 338 TDENSHALLRLEPSPHDPNVLATFAIASNE--ILILDMRNP--DSPLVVLNGHSASINQI 393

Query: 222 KWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSN 281
           KWH  + +   + S+D  ++  D           +SS F+  A S  +    AA+G    
Sbjct: 394 KWHPTKKNTLISCSDDCQVLFWD-----------ISSYFDQGAVSHTTTPRPAASGASME 442

Query: 282 V-----YLYD 286
           V     Y YD
Sbjct: 443 VDSEGDYSYD 452

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 39/83 (46%), Gaps = 4/83 (4%)

Query: 120 KHEQEVTRARYMPQSPNIIATLN-GAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFN 178
           ++   + R    P  PN++AT    +  + I D  ++  D   +   + H  +   + ++
Sbjct: 340 ENSHALLRLEPSPHDPNVLATFAIASNEILILD--MRNPD-SPLVVLNGHSASINQIKWH 396

Query: 179 PTVSGQLLSASDDGTVALWDVTS 201
           PT    L+S SDD  V  WD++S
Sbjct: 397 PTKKNTLISCSDDCQVLFWDISS 419

>Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON}
           similar to Ashbya gossypii AGR067W
          Length = 1132

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 76/152 (50%), Gaps = 11/152 (7%)

Query: 196 LWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNS-DRAIQKL 254
           +W+++ T++ +       H   + D  +H     L  T S D  +   D  S  R     
Sbjct: 95  VWNLSRTSSNAIEYELHGHFRAITDINFHPSHPELLATCSIDTYVHAWDMRSPQRPYYST 154

Query: 255 S-VSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQ 313
           S  S+  + + ++ ++ N+LA++  +S V+++D+R+   PL+ ++G+  SV +++F+  +
Sbjct: 155 SDWSAGASQVKWNLQNANVLASSHANS-VFIWDIRKGCTPLYKLSGNNSSVNNIDFNKVK 213

Query: 314 DGLLTSSGSDRRIIMWD--------LFNIGAE 337
           +  + SS +D  +  WD        LF I AE
Sbjct: 214 ENEIMSSSNDGTVKFWDYSKSSTEPLFTIKAE 245

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 42/79 (53%), Gaps = 4/79 (5%)

Query: 125 VTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQ 184
            ++ ++  Q+ N++A+ + A  V+I+D     K    +   S +  +   + FN     +
Sbjct: 161 ASQVKWNLQNANVLAS-SHANSVFIWD---IRKGCTPLYKLSGNNSSVNNIDFNKVKENE 216

Query: 185 LLSASDDGTVALWDVTSTA 203
           ++S+S+DGTV  WD + ++
Sbjct: 217 IMSSSNDGTVKFWDYSKSS 235

>KLTH0A06380g Chr1 complement(532367..535114) [2748 bp, 915 aa] {ON}
           highly similar to uniprot|P25636 Saccharomyces
           cerevisiae YCR057C PWP2 part of small (ribosomal)
           subunit (SSU) processosome (contains U3 snoRNA) Eight
           WD-repeats with homology with G protein beta subunits
           flanked by nonhomologous N-terminal and C-terminal
           extensions regulatory protein
          Length = 915

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 82/169 (48%), Gaps = 14/169 (8%)

Query: 184 QLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHE-----FQSSLFGTVSEDN 238
           ++++AS+DG + +WDV S        TF  HT  V    + +     F +SL GTV   +
Sbjct: 355 RVVTASEDGKIKIWDVVSGF---CLVTFQEHTSAVTGLAFAKKGQVLFSASLDGTVRAWD 411

Query: 239 TLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMA 298
            +   +  +  A +++     FN LA     E + A +     ++++ ++  Q  + ++ 
Sbjct: 412 LVRYRNFRTFTAAERIQ----FNCLAADPSGEVVCAGSVDSFAIHVWSVQTGQ-LVETLD 466

Query: 299 GHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGV 347
           GHE  V+ L FS  ++ +L S+  D+ I +W +F    + +P + Y  V
Sbjct: 467 GHEGPVSCLSFS-RENSVLASASWDKTIRVWSIFGRSQQVEPLEVYADV 514

>SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {ON}
           highly similar to uniprot|Q75BY3 Ashbya gossypii ACR137W
           PRP46 Pre-mRNA-splicing factor PRP46 and similar to
           YPL151C uniprot|Q12417 Saccharomyces cerevisiae YPL151C
           PRP46 Splicing factor that is found in the Cef1p
           subcomplex of the spliceosome
          Length = 441

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 79/164 (48%), Gaps = 10/164 (6%)

Query: 171 NGY--GLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQS 228
           NG+   +A +P  +    + S+D T+ +WD+ +   K    T   H   V D    +   
Sbjct: 129 NGWVRTVAVDPIDNEWFATGSNDTTIKIWDLATGKLK---LTLSGHIMTVKDICISKRHP 185

Query: 229 SLFGTVSEDNTLIIHDTNSDRAIQKLSVS-SAFNTLAFSKRSENLLAAAGTDSNVYLYDL 287
            +F + SED  +   D   +R I+      S  +T+     + NL+A AG DS V L+D+
Sbjct: 186 YMF-SASEDKLVKCWDLEKNRVIRDYHGHLSGVHTVDIHP-TLNLIATAGRDSVVRLWDI 243

Query: 288 RRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
            R + P+ +MAGH+  +  ++  P  D  + S  +D  + +WD+
Sbjct: 244 -RTKLPVMTMAGHKSPINRVKCLP-VDPQVVSCSADATVRLWDI 285

>Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}
           similar to Ashbya gossypii AER263C
          Length = 542

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 62/244 (25%), Positives = 100/244 (40%), Gaps = 63/244 (25%)

Query: 184 QLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIH 243
           ++ SAS DGT+ +WD   T  +    T   HT  V+  KW   Q  ++ T S D T+   
Sbjct: 277 RIASASKDGTIKVWD---TVRRQCILTLSGHTSSVSCIKWGG-QGVIY-TGSHDRTIRCW 331

Query: 244 DTNSDRA-----------IQKLSVSS--AFNTLAF------------------------S 266
           D N+              +  LS+S+  A    AF                        +
Sbjct: 332 DMNAGGKCINILKSHAHWVNHLSLSTDYALKVGAFDHTYSRPATAEEAQKRALKNYEKVA 391

Query: 267 KRS---ENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDG-LLTSSGS 322
           KR+   E L+A A  D  +YL++  +  KPL  M GH+  V  + FSP  DG  + S+  
Sbjct: 392 KRNGVLEELIATASDDFTMYLWNPLKGTKPLTRMTGHQKLVNHVAFSP--DGRYIVSASF 449

Query: 323 DRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENV 382
           D  I +W+    G+  +                GH + V + + +S+   L+ S  ++  
Sbjct: 450 DNSIKLWE----GSSGK----------FISTFRGHVASVYQVAWSSDCR-LLVSCSKDTT 494

Query: 383 LQIW 386
           L++W
Sbjct: 495 LKVW 498

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 77/169 (45%), Gaps = 16/169 (9%)

Query: 177 FNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSE 236
           F P  S ++++ S D    +WD  +   ++P  T   HT+ V    W      +  T S 
Sbjct: 178 FAPHTSSRMVTGSGDNNARIWDCDT---QTPIYTLKGHTNWVLCVAWSA-DGEVIATGSM 233

Query: 237 DNTLIIHDTNSD-------RAIQKLSVSSAFNTLAF-SKRSENLLAAAGTDSNVYLYDLR 288
           DNT+ + D  +        R   K   S ++  +   +  ++  +A+A  D  + ++D  
Sbjct: 234 DNTIRLWDAQTGDSKGDALRGHSKWITSMSWEPIHLVTPGNKPRIASASKDGTIKVWDTV 293

Query: 289 RLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAE 337
           R Q  L +++GH  SV+ +++     G++ +   DR I  WD+ N G +
Sbjct: 294 RRQCIL-TLSGHTSSVSCIKWGGQ--GVIYTGSHDRTIRCWDM-NAGGK 338

>CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072c
          Length = 517

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 75/164 (45%), Gaps = 15/164 (9%)

Query: 176 AFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVS 235
           AF P  S ++++   D T  +WD  +   ++P  T + H + V    W      +  T S
Sbjct: 152 AFAPHTSSRVVTGGGDNTARIWDCDT---QTPKVTLNGHRNWVLCVSW-SADGEVIATGS 207

Query: 236 EDNTLIIHDTNSD-------RAIQKLSVSSAFNTLAFSK-RSENLLAAAGTDSNVYLYDL 287
            DNT+ + D  S        R   K   S  +  +   +  S+  LA+A  D  + ++D 
Sbjct: 208 MDNTIRLWDAESGKPLGDALRGHSKWITSLTWEPIHLVEPGSKPRLASASKDGTIRIWDS 267

Query: 288 RRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
            R +  L ++ GH +SV+ +++    +G+L S   D+ +  WD+
Sbjct: 268 SR-RVCLMTLGGHTNSVSCVKWG--GEGILYSGSHDKTVRAWDM 308

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 57/249 (22%), Positives = 96/249 (38%), Gaps = 63/249 (25%)

Query: 179 PTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDN 238
           P    +L SAS DGT+ +WD   ++ +    T   HT+ V+  KW      +  + S D 
Sbjct: 247 PGSKPRLASASKDGTIRIWD---SSRRVCLMTLGGHTNSVSCVKWG--GEGILYSGSHDK 301

Query: 239 TLIIHDTNSDRA-----------IQKLSVSS--AFNTLAF-------------------- 265
           T+   D   +             +  LS+S+  A    AF                    
Sbjct: 302 TVRAWDMKQNGKCINILKSHAHWVNHLSLSTDYALRVGAFDYTGVKPANAKEARDKALQN 361

Query: 266 -------SKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDG-LL 317
                  + + E L+  A  D  ++L++  +  KP+  M GH+  V  + FSP  DG  +
Sbjct: 362 YEKVARKNGKHEELMVTASDDFTMFLWNPLKGTKPISRMTGHQKLVNHVAFSP--DGKYI 419

Query: 318 TSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPWLMCSV 377
            S+  D  I +WD    G E                  GH + V + + +S+   L+ S 
Sbjct: 420 VSASFDNSIKLWD----GKEGT----------FLSTFRGHVASVYQVAWSSDCR-LLVSC 464

Query: 378 EEENVLQIW 386
            ++  L++W
Sbjct: 465 SKDTTLKVW 473

>YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}
           TUP1General repressor of transcription, forms complex
           with Cyc8p, involved in the establishment of repressive
           chromatin structure through interactions with histones
           H3 and H4, appears to enhance expression of some genes
          Length = 713

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 53/217 (24%), Positives = 92/217 (42%), Gaps = 18/217 (8%)

Query: 175 LAFNPTVSGQLLS-ASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGT 233
           + F+P   G+ L+  ++D  + +WD+    N+        H   +    +      L  +
Sbjct: 449 VCFSP--DGKFLATGAEDRLIRIWDI---ENRKIVMILQGHEQDIYSLDYFPSGDKLV-S 502

Query: 234 VSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYD------L 287
            S D T+ I D  + +    LS+     T+A S      +AA   D  V ++D      +
Sbjct: 503 GSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLV 562

Query: 288 RRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGS-DRRIIMWDLFNIGAEQQPDDAYDG 346
            RL     S  GH+DSV S+ F+  +DG    SGS DR + +W+L N   +        G
Sbjct: 563 ERLDSENESGTGHKDSVYSVVFT--RDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSG 620

Query: 347 VPELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENVL 383
             E+  +  GH+  V   +   N  +++   ++  VL
Sbjct: 621 TCEVTYI--GHKDFVLSVATTQNDEYILSGSKDRGVL 655

>KLTH0H02134g Chr8 (191540..195439) [3900 bp, 1299 aa] {ON} similar
           to uniprot|P38968 Saccharomyces cerevisiae YDL195W SEC31
           involved in protein transport from endoplasmic reticulum
           to Golgi Component (p150) of COPII coat of secretory
           pathway vesicles
          Length = 1299

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 85/209 (40%), Gaps = 19/209 (9%)

Query: 137 IIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQLLSASDDGTVAL 196
           IIA     G+V  F      ++  ++A  + H      + FN      L S    G + +
Sbjct: 76  IIAGALENGVVEFF----APEEPRSVAKLAQHTTPVKTVTFNARQHNVLCSGGSKGEIYI 131

Query: 197 WDVTS--TANKSP--SQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQ 252
           WD     T   +P    T     D +    W++ Q+ +F +        I D  + + + 
Sbjct: 132 WDANKIETPGYAPFVPGTAMTPMDEIYSLAWNQNQAHVFASAGSSGYASIWDLKAKKEVI 191

Query: 253 KLSVSSAF----NTLAF----SKRSENLLAAAGTDSN--VYLYDLRRLQKPLHSMA-GHE 301
            LS +S      N L+        S  +  A+G DS+  + ++DLR    P+  ++  H 
Sbjct: 192 HLSYASPVTGQRNQLSIVEWHPNNSTRIATASGNDSDPSILIWDLRNANVPMQVLSQPHT 251

Query: 302 DSVTSLEFSPHQDGLLTSSGSDRRIIMWD 330
             V SL++    + LL SSG D   ++W+
Sbjct: 252 KGVLSLDWCKQDETLLLSSGRDNVCVLWN 280

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/186 (22%), Positives = 86/186 (46%), Gaps = 11/186 (5%)

Query: 154 IKEKDHGAIASFSYHKENGYGLAFNPTVSGQL-LSASDDGTVALWDVTSTANKSPSQTFD 212
           +K  ++   A+F++  +    LA   T SG +    S + T+ +W + S    +P  +  
Sbjct: 2   VKLAEYPRTATFAWSYDRSPLLATG-TASGTIDADFSSESTLEIWSLLSPHEATPQASIT 60

Query: 213 VHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSV-SSAFNTLAFSKRSEN 271
                 ND  W    + + G + E+  +        R++ KL+  ++   T+ F+ R  N
Sbjct: 61  ADAKF-NDLDWSHDNAIIAGAL-ENGVVEFFAPEEPRSVAKLAQHTTPVKTVTFNARQHN 118

Query: 272 LLAAAGTDSNVYLYDLRRLQKPLHS--MAGHE----DSVTSLEFSPHQDGLLTSSGSDRR 325
           +L + G+   +Y++D  +++ P ++  + G      D + SL ++ +Q  +  S+GS   
Sbjct: 119 VLCSGGSKGEIYIWDANKIETPGYAPFVPGTAMTPMDEIYSLAWNQNQAHVFASAGSSGY 178

Query: 326 IIMWDL 331
             +WDL
Sbjct: 179 ASIWDL 184

>AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,
           334 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YMR116C (ASC1); 1-intron
          Length = 334

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 91/179 (50%), Gaps = 17/179 (9%)

Query: 171 NGY--GLAFNPTVSGQLLSASDDGTVALWDVTSTANK--SPSQTFDVHTDIVNDCKW-HE 225
           NG+   L+ +P     LLS S D T+  W +T    +   P ++F  H+ IV DC   H+
Sbjct: 33  NGWVTSLSTSPAQPNMLLSGSRDKTLITWKLTGEDQQYGVPVRSFKGHSHIVQDCTVTHD 92

Query: 226 FQSSLFGTVSEDNTLIIHDTNSDRAIQK-LSVSSAFNTLAFSKRSENLLAAAGTDSNVYL 284
            + +L  + S D TL + D  S + I++ +   S   +++   R+  +++A+  D  V +
Sbjct: 93  GKYAL--SASWDKTLRLWDLQSGKCIKRFVGHKSDVMSVSIDPRATQIVSAS-RDKTVKV 149

Query: 285 YDLRRLQKPLHSMAGHEDSVTSLEFSPHQDG----LLTSSGSDRRIIMWDL--FNIGAE 337
           ++   +   + ++ GH D V+++  +P +       + S+G D+ + +WDL  F I A+
Sbjct: 150 WN--TVGDCVVTLLGHNDWVSNVRIAPSEKSDDAVTVISAGMDKVVKVWDLQSFTIEAD 206

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 2/44 (4%)

Query: 296 SMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQ 339
           ++ GH   VTSL  SP Q  +L S   D+ +I W L   G +QQ
Sbjct: 28  TLEGHNGWVTSLSTSPAQPNMLLSGSRDKTLITWKL--TGEDQQ 69

>TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.276
           YPL247C
          Length = 531

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 68/316 (21%), Positives = 134/316 (42%), Gaps = 40/316 (12%)

Query: 26  MMYDFVSETRLTWPSLTVQWLPTEMQPREV----DGQQL--LRQELL-IGTLTTDNEPNY 78
           + ++ V+E  +T+P   +QW+P ++QPR+     D  +L  LR++   I  +   +   Y
Sbjct: 155 LNWNRVAEYNVTYPVSNIQWIPAQLQPRKFATCSDSLRLWSLREDTSSIEEILNLSYCKY 214

Query: 79  LKIAAIDLPENVTSSKPSVSDDAKENELSHRQSKIKIVRKFKHEQEVTRARYMPQSPNII 138
            K+           S+ SV  D              ++ +F     +T   + P   N +
Sbjct: 215 NKLRQNTTTNGTNDSRTSVGVDPS------------VLGQFP---PITSFHWNPIDTNFL 259

Query: 139 --ATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQLLSASDDGTVAL 196
             ++++   IV+    N   K    IA    H    + + F    +    S   DG+V +
Sbjct: 260 ISSSIDTTCIVWDLQSNNYVKTQ-LIA----HDSEVFDVRFLTQSTQLFASCGGDGSVRV 314

Query: 197 WDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSV 256
           +D+ S A          H+ I+ +   +   S+L      D+   ++ ++   ++   S 
Sbjct: 315 FDLRSLA----------HSTIIYESAANTSMSNLSSGGMVDHPGSLNTSSRVGSVDLSSK 364

Query: 257 SSAFNTLAFSKRSENLLAAAGTDSN-VYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDG 315
           S+A   L  S    N++A  G DSN V + D+R    P+ ++ GH   +  +++ P +  
Sbjct: 365 SNALLRLEPSPTDPNVIATFGADSNSVLILDMRNPGTPVLTLDGHSAPINQIKWHPTKKN 424

Query: 316 LLTSSGSDRRIIMWDL 331
            + SS  D +++ W+L
Sbjct: 425 TILSSSDDCQVLYWNL 440

 Score = 31.2 bits (69), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 46/108 (42%), Gaps = 6/108 (5%)

Query: 111 SKIKIVRKFKHEQEVTRARYMPQSPNIIATLNG-AGIVYIFDRNIKEKDHGA-IASFSYH 168
           S++  V        + R    P  PN+IAT    +  V I D     ++ G  + +   H
Sbjct: 354 SRVGSVDLSSKSNALLRLEPSPTDPNVIATFGADSNSVLILDM----RNPGTPVLTLDGH 409

Query: 169 KENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTD 216
                 + ++PT    +LS+SDD  V  W++      SPS+  ++  +
Sbjct: 410 SAPINQIKWHPTKKNTILSSSDDCQVLYWNLNDPLTISPSENGEISAN 457

>KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {ON}
           some similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 725

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/217 (24%), Positives = 93/217 (42%), Gaps = 18/217 (8%)

Query: 175 LAFNPTVSGQLLS-ASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGT 233
           + F+P   G+ L+  ++D  + +WD+T+   +    T   H   +    +      L  +
Sbjct: 454 VCFSP--DGKFLATGAEDKLIRIWDLTT---RRIVMTLQGHEQDIYSLDYFPSGDKLV-S 507

Query: 234 VSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYD------L 287
            S D T+ I D  + +    LS+     T+A S     L+AA   D  V ++D      +
Sbjct: 508 GSGDRTVRIWDLRAGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFLV 567

Query: 288 RRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGS-DRRIIMWDLFNIGAEQQPDDAYDG 346
            RL        GH+DSV S+ F+  +DG    SGS DR + +W+L +         A   
Sbjct: 568 ERLDSENELGTGHKDSVYSVVFT--RDGHGVVSGSLDRSVKLWNLRSANGGSTEGKANTA 625

Query: 347 VPELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENVL 383
             E  + + GH+  V   +   N  +++   ++  VL
Sbjct: 626 ASE--VTYTGHKDFVLSVATTQNDEFILSGSKDRGVL 660

>ZYRO0D08558g Chr4 (736975..739713) [2739 bp, 912 aa] {ON} highly
           similar to uniprot|P25636 Saccharomyces cerevisiae
           YCR057C PWP2 part of small (ribosomal) subunit (SSU)
           processosome (contains U3 snoRNA) Eight WD-repeats with
           homology with G protein beta subunits flanked by
           nonhomologous N-terminal and C-terminal extensions
           regulatory protein
          Length = 912

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 89/185 (48%), Gaps = 15/185 (8%)

Query: 168 HKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHE-- 225
           H ++   L ++P  S ++++ASDDG + +WDV S        T + HT  V   ++ +  
Sbjct: 336 HFDSMNSLTYSPDGS-RVVTASDDGKIKVWDVVSGF---CIVTLEGHTSSVTGIQFAKRG 391

Query: 226 ---FQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNV 282
              F SSL GTV   + +   +     +++++     F  +A     E + A +    ++
Sbjct: 392 QVLFTSSLDGTVRAWDLIRYRNFRVFTSVERIQ----FTCVAVDPSGEVVCAGSTDSFDI 447

Query: 283 YLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDD 342
           +++ ++  Q  +  +AGHE  V+ L FS  +   L S+  DR I +W +F    + +P +
Sbjct: 448 HVWSVQTGQ-LVDQLAGHEGPVSCLSFS-RETSTLASASWDRTIRVWSIFGRSQQVEPIE 505

Query: 343 AYDGV 347
            +  V
Sbjct: 506 VFSDV 510

>KLTH0B01628g Chr2 (129632..132004) [2373 bp, 790 aa] {ON} similar
           to uniprot|P42935 Saccharomyces cerevisiae YGR200C ELP2
           Elongator protein part of the six- subunit RNA
           polymerase II Elongator histone acetyltransferase
           complex target of Kluyveromyces lactis zymocin
          Length = 790

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 82/205 (40%), Gaps = 20/205 (9%)

Query: 143 GAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTST 202
           GAG    F + +     G  A+   H      + F P     +++AS+D  V LW     
Sbjct: 33  GAGKTIAFWKPLDPAHRGVYATLKGHDAEVTCVRFVPGTEF-MITASEDSQVRLWAFDGE 91

Query: 203 ANKSPS--QTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRA------IQKL 254
            N + +  Q+ D H   +         S+L      D ++ +   N  +       + K 
Sbjct: 92  DNSAMACIQSTDHHKHTITSLS---VLSNLLTVGCADGSVSVWQINERQISLVHSFVLKA 148

Query: 255 SVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLH------SMAGHEDSVTSLE 308
            V      L   + S+ LLA  GT+SNV++Y   R    L       ++ GHED + +++
Sbjct: 149 GVFPLCMALKSVEDSKVLLAVGGTNSNVFIYSFTREAAALENFQLAATLEGHEDWIKAMD 208

Query: 309 FSPHQDG--LLTSSGSDRRIIMWDL 331
           F     G  LL +   DR I +W +
Sbjct: 209 FYEEGPGNMLLATGSQDRYIRLWRI 233

>KNAG0J01680 Chr10 (307280..308476) [1197 bp, 398 aa] {ON} Anc_8.672
           YPL151C
          Length = 398

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 78/158 (49%), Gaps = 8/158 (5%)

Query: 175 LAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTV 234
           +A  P  +   ++ S+D T+ +WD+ S   K    T   HT  V D    E    +F + 
Sbjct: 92  VAVEPVDNEWFVTGSNDTTLKVWDLASGKLK---LTLSGHTMGVRDVAVSERHPYMF-SA 147

Query: 235 SEDNTLIIHDTNSDRAIQKLSVS-SAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKP 293
           SED  +   D   + AI+      S  +T+     + +L+A  G D+ V L+D+ R +K 
Sbjct: 148 SEDKLVKCWDLEKNTAIRDYYGHLSGVHTVDIHP-TLDLIATGGRDAVVKLWDI-RTRKA 205

Query: 294 LHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
           + ++ GH+  +T ++ +P  D  + SS +D  + +WD+
Sbjct: 206 VKTLVGHKAPITKVKCTP-VDPQVVSSSTDTTVRLWDI 242

>Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}
           similar to Ashbya gossypii ADL218C
          Length = 409

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 60/242 (24%), Positives = 109/242 (45%), Gaps = 30/242 (12%)

Query: 171 NGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEF---Q 227
           + + L   P  S  LLSA  +G V L D  S    +  Q   VH   ++  K  +     
Sbjct: 14  DNWCLKLQPLYSRGLLSALSNGHVHLIDWNSL---TSIQDIPVHGTSISALKVLDNDVDS 70

Query: 228 SSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGT-----DSNV 282
            + F T SED ++ I D   ++ +   +V +A N+   S  S + + A GT     D+ +
Sbjct: 71  GNTFVTASED-SVKIFDLRLNQCVA--TVQNAKNSPFISLDSRHGMLACGTELSGTDAEI 127

Query: 283 YLYDLRRLQKPLHSMA-GHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPD 341
           +LYDL+++  P+ S    H D +T ++F      +L S  +D  + ++DL     +Q+ +
Sbjct: 128 HLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDL----KQQEEE 183

Query: 342 DAYDGVPELFMMHG-GHRSPVNEFSHNSNVPWLMCSVEEENVLQIWKPANKIVRPPQPPA 400
           +A   V     +H  G  SP           W +  +E  ++ ++   ++++V P   P 
Sbjct: 184 EALHQVINFASIHSCGWLSP--------KRIWALSHMETFSIHELNDKSDELVEP--KPL 233

Query: 401 DF 402
           +F
Sbjct: 234 EF 235

>KLTH0E08162g Chr5 complement(749584..751254) [1671 bp, 556 aa] {ON}
           similar to uniprot|P53197 Saccharomyces cerevisiae
           YGL003C CDH1 CDC20 homolog 1 protein required for Clb2
           and Ase1 degradation
          Length = 556

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 44/64 (68%), Gaps = 3/64 (4%)

Query: 270 ENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSG--SDRRII 327
           EN LA+ G D+ V++YD    +KP+ ++A H  +V ++ +SPH+ G+L + G  +D+R+ 
Sbjct: 387 ENQLASGGNDNVVFVYDGTS-RKPILTLAEHTAAVKAMAWSPHRRGVLATGGGTADKRLK 445

Query: 328 MWDL 331
           +W++
Sbjct: 446 IWNV 449

>KLLA0F21406g Chr6 complement(1996260..1998377) [2118 bp, 705 aa]
           {ON} similar to uniprot|P47025 Saccharomyces cerevisiae
           YJL112W MDV1 WD repeat protein that regulates steps in
           the Dnm1p-dependent process of mitochondrial fission
          Length = 705

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/204 (25%), Positives = 81/204 (39%), Gaps = 47/204 (23%)

Query: 159 HGAIASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDV----------TSTANKSPS 208
           HG +AS S  + + Y           L++   D  + LWD+          +S  N +  
Sbjct: 437 HGHLASISCMQIDQYS---------TLITGGRDAVLKLWDIDKAMADEASNSSEDNDACL 487

Query: 209 QTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAF-------- 260
            TFD H D +       F      + S+D T+   D NS +  Q + +S A         
Sbjct: 488 YTFDSHVDEITAI---SFDGDNLVSGSQDRTVRQWDLNSGKCTQTIDISFATGPMRSQRN 544

Query: 261 ----NTLAFSKRS---------ENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSL 307
               N++  +K           +  LA    D  V L+DLR   K +  + GH D++TSL
Sbjct: 545 IPLRNSVLLTKEPPAIGALQCFDAALATGTKDGIVRLWDLRS-GKVVRMLEGHTDAITSL 603

Query: 308 EFSPHQDGLLTSSGSDRRIIMWDL 331
           +F       L +   DR I +WDL
Sbjct: 604 QFDSVN---LVTGAMDRSIRIWDL 624

>SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]
           {ON} highly similar to uniprot|Q75AV4 Ashbya gossypii
           ADL184W PSF2 Polyadenylation factor subunit 2 and
           similar to YNL317W uniprot|P42841 Saccharomyces
           cerevisiae YNL317W PFS2 Integral subunit of the pre-mRNA
           cleavage and polyadenylation factor (CPF) complex plays
           an essential role in mRNA 3'-end formation by bridging
           different processing factors and thereby promoting the
           assembly of the processing complex
          Length = 459

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/237 (22%), Positives = 94/237 (39%), Gaps = 22/237 (9%)

Query: 168 HKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQ 227
           H E    ++F+ T S + ++ SDD  + +W+    +N    +    H   V  C WH   
Sbjct: 164 HMECVRDVSFSGTDS-KFVTCSDDNILKIWNF---SNGQQERVLSGHHWDVKSCDWHPTM 219

Query: 228 SSLFGTVSEDNTLIIHDTNSDRAIQK-LSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYD 286
             L  + S+DN + + D  S + I   L          F     NLLA    D +  ++D
Sbjct: 220 G-LIVSGSKDNLIKLWDPRSGQCISTILGFKHTIIKTKFQPTKGNLLAVVAKDKSCKIFD 278

Query: 287 LRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDG 346
           +R+  K L S     D + SL + P  + + T    D  +  +DL     +    +++  
Sbjct: 279 IRQNMKELKSFRDESDYM-SLTWHPINESIFTVGCYDGSLKHFDLLQ---DTGSSNSFHD 334

Query: 347 VPELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENVLQIWKPANKIVRPPQPPADFD 403
           +P        H   +   S+N  V  ++ S  ++  ++ W  +      P  P  FD
Sbjct: 335 IPY------AHDKCITSLSYNP-VGHILASASKDRTIRFWTRSR-----PMDPNAFD 379

>NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363
          Length = 621

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 73/159 (45%), Gaps = 19/159 (11%)

Query: 235 SEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYD------LR 288
           S D ++ I D  + +    LS+     T+A S     L+AA   D +V ++D      + 
Sbjct: 402 SGDRSIRIWDLKTGQCSLTLSIEDGVTTVAVSPNEGKLIAAGSLDRSVRIWDSSTGFLVE 461

Query: 289 RLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGS-DRRIIMWDLFNIGAEQQPDDAYDGV 347
           RL     S  GH+DSV S+ F+  +DG    SGS DR + +W+L          D   G 
Sbjct: 462 RLDSDNESGNGHQDSVYSVAFT--KDGQHVVSGSLDRTVKLWNL---------GDTQSGT 510

Query: 348 PELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENVLQIW 386
            +  + + GH+  V   + +++  ++    ++  V+ IW
Sbjct: 511 GKCEVTYIGHKDFVLSVATSNDDKYIFSGSKDRGVI-IW 548

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 56/231 (24%), Positives = 103/231 (44%), Gaps = 36/231 (15%)

Query: 153 NIKEKDHGAIASFSYHKENGYGLAFNPTVSGQ-LLSASDDGTVALWDVTSTANKSPSQTF 211
           NIKE+    +     H+++ Y L + P   GQ L+S S D ++ +WD+ +      S T 
Sbjct: 369 NIKERK--IVMVLKGHEQDIYSLDYFP--DGQKLVSGSGDRSIRIWDLKT---GQCSLTL 421

Query: 212 DVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSS--------AFNTL 263
            +  D V        +  L    S D ++ I D+++   +++L   +        +  ++
Sbjct: 422 SIE-DGVTTVAVSPNEGKLIAAGSLDRSVRIWDSSTGFLVERLDSDNESGNGHQDSVYSV 480

Query: 264 AFSKRSENLLAAAGTDSNVYLYDLRRLQ----KPLHSMAGHEDSVTSLEFSPHQDGLLTS 319
           AF+K  +++++ +  D  V L++L   Q    K   +  GH+D V S+  S + D  + S
Sbjct: 481 AFTKDGQHVVSGS-LDRTVKLWNLGDTQSGTGKCEVTYIGHKDFVLSVATS-NDDKYIFS 538

Query: 320 SGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNV 370
              DR +I+WD              D    + M+ G   S ++  + NSNV
Sbjct: 539 GSKDRGVIIWD-------------KDSGNPILMLQGHRNSVISVATVNSNV 576

>Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}
           YPL247C (REAL)
          Length = 522

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 69/315 (21%), Positives = 119/315 (37%), Gaps = 55/315 (17%)

Query: 117 RKFKHEQEVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLA 176
           R  + +  ++  +Y  Q P   AT +   ++  F           I SF +         
Sbjct: 210 RHLQEQVNLSLCKYNRQHPTSPATADDMKVIGTFP---------PITSFDW--------- 251

Query: 177 FNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSE 236
            N   +  ++S+S D T  +WD+ S+           H   V D ++    + LF +   
Sbjct: 252 -NTVDTNLIISSSIDTTCIVWDLQSS--HYVKTQLIAHDSEVFDVRFLTKSTQLFASCGG 308

Query: 237 DNTLIIHDT--------------------NSDRAIQKLSVSSAFNTLAFSKRSENLLAAA 276
           D ++ + D                     N+      L  S A   L  S    N+LA  
Sbjct: 309 DGSVRVFDLRSLAHSTIIYEPPSSPASGPNAGATTPSLKGSDALLRLEPSPYDPNVLATF 368

Query: 277 GTDSN-VYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIG 335
             DSN + + D+R  + P+ ++ GH  SV  +++ P +  +L S   D + + WDL N  
Sbjct: 369 AADSNKIIILDMRNPESPILNLEGHTCSVNEIKWHPTKRNVLLSCSDDCQALYWDLNNSF 428

Query: 336 AEQQPDDAY----------DGVPELFMMHGGHRSPVNEFSHNSNVPWLMC-SVEEENVLQ 384
            E    D+           D   +  M  GG ++   E   NSN    +C +++  N++ 
Sbjct: 429 MEINGSDSKSPTASGASLEDSDGDTVMADGGAKANQQEDPLNSNNDKQVCRTLDTPNMMY 488

Query: 385 IWKPA--NKIVRPPQ 397
           + K    N I   PQ
Sbjct: 489 VNKTQEINNIAWRPQ 503

>Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON}
           YCR084C (REAL)
          Length = 713

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/217 (24%), Positives = 92/217 (42%), Gaps = 18/217 (8%)

Query: 175 LAFNPTVSGQLLS-ASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGT 233
           + F+P   G+ L+  ++D  + +WD+    N+        H   +    +      L  +
Sbjct: 449 VCFSP--DGKFLATGAEDRLIRIWDI---ENRKIVMILQGHEQDIYSLDYFPSGDKLV-S 502

Query: 234 VSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYD------L 287
            S D T+ I D  + +    LS+     T+A S      +AA   D  V ++D      +
Sbjct: 503 GSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLV 562

Query: 288 RRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGS-DRRIIMWDLFNIGAEQQPDDAYDG 346
            RL     S  GH+DSV S+ F+  +DG    SGS DR + +W+L N   +        G
Sbjct: 563 ERLDSENESGTGHKDSVYSVVFT--RDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSG 620

Query: 347 VPELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENVL 383
             E+  +  GH+  V   +   N  +++   ++  VL
Sbjct: 621 TCEVTYI--GHKDFVLSVATTQNDEYILSGSKDRGVL 655

>TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.544
           YBR198C
          Length = 812

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/180 (28%), Positives = 87/180 (48%), Gaps = 10/180 (5%)

Query: 159 HGAIASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIV 218
           H A+ S+  H    + + F+P +     +AS D T  LW   S  +  P + F  H + V
Sbjct: 557 HTALVSYKGHNHPIWDVQFSP-LGHYFATASHDQTARLW---SCDHIFPLRIFAGHLNDV 612

Query: 219 NDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQK-LSVSSAFNTLAFSKRSENLLAAAG 277
           +   +H     +F T S D T  + D ++  +++  L  +SA  + A S      L    
Sbjct: 613 DCVSFHPNGYYVF-TGSSDKTCRMWDISTGDSVRLFLGHTSAVVSTAVSPDGR-WLTTGS 670

Query: 278 TDSNVYLYDLRRLQKPLHSMAGH-EDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGA 336
            D  + ++D+    K L S+ GH +++V SL +S  +  LL SSG+D+ + +WDLF   A
Sbjct: 671 DDGTINVWDIGS-GKRLKSLRGHGKNAVYSLTYS-KEGNLLVSSGADQSVRVWDLFKPSA 728

>ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 808

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 69/149 (46%), Gaps = 18/149 (12%)

Query: 235 SEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPL 294
           S+   L I D    + ++ + +SS  + +  S  +  LLA  GTD ++ + D+       
Sbjct: 79  SQAQLLKIFDLREGKIVRSMKISSP-SYVVDSDSTSTLLAIGGTDGSITVVDVEN-GYVT 136

Query: 295 HSMAGHEDSVTSLEFSPHQDG---LLTSSGSDRRIIMWDLFN---IGAEQQPDDAYDGV- 347
           HS+ GH  +++S++F   Q+G   LL S  ++  + +WDL     I   Q+   A  G+ 
Sbjct: 137 HSLKGHGGTISSVKFYGEQNGEVWLLASGDTNGMVKIWDLVKRKCIHTVQEHTAAVRGID 196

Query: 348 ---------PELFMMHGGHRSPVNEFSHN 367
                     ELF++ GG    +N +  N
Sbjct: 197 FHESKNNDESELFLISGGRDDVINYWQFN 225

>Kpol_1014.19 s1014 complement(30466..31824) [1359 bp, 452 aa] {ON}
           complement(30466..31824) [1359 nt, 453 aa]
          Length = 452

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 71/150 (47%), Gaps = 7/150 (4%)

Query: 183 GQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLII 242
           G ++SAS D  + LWD  S    S    F  HT  V   ++   + +L   +S+D +  +
Sbjct: 221 GLIVSASKDNLIRLWDPRSGQCISSLLNFK-HT--VLKTRFQPTKGNLLTAISKDKSCRV 277

Query: 243 HDT-NSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYD-LRRLQKPLHSMA-G 299
            D  +S R +        + TL +   +E +   A  D ++  +D L+ L+KP H +   
Sbjct: 278 FDIRHSMRELMVYRDEVDYMTLEWHPTNETMFTVASYDGSLKHFDILQDLEKPTHVVPYA 337

Query: 300 HEDSVTSLEFSPHQDGLLTSSGSDRRIIMW 329
           H+  +TSL ++P    +L S+  DR I  W
Sbjct: 338 HDKCITSLSYNP-VGHILASAAKDRTIRFW 366

 Score = 35.4 bits (80), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 69/148 (46%), Gaps = 7/148 (4%)

Query: 185 LLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHD 244
           ++S   DGT+ +W       K   +    HT+ + D  + +   S F T ++DN L I +
Sbjct: 139 MISGDADGTIKIWQPNFNMVK---EIDGAHTEGIRDIAFSK-NDSKFVTCADDNVLKIWN 194

Query: 245 TNSDRAIQKLSVSSAFNTLAFSKRSE-NLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDS 303
            ++ +  + LS    ++  +     E  L+ +A  D+ + L+D R  Q  + S+   + +
Sbjct: 195 FSNGQQERVLS-GHHWDVKSCDWHPEMGLIVSASKDNLIRLWDPRSGQC-ISSLLNFKHT 252

Query: 304 VTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
           V    F P +  LLT+   D+   ++D+
Sbjct: 253 VLKTRFQPTKGNLLTAISKDKSCRVFDI 280

>SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {ON}
           similar to uniprot|Q12523 Saccharomyces cerevisiae
           YPL247C Hypothetical ORF
          Length = 415

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/246 (20%), Positives = 102/246 (41%), Gaps = 41/246 (16%)

Query: 125 VTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLA-------- 176
           VTR +++P+    +AT + +  ++    +++E+ + ++  +S         A        
Sbjct: 111 VTRCQWLPKGGGKLATCSDSLRIWSVGDSLQEQLNLSLCKYSKQSNGSTASAALGSLPPV 170

Query: 177 ----FNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFG 232
               +N   +  ++S+S D T  +WD+ S+ N   +Q    H   V D K+    + LF 
Sbjct: 171 TSFDWNSVDTNLIISSSIDTTCTVWDLQSS-NYVKTQLI-AHDSEVYDVKFLTNSTQLFA 228

Query: 233 TVSEDNTL-------IIHDTNSDRAIQKLSVSS-------------------AFNTLAFS 266
           +   D ++       + H T     +  L+  +                   A   L  S
Sbjct: 229 SCGGDGSVRVFDLRCLAHSTIIYEPLAGLTSGTVKSSGEGNVGGNEDGTNHTALLRLEPS 288

Query: 267 KRSENLLAAAGTDSN-VYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRR 325
               N++A    DSN V + D+R    P+ ++ GH  +V  + + P Q  +L + G D +
Sbjct: 289 PFDPNVVATFTQDSNAVLILDMRYPGSPILTLEGHSSAVNQMRWHPTQRNVLLTCGDDCQ 348

Query: 326 IIMWDL 331
           ++ WD+
Sbjct: 349 VLYWDI 354

 Score = 33.9 bits (76), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 34/155 (21%), Positives = 55/155 (35%), Gaps = 36/155 (23%)

Query: 121 HEQEVTRARYMPQSPNIIATLNGAGIVYIFD-------------------RNIKEKDHGA 161
           H+ EV   +++  S  + A+  G G V +FD                     +K    G 
Sbjct: 210 HDSEVYDVKFLTNSTQLFASCGGDGSVRVFDLRCLAHSTIIYEPLAGLTSGTVKSSGEGN 269

Query: 162 IASFSYHKENGYGLA---------FNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFD 212
           +       E+G             F+P V        D   V + D+      SP  T +
Sbjct: 270 VGG----NEDGTNHTALLRLEPSPFDPNVVATF--TQDSNAVLILDMRYPG--SPILTLE 321

Query: 213 VHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNS 247
            H+  VN  +WH  Q ++  T  +D  ++  D NS
Sbjct: 322 GHSSAVNQMRWHPTQRNVLLTCGDDCQVLYWDINS 356

>SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|Q750X9 Ashbya gossypii AGL190W
           AGL190Wp and similar to YDR142C uniprot|P39108
           Saccharomyces cerevisiae YDR142C PEX7 May serve as
           intraperoxisomal receptor for type 2 peroxisomal
           proteins (such as thiolase) Member of
           beta-transducin-related (WD- 40) protein family
          Length = 368

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/236 (22%), Positives = 96/236 (40%), Gaps = 46/236 (19%)

Query: 136 NIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQLLSASDDGTVA 195
           N +    G G + +FD N+ +     I+ F  H++  +   +N       +S+S DGTV 
Sbjct: 74  NQVLAAQGDGSLRLFDINLPQY---PISIFQEHQKEVFSCNWNLVNKQTFVSSSWDGTVK 130

Query: 196 LWD--------------------VTSTANKSPSQTFDVHT------DIVNDCKWHEFQSS 229
           +W                     V + A   P      H+      D +   ++     +
Sbjct: 131 IWSPMRQESLTTLVPIPMERSPLVEAKAGGIPLSNQQNHSIISKNKDCIYQAQFSPHDPN 190

Query: 230 LFGTVSEDNTLIIHD----TNSDRAIQKLSVSSAFNTLA--FSKRSENLLAAAGTDSNVY 283
           L    + ++ + + D    TN+++  Q         TL   F+K   +++A  G D  V 
Sbjct: 191 LIMCCAGNSYVTLFDLRQPTNTNQ--QNFMSHGGLETLTCDFNKYRPHIVATGGVDKLVK 248

Query: 284 LYDLRR-------LQKPL--HSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWD 330
           ++DLR        LQ+P+  + + GHE ++  + +SPH   L+ S+  D    +WD
Sbjct: 249 IWDLRMVRKFSNPLQQPMSINEIPGHELAIRKVSWSPHHSNLVLSTSYDMTCRVWD 304

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 64/264 (24%), Positives = 113/264 (42%), Gaps = 37/264 (14%)

Query: 141 LNGAGIVYIFDRNIKEKDHG-AIASFSYHKENG-YGLAFNPTVSGQLLSASDDGTVALWD 198
           L G G ++I D +     HG  + S S+  ++G + +A+N   + Q+L+A  DG++ L+D
Sbjct: 34  LVGNGKLFILDID----PHGRMVESNSFLTQDGLFDVAWNEGHANQVLAAQGDGSLRLFD 89

Query: 199 VTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSS 258
           +     + P   F  H   V  C W+      F + S D T+ I       ++  L    
Sbjct: 90  I--NLPQYPISIFQEHQKEVFSCNWNLVNKQTFVSSSWDGTVKIWSPMRQESLTTLVPIP 147

Query: 259 AFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHS-MAGHEDSVTSLEFSPHQDGLL 317
                   +RS  + A AG         L   Q   HS ++ ++D +   +FSPH   L+
Sbjct: 148 M-------ERSPLVEAKAGG------IPLSNQQN--HSIISKNKDCIYQAQFSPHDPNLI 192

Query: 318 TSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPWLMCSV 377
                +  + ++DL      +QP +      + FM HGG  +   +F  N   P ++ + 
Sbjct: 193 MCCAGNSYVTLFDL------RQPTNTNQ---QNFMSHGGLETLTCDF--NKYRPHIVATG 241

Query: 378 EEENVLQIW--KPANKIVRPPQPP 399
             + +++IW  +   K   P Q P
Sbjct: 242 GVDKLVKIWDLRMVRKFSNPLQQP 265

>Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {ON}
           complement(43719..47660) [3942 nt, 1314 aa]
          Length = 1313

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 44/92 (47%), Gaps = 4/92 (4%)

Query: 136 NIIATLNGAGIVYIFDRNIKEK-DHGAIASFSYHKENGYGLAFNPTVSGQLLSASDDGTV 194
           N IA  N + I+ I+D N  +  D+  + SFS H        FN T +  L+S   DG +
Sbjct: 197 NYIAVCNNSTIISIYDINKNDNIDNPLVTSFSEHSRAVNSFDFNMTQTSLLISGGQDGQI 256

Query: 195 ALWDVTS---TANKSPSQTFDVHTDIVNDCKW 223
            +WD+ S   + +  P    +  +D + D KW
Sbjct: 257 KIWDLRSNSLSGSNKPDLNINAASDSIRDVKW 288

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 72/150 (48%), Gaps = 13/150 (8%)

Query: 224 HEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVY 283
           HEF        S+ N+L   + N ++  +++ +S+  +  +  ++  N +A     + + 
Sbjct: 153 HEFTQGFSSGSSQLNSL---NPNLNKRRRQIKLSTIADVKSGFQKYNNYIAVCNNSTIIS 209

Query: 284 LYDLRR---LQKPL-HSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLF--NIGAE 337
           +YD+ +   +  PL  S + H  +V S +F+  Q  LL S G D +I +WDL   ++   
Sbjct: 210 IYDINKNDNIDNPLVTSFSEHSRAVNSFDFNMTQTSLLISGGQDGQIKIWDLRSNSLSGS 269

Query: 338 QQPD----DAYDGVPELFMMHGGHRSPVNE 363
            +PD     A D + ++  M G + S  N+
Sbjct: 270 NKPDLNINAASDSIRDVKWMPGYNFSSFNQ 299

>ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL317W (PFS2)
          Length = 449

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/221 (21%), Positives = 91/221 (41%), Gaps = 20/221 (9%)

Query: 184 QLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIH 243
           + ++ SDD  + +W+ +   N    +    H   V  C WH  +  L  + S+DN + + 
Sbjct: 177 KFVTCSDDNVLKIWNFS---NGQQERVLSGHHWDVKSCDWHP-KMGLIVSGSKDNLIKLW 232

Query: 244 DTNSDRAIQK-LSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHED 302
           D  + R +   L +        F     NLLA    D ++ +YD+R+  + L ++    D
Sbjct: 233 DPRTGRNVSTILGLKHTVIKTKFQPTQGNLLAVVSKDKSIKIYDMRQHMRELQTIRDDMD 292

Query: 303 SVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVN 362
            + SL + P  + + +    +  I  +DL +        D  +  P    +   H   V 
Sbjct: 293 YM-SLSWHPINETIFSVGCYNGAIKHFDLLH--------DNSNSTPACHTIPYAHEKSVT 343

Query: 363 EFSHNSNVPWLMCSVEEENVLQIWKPANKIVRPPQPPADFD 403
             ++ S V  ++ S  ++  ++ W  +    RP  P A FD
Sbjct: 344 SLAY-SPVGHILASAAKDRTIRFWARS----RPVDPNA-FD 378

>Kpol_1061.6 s1061 complement(19407..20762) [1356 bp, 451 aa] {ON}
           complement(19407..20762) [1356 nt, 452 aa]
          Length = 451

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 63/133 (47%), Gaps = 8/133 (6%)

Query: 207 PSQ---TFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTL 263
           PSQ   + + H   +   KW++  + +F T S DN++ I +TN    +Q + +    N +
Sbjct: 162 PSQEEDSLESHKYSIRTLKWYKDDNGMFFTGSYDNSVKIWNTNEFVPVQDIKLEHKVNQI 221

Query: 264 AFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDS-----VTSLEFSPHQDGLLT 318
             S +  N+L  A  D +  L DL  +   L S+    +S     +   +F+P +  ++ 
Sbjct: 222 DCSYQGTNMLVVATDDYHPRLIDLNNMNLGLTSLGNANNSEMKSPILCCKFNPQRTNIVA 281

Query: 319 SSGSDRRIIMWDL 331
           +   + ++ +WDL
Sbjct: 282 TGDENGQVKLWDL 294

>NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON}
           Anc_1.399
          Length = 327

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/200 (24%), Positives = 95/200 (47%), Gaps = 18/200 (9%)

Query: 141 LNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVT 200
           L  AG   +   +I+  +  A+A+F  HK N   ++F    +  ++++S+DGT+ +WDV 
Sbjct: 67  LAAAGYQNVRLYDIRTTNPNAVATFEGHKGNVTSVSFQQD-NKWMVTSSEDGTIKVWDV- 124

Query: 201 STANKSPSQTFDV-HTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKL---SV 256
               +SPS   +  H   VN+   H  Q  L  +   D T+ I D   ++   +L     
Sbjct: 125 ----RSPSVPRNYKHNAPVNEVVIHPNQGELI-SCDRDGTIKIWDLGENQCTHQLIPDDD 179

Query: 257 SSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQ-----KPLHSMAGHEDSVTSLEFSP 311
           +++  +L+ +    ++L AA    + Y++++         KP++  + H+D +T +  S 
Sbjct: 180 NTSLQSLSVASDG-SMLVAANNKGDCYVWEMPNHTDASNLKPINKFSAHKDYITRVVLSS 238

Query: 312 HQDGLLTSSGSDRRIIMWDL 331
               + T S +DR   +W +
Sbjct: 239 DVKHMATCS-ADRTAKIWSV 257

>KAFR0E03900 Chr5 complement(771649..772968) [1320 bp, 439 aa] {ON}
           Anc_5.429 YDR364C
          Length = 439

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 82/197 (41%), Gaps = 8/197 (4%)

Query: 165 FSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWH 224
           FS H      + F P      LS  +D  V +WD     ++   + +  HT  +    ++
Sbjct: 142 FSGHSSGTTCMKFIPNTGHLFLSGGNDNIVKIWDFYH--DRKSLRDYRGHTKAIKSMSFN 199

Query: 225 EFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYL 284
           +  +  F T S D T+ + DT + +  ++L   S  N + F   + +       DS +  
Sbjct: 200 D-DAHNFITSSFDQTVKLWDTETGQVKKRLKFKSTPNCVEFRPANNHEFIVGLADSKIAH 258

Query: 285 YDLRRLQKP--LHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWD-LFNIGAEQQPD 341
           YD R   K   + +   H  S+ SL F P     ++SS  D+ + +W+   NI  +Q  D
Sbjct: 259 YDTRESSKHGLVQTYDHHLGSILSLRFFPDGSKFISSS-EDKTVRIWENQINIPIKQISD 317

Query: 342 DAYDGVPELFMMHGGHR 358
                +P    +H  H+
Sbjct: 318 TTQYSMP-FIGIHPEHK 333

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 21/39 (53%)

Query: 295 HSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFN 333
           +  +GH    T ++F P+   L  S G+D  + +WD ++
Sbjct: 140 YKFSGHSSGTTCMKFIPNTGHLFLSGGNDNIVKIWDFYH 178

>Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON}
           YCR084C (REAL)
          Length = 700

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 53/217 (24%), Positives = 92/217 (42%), Gaps = 18/217 (8%)

Query: 175 LAFNPTVSGQLLS-ASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGT 233
           + F+P   G+ L+  ++D  + +WD+    N+        H   +    +      L  +
Sbjct: 453 VCFSP--DGKFLATGAEDRLIRIWDI---ENRKIVMILQGHEQDIYSLDYFPSGDKLV-S 506

Query: 234 VSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYD------L 287
            S D T+ I D  + +    LS+     T+A S      +AA   D  V ++D      +
Sbjct: 507 GSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLV 566

Query: 288 RRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGS-DRRIIMWDLFNIGAEQQPDDAYDG 346
            RL     S  GH+DSV S+ F+  +DG    SGS DR + +W+L N   +        G
Sbjct: 567 ERLDSENESGTGHKDSVYSVVFT--RDGESVVSGSLDRSVKLWNLQNANNKSDSKTPNSG 624

Query: 347 VPELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENVL 383
             E+  +  GH+  V   +   N  +++   ++  VL
Sbjct: 625 TCEVTYI--GHKDFVLSVATTQNDEYILSGSKDRGVL 659

>CAGL0A00605g Chr1 complement(67281..69203) [1923 bp, 640 aa] {ON}
           similar to uniprot|P53197 Saccharomyces cerevisiae
           YGL003c CDH1 substrate-specific activator of
           APC-dependent proteolysis
          Length = 640

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 71/144 (49%), Gaps = 10/144 (6%)

Query: 191 DGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTN-SDR 249
           +G V ++DVT    +   +T   H D V    W+     +  + S D T++  D   +D 
Sbjct: 397 NGIVEIYDVT---KEKCIRTLSGHLDRVACLSWNNH---ILSSGSRDRTILHRDVRMADP 450

Query: 250 AIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEF 309
             +K+              ++N LA+ G D+ V++YD    + P  S+  H+ +V ++ +
Sbjct: 451 FFEKIETHEQEICGLKWNTNDNKLASGGNDNMVFVYDGTS-RTPFLSINEHKAAVKAMAW 509

Query: 310 SPHQDGLLTSSG--SDRRIIMWDL 331
           SPH+ G+L + G  +DR + MW++
Sbjct: 510 SPHKQGILATGGGTADRTLKMWNV 533

>Ecym_4717 Chr4 (1407391..1409202) [1812 bp, 603 aa] {ON} similar to
           Ashbya gossypii AAR078W
          Length = 603

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 85/176 (48%), Gaps = 15/176 (8%)

Query: 166 SYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVT-STANKSPSQTFDVHTDIVNDCKWH 224
           ++H +    L+ N      L S S D T+ LWD+   TA +S +   +  T  V+  +WH
Sbjct: 307 THHTDAVLSLSHNKQYRVVLASTSADQTIKLWDLNQGTAVRSIASIHNGTT--VSSSQWH 364

Query: 225 EFQSSLFGTVSEDNTLIIHDT--NSDRAIQK---LSVSSAFNTLAFSKRSENLLAAAGTD 279
               S+  T + D+ + + D   ++D  + K   +        ++F   +E L   AGTD
Sbjct: 365 PSDGSIILTGAYDSRVALSDVRISNDSEMSKYWSVMTGEEVECVSFVNDNEFL---AGTD 421

Query: 280 S-NVYLYDLRRLQK--PLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRII-MWDL 331
           S N+Y +DLR  +K  PL ++  H+  ++S+  +     ++ SS    ++I +W +
Sbjct: 422 SGNIYSFDLRNGEKSSPLWTLKAHDSGISSMNVNSFIPNMMVSSAMGEKVIKLWKI 477

>ZYRO0A03234g Chr1 (258942..260183) [1242 bp, 413 aa] {ON} similar
           to uniprot|Q12021 Saccharomyces cerevisiae YDR030C RAD28
           Protein involved in transcription-coupled repair
           nucleotide excision repair of UV-induced DNA lesions
           homolog of human CSA protein
          Length = 413

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 82/193 (42%), Gaps = 15/193 (7%)

Query: 208 SQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSK 267
           SQ+   H   +  C+W +  + +F T S D ++ + DTNS  A+  + V    N +    
Sbjct: 139 SQSRPGHRYGIRSCQWFKLDNGMFFTGSNDLSVQLWDTNSLEAVHSVDVGHRVNQI---D 195

Query: 268 RSENLLAAAGTDSNVYLYDLRRLQKPLHSMAG---HEDSVTSLEFSPHQDGLLTSSGSDR 324
            +++ +  A  D    L DLR      H  +G   HE  + ++  +P +  ++ +  S+ 
Sbjct: 196 TTDHCIVVATEDGYPRLIDLRNPTGITHLGSGTMPHE--MLTVHCNPQKTHIVATGDSNG 253

Query: 325 RIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENVLQ 384
            I +WDL      Q   + Y   P        H S   + + NSN   L  SV  +  + 
Sbjct: 254 SIKLWDLRK--RNQLLMEVYHDTPR----KRAHLSYCQDLAWNSNGSQLA-SVGADGRIY 306

Query: 385 IWKPANKIVRPPQ 397
           IW P N+  R  Q
Sbjct: 307 IWSPFNQSHRASQ 319

>Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa]
           {ON} YCR084C (TUP1) - glucose repression regulatory
           protein, exhibits similarity to beta subunits of G
           proteins [contig 17] FULL
          Length = 750

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/206 (24%), Positives = 86/206 (41%), Gaps = 15/206 (7%)

Query: 185 LLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHD 244
           L + ++D  + +WD+   A +    T   H   +    +      L  + S D T+ I D
Sbjct: 485 LATGAEDKLIRIWDL---ATRRIVMTLQGHEQDIYSLDYFPSGDKLV-SGSGDRTVRIWD 540

Query: 245 TNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYD------LRRLQKPLHSMA 298
             + +    LS+     T+A S     L+AA   D  V ++D      + RL        
Sbjct: 541 LRTGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVERLDSENELGT 600

Query: 299 GHEDSVTSLEFSPHQDGLLTSSGS-DRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGH 357
           GH+DSV S+ F+  +DG    SGS DR + +W+L +         A     E  + + GH
Sbjct: 601 GHKDSVYSVVFT--RDGHGVVSGSLDRSVKLWNLRSANGGTAEGKANTAASE--VTYTGH 656

Query: 358 RSPVNEFSHNSNVPWLMCSVEEENVL 383
           +  V   +   N  +++   ++  VL
Sbjct: 657 KDFVLSVATTQNDEFILSGSKDRGVL 682

>Skud_7.536 Chr7 complement(874704..877070) [2367 bp, 788 aa] {ON}
           YGR200C (REAL)
          Length = 788

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 64/247 (25%), Positives = 106/247 (42%), Gaps = 29/247 (11%)

Query: 126 TRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQL 185
           T+   + ++  I+A   GAG        I+  + G  A+   H+     + F P  S  +
Sbjct: 18  TQVSDLHKAKKIVAF--GAGKTIALWNPIEPNNQGVYATLKGHEAEVTCVRFIPE-SQFM 74

Query: 186 LSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLII--H 243
           +SAS+D  V +W  T  ++    QT + ++  +          +L      D T+ +   
Sbjct: 75  VSASEDHHVKIWKFTDYSHLQCVQTIEHYSKTIVALT---ALPNLISVGCADGTITLWRQ 131

Query: 244 DTNSDR--AIQKLSVSSAFN---TLAFSKRSEN--LLAAAGTDSNVYLYDLRRLQKPLHS 296
           DT +D+     K ++   F     L+ SK  EN  LLA  GT+++V++         + +
Sbjct: 132 DTQNDQFSLAHKFTIKRGFFYPLCLSLSKVQENKYLLAIGGTNTHVFIASFVLDNAGIEN 191

Query: 297 ------MAGHEDSVTSLEFSPHQ----DGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDG 346
                 + GHED V SL F  HQ    D LL S   DR I +W    I A    DD+ + 
Sbjct: 192 CQIVAELEGHEDWVKSLAFR-HQETPGDYLLCSGSQDRYIRLW---RIRANDLIDDSEED 247

Query: 347 VPELFMM 353
             +L ++
Sbjct: 248 SKKLTLL 254

>KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.399
           YNL006W
          Length = 303

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 89/200 (44%), Gaps = 15/200 (7%)

Query: 141 LNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVT 200
           L  AG   +   +I+  +   +ASF  HK N   L+F    +  ++S+S+DGT+ +WDV 
Sbjct: 47  LAAAGHQNVRLYDIRTTNPNPVASFEGHKGNVTSLSFQQD-NKWMVSSSEDGTIKVWDV- 104

Query: 201 STANKSPSQTFDV-HTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSA 259
               +SPS   +  H   VN+   H  Q  L  +   D  + I D   ++   +L+    
Sbjct: 105 ----RSPSIPRNYKHNAPVNEVVIHPNQGELI-SCDRDGNIRIWDLGENQCTHQLTPEDD 159

Query: 260 FNTLAFSKRSE-NLLAAAGTDSNVYLYDLRRLQ-----KPLHSMAGHEDSVTSLEFSPHQ 313
               + S  S+ ++L AA T  N +++++         KP+     H D +T +  S   
Sbjct: 160 IPLQSISVASDGSMLVAANTKGNCFVWEMPNHTDASNLKPVTKFKAHNDYITRILLSSDV 219

Query: 314 DGLLTSSGSDRRIIMWDLFN 333
             L T S +D    +W + N
Sbjct: 220 KHLATCS-ADHTTRVWSIDN 238

>TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa]
           {ON} Anc_2.283 YNL035C
          Length = 403

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 81/170 (47%), Gaps = 15/170 (8%)

Query: 171 NGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHT---DIVNDCKWHEFQ 227
           N + L F P  +  LL++  +G +++ D  +   K   +  +      +IVN+     + 
Sbjct: 14  NNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVNN----NYN 69

Query: 228 SSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRS-ENLLAA----AGTDSNV 282
                  + + ++ I+D  S+  I+  ++++  N+   S  S  N++A     +G D+ +
Sbjct: 70  GGSLMVTATNESVKIYDLKSNDCIK--TITNEKNSPFLSLDSLHNMMACGTELSGVDAEL 127

Query: 283 YLYDLRRLQKPLHSMA-GHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
           Y+YD+R    P+ S    H D +T ++F P+   +L S  +D    ++DL
Sbjct: 128 YIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDL 177

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 46/107 (42%), Gaps = 5/107 (4%)

Query: 147 VYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKS 206
           +YI+D  I+  D    +    H ++   + F+P  S  L+S S DG   ++D+T T  + 
Sbjct: 127 LYIYD--IRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEED 184

Query: 207 PSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQK 253
                 ++   ++ C W    S    T+S   T  IH  N    + K
Sbjct: 185 SLHQV-INYSSIHSCGW--LSSRRIFTLSHMETFAIHQLNDKSEVLK 228

>KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {ON}
           Anc_8.672 YPL151C
          Length = 417

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 76/158 (48%), Gaps = 8/158 (5%)

Query: 175 LAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTV 234
           +A +P  +    + S+D T+ +WD  S   K    T   H   V D    +    +F + 
Sbjct: 114 IAMDPVDNEWFATGSNDSTIKVWDFASGKLK---LTLSGHVMGVRDLVVSKRHPYMF-SA 169

Query: 235 SEDNTLIIHDTNSDRAIQK-LSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKP 293
           SED  +   D   +  I+      S  +T+     + +L+A+AG DS V L+D+R  +K 
Sbjct: 170 SEDKLVKCWDLEKNAPIRDYFGHLSGVHTVDIHP-TLSLIASAGRDSVVKLWDIRS-KKA 227

Query: 294 LHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
           + ++ GH+  + S++ +P  D  + S  +D  +I WDL
Sbjct: 228 VITLVGHKSPINSVKCTP-ADPQIISCSNDTTVITWDL 264

>ZYRO0B02486g Chr2 complement(199474..201201) [1728 bp, 575 aa] {ON}
           similar to uniprot|P21304 Saccharomyces cerevisiae
           YLR196W PWP1
          Length = 575

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 82/172 (47%), Gaps = 11/172 (6%)

Query: 166 SYHKENGYGLAFNPTVSGQLLSASDDGTVALWDV-TSTANKSPSQTFDVHTDI-VNDCKW 223
           ++H +    LA N      L S S D TV LWD+   TA +S +    +H+   V+  +W
Sbjct: 285 THHTDAILSLALNKHFRAVLASTSADHTVKLWDLNNGTAARSLAS---IHSGKNVSSSEW 341

Query: 224 HEFQSSLFGTVSEDNTLIIHD---TNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDS 280
           H+   S+  T   D+ + + D   ++  +  +  SV       + +   EN++ +     
Sbjct: 342 HKTNGSVLLTSGYDSRVALSDVRISDESQLSKYWSVLPGEEVESSTFADENIILSGTDSG 401

Query: 281 NVYLYDLRR--LQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSG-SDRRIIMW 329
           NVY +D+R     KP+ ++  H+  ++ L  + +  G++T+S   D+ + +W
Sbjct: 402 NVYAFDIRNNSGSKPVWTLNAHDAGISCLCANDYIPGMMTTSAMGDKTVKLW 453

>AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR084C (TUP1)
          Length = 629

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 71/161 (44%), Gaps = 13/161 (8%)

Query: 185 LLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHD 244
           L + ++D  + +WD+T+   K    T   H   +    +      L  + S D T+ I D
Sbjct: 367 LATGAEDKLIRIWDLTT---KKILMTLQGHEQDIYSLDYFPAGDKLV-SGSGDRTVRIWD 422

Query: 245 TNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYD------LRRLQKPLHSMA 298
             + +    LS+     T+A S      +AA   D  V ++D      + RL        
Sbjct: 423 LRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWDSETGFLVERLDSENELST 482

Query: 299 GHEDSVTSLEFSPHQDGLLTSSGS-DRRIIMWDLFNIGAEQ 338
           GH+DSV S+ F+  +DG    SGS DR + +WDL  +  ++
Sbjct: 483 GHKDSVYSVVFT--RDGQGVISGSLDRSVKLWDLRGLNGQK 521

>AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR072C
          Length = 513

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 78/168 (46%), Gaps = 15/168 (8%)

Query: 176 AFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVS 235
           AF P  S ++++ + D T  +WD  +   ++P  T   H++ V    W      +  T S
Sbjct: 148 AFAPHTSSRMVTGAGDNTARIWDCDT---QTPLCTLKGHSNWVLCVAW-SADGEVIATGS 203

Query: 236 EDNTLIIHDT-------NSDRAIQKLSVSSAFNTLAFSKRSEN-LLAAAGTDSNVYLYDL 287
            D T+ + D+       ++ R   K   S ++  +   K  E   LA+A  D  + ++D 
Sbjct: 204 MDATIRLWDSEKGQSLGDALRGHTKWITSLSWEPIHLVKPGEKPRLASASKDGTIKIWDT 263

Query: 288 RRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIG 335
            R +  +++++GH  SV+ +++      +L S+  DR +  WD+   G
Sbjct: 264 TR-RVCIYTLSGHTSSVSCIKWGGRN--VLYSASHDRTVRCWDMAAGG 308

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 56/244 (22%), Positives = 95/244 (38%), Gaps = 63/244 (25%)

Query: 184 QLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIH 243
           +L SAS DGT+ +WD T    +    T   HT  V+  KW     ++  + S D T+   
Sbjct: 248 RLASASKDGTIKIWDTT---RRVCIYTLSGHTSSVSCIKWG--GRNVLYSASHDRTVRCW 302

Query: 244 DTNSDRA-----------IQKLSVSSAF--------------------------NTLAFS 266
           D  +              +  LS+S+ +                          N    +
Sbjct: 303 DMAAGGKCINILKSHAHWVNHLSLSTDYALRMGPFDHTGTKPASPEDAQARALRNYEKVA 362

Query: 267 KRS---ENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDG-LLTSSGS 322
           K++   E L+     D  +YL++  +  KP+  M GH+  V  + FSP  DG  + S+  
Sbjct: 363 KKNGTMEELMVTGSDDFTMYLWNPLKGSKPILRMTGHQKLVNHVAFSP--DGRYIVSASF 420

Query: 323 DRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENV 382
           D  I +W            D  DG  +      GH + V + + +S+   L+ S  ++  
Sbjct: 421 DNSIKLW------------DGRDG--KFIATFRGHVASVYQVAWSSDCR-LLVSCSKDTT 465

Query: 383 LQIW 386
           L++W
Sbjct: 466 LKVW 469

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 71/155 (45%), Gaps = 11/155 (7%)

Query: 178 NPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSED 237
           N T+   +++ SDD T+ LW+        P      H  +VN   +         + S D
Sbjct: 365 NGTMEELMVTGSDDFTMYLWN--PLKGSKPILRMTGHQKLVNHVAFSP-DGRYIVSASFD 421

Query: 238 NTLIIHDTNSDRAIQKLS--VSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLH 295
           N++ + D    + I      V+S +  +A+S     LL +   D+ + ++D+ + +K   
Sbjct: 422 NSIKLWDGRDGKFIATFRGHVASVYQ-VAWSSDCR-LLVSCSKDTTLKVWDV-KTRKLTV 478

Query: 296 SMAGHEDSVTSLEFSPHQDG-LLTSSGSDRRIIMW 329
            + GH D V ++++S   DG  + S G D+ + +W
Sbjct: 479 DLPGHNDEVYTVDWS--VDGKRVCSGGKDKMVRLW 511

>Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035C -
           Hypothetical ORF [contig 27] FULL
          Length = 407

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 47/203 (23%), Positives = 90/203 (44%), Gaps = 16/203 (7%)

Query: 159 HGAIASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTD-- 216
           +  + S ++  +N + L   P  +  LL++  +G+V L D       S  Q         
Sbjct: 3   YSKVDSINFGADN-WCLKLQPLYNRGLLASLSNGSVQLIDWVKNKQISQIQAHGTTISDM 61

Query: 217 -IVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAA 275
            ++N+ + + F   L  T +ED ++ I D  S   +  L    +   L+   R   L   
Sbjct: 62  VVLNNDRNNGF---LIATAAED-SVKIFDLRSSDTVATLKNEKSAPFLSLDSRHGMLACG 117

Query: 276 ---AGTDSNVYLYDLRRLQKPLHSMA-GHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
              +G D+ +++YD++   +PL S+   H D +T+++F P    +L S  +D  + ++DL
Sbjct: 118 TELSGVDAELHIYDMKAWHQPLRSLVDSHHDDITNIKFHPTDPNVLLSGSTDGYVNIYDL 177

Query: 332 FNIGAEQQPDDAYDGVPELFMMH 354
                + + DDA   V     +H
Sbjct: 178 ----TQPEEDDALHQVINFASIH 196

>CAGL0A04037g Chr1 complement(404063..405814) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P21304 Saccharomyces
           cerevisiae YLR196w PWP1
          Length = 583

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 82/174 (47%), Gaps = 15/174 (8%)

Query: 166 SYHKENGYGLAFNPTVSGQLLSASDDGTVALWDV-TSTANKSPSQTFDVHTDI-VNDCKW 223
           ++H +    LA N      L S S D TV LWD+  +TA +S +   ++H++  V+  +W
Sbjct: 287 THHTDAVLSLAHNRQFRTVLASTSADHTVKLWDLNNATAARSMA---NIHSNKNVSSSQW 343

Query: 224 HEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAF-----NTLAFSKRSENLLAAAGT 278
           H   +S+  T   D+   + D       Q     S        T  F+  SEN++     
Sbjct: 344 HMQNASILLTAGYDSRAALTDVRISDEAQMSKYWSVLPGEEIETATFA--SENIILCGTD 401

Query: 279 DSNVYLYDLRRLQ--KPLHSMAGHEDSVTSLEFSPHQDGLL-TSSGSDRRIIMW 329
             NVY +D+R  +  KP+ ++  H+  ++SL  +    G++ T +  ++++ +W
Sbjct: 402 AGNVYSFDIRNNEGSKPVWTLKAHDAGISSLSCNRFISGMMATGAMGEKQVKLW 455

>TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {ON}
           Anc_1.247 YKR036C
          Length = 709

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 71/172 (41%), Gaps = 33/172 (19%)

Query: 160 GAIASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVN 219
             + +F  H +    L+F+   SG L+S S D TV  WD+TS       QT D+      
Sbjct: 489 ACVYTFDSHVDEITALSFD---SGHLVSGSQDRTVRQWDLTSG---KCLQTIDL------ 536

Query: 220 DCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTD 279
                 F   L  T S   + ++  T++   I  L    A             LA    D
Sbjct: 537 -----SFAGRLSQTSSNSGSGLLTSTDTSPIIGALQCFDA------------ALATGTRD 579

Query: 280 SNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
             V L+DLR   K + ++ GH  +VTSL+F       L +   DR + +WDL
Sbjct: 580 GAVRLWDLRS-GKIIRTLEGHTGAVTSLKFDSKN---LITGSLDRSVRIWDL 627

>AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL247C
          Length = 438

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 57/220 (25%), Positives = 88/220 (40%), Gaps = 46/220 (20%)

Query: 121 HEQEVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPT 180
           H+ EV  A+++ QS N+ A+  G G V +FD  ++   H  I    Y  +          
Sbjct: 207 HDSEVFDAKFLTQSSNLFASCGGDGSVRVFD--LRCLAHSTII---YEPQQ--------Q 253

Query: 181 VSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTL 240
           V GQ                     +PSQT  VHT        HE    L     + N+ 
Sbjct: 254 VQGQ---------------------TPSQT-QVHTLAA-----HEQDGQL-----QKNSQ 281

Query: 241 IIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYL-YDLRRLQKPLHSMAG 299
               ++S  +      + A   L  S    N+LA    DSNV +  D+R    P+  + G
Sbjct: 282 SSALSSSASSSLGALDNCALLRLEPSPFDPNILATIQQDSNVVIILDMRYPGSPMLLLEG 341

Query: 300 HEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQ 339
           H   V  L++ P +  +L + G D +I+ WDL  + +  Q
Sbjct: 342 HAAPVNQLKWHPSKPNVLATCGDDCQILYWDLLELLSASQ 381

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 44/217 (20%), Positives = 78/217 (35%), Gaps = 60/217 (27%)

Query: 218 VNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAI--QKLSVSSAFNTLAFSKRSENLLAA 275
           V    W+   ++L    S D T  + D  +   +  Q ++  S      F  +S NL A+
Sbjct: 167 VTSFDWNALDTNLILFSSIDTTCTVWDLQASNYVKTQLIAHDSEVFDAKFLTQSSNLFAS 226

Query: 276 AGTDSNVYLYDLRRL-------------------QKPLHSMAGHED-------------- 302
            G D +V ++DLR L                   Q  +H++A HE               
Sbjct: 227 CGGDGSVRVFDLRCLAHSTIIYEPQQQVQGQTPSQTQVHTLAAHEQDGQLQKNSQSSALS 286

Query: 303 -------------SVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPE 349
                        ++  LE SP    +L +   D  +++            D  Y G P 
Sbjct: 287 SSASSSLGALDNCALLRLEPSPFDPNILATIQQDSNVVI----------ILDMRYPGSPM 336

Query: 350 LFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENVLQIW 386
           L +   GH +PVN+   + + P ++ +  ++  +  W
Sbjct: 337 LLLE--GHAAPVNQLKWHPSKPNVLATCGDDCQILYW 371

>ZYRO0C03124g Chr3 complement(240321..241658) [1338 bp, 445 aa] {ON}
           highly similar to uniprot|Q75AV4 Ashbya gossypii ADL184W
           PSF2 Polyadenylation factor subunit 2 and similar to
           YNL317W uniprot|P42841 Saccharomyces cerevisiae YNL317W
           PFS2 Integral subunit of the pre-mRNA cleavage and
           polyadenylation factor (CPF) complex plays an essential
           role in mRNA 3'-end formation by bridging different
           processing factors and thereby promoting the assembly of
           the processing complex
          Length = 445

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 66/287 (22%), Positives = 115/287 (40%), Gaps = 35/287 (12%)

Query: 121 HEQEVTRARYMPQSPNIIATLNGAGIVYIFDRN---IKEKDHGAIASFSYHKENGYGLAF 177
           H+  VT   Y  ++ + + + +  G + I+  N   +KE D         H E    +AF
Sbjct: 122 HDTAVTTMEY-SRAGDWMISGDTDGTIKIWQPNFNMVKELDRA-------HTECIRDIAF 173

Query: 178 NPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSED 237
           +   S + ++ SDD  + +W+    +N    +    H   V  C WH  Q  L  + S+D
Sbjct: 174 SHNDS-KFVTCSDDNILKIWNF---SNGQQERVLSGHHWDVKSCDWHP-QMGLIASASKD 228

Query: 238 NTLIIHDTNSDRAIQKL-SVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHS 296
           N + + D  S + +  L           F     NL+AA   D +  ++DLR+  K L  
Sbjct: 229 NLVKLWDPRSGQCVSTLLKFKHTVLKTKFQPTQGNLMAAISKDKSCRVFDLRQSMKELMV 288

Query: 297 MAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGG 356
                D +T L + P  + + T +  D  +  +D+      Q  +     +P        
Sbjct: 289 TRDEVDYMT-LLWHPINETMFTVACYDGSLKNFDIL-----QDTEGPTHTIPY------A 336

Query: 357 HRSPVNEFSHNSNVPWLMCSVEEENVLQIWKPANKIVRPPQPPADFD 403
           H   +   S+N  V  ++ S  ++  ++ W  A    RP  P A FD
Sbjct: 337 HDKCITSLSYNP-VGHILASASKDRTIRFWTRA----RPYDPNA-FD 377

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 49/94 (52%), Gaps = 16/94 (17%)

Query: 297 MAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGG 356
           M  H+ +VT++E+S   D ++ S  +D  I +W         QP+  ++ V EL   H  
Sbjct: 119 MQAHDTAVTTMEYSRAGDWMI-SGDTDGTIKIW---------QPN--FNMVKELDRAHTE 166

Query: 357 HRSPVNEFSHNSNVPWLMCSVEEENVLQIWKPAN 390
               +  FSHN +  ++ CS  ++N+L+IW  +N
Sbjct: 167 CIRDI-AFSHNDS-KFVTCS--DDNILKIWNFSN 196

>Ecym_7028 Chr7 (52132..52136,52211..54083) [1878 bp, 625 aa] {ON}
           similar to Ashbya gossypii AER114W
          Length = 625

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 55/226 (24%), Positives = 93/226 (41%), Gaps = 23/226 (10%)

Query: 126 TRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQL 185
           T  +Y+  S N  A+  GA  V   +   K  D   I  F  H        F+P     +
Sbjct: 42  TNGKYI--SINWNASGGGAFAVVPVEEIGKAPDQ--IPLFRGHTAQILDTDFDPFNDQII 97

Query: 186 LSASDDGTVALWDVTS-------------TANKSPSQTFDVHTDIVNDCKWHEFQSSLFG 232
            S+SDD  +A+W++ S             T + +P +    HT  V    +H   S++  
Sbjct: 98  ASSSDDTKIAIWEIPSDYSFHNAQDEDGNTKDVTPVKFLMGHTRKVGHVLYHPTASNILA 157

Query: 233 TVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQK 292
           + S D+T+ I +  +   +  L       +++FS   +  LA    D  + ++D+R+ Q+
Sbjct: 158 SSSLDHTVRIWNVETGETVIILKHPDMVTSMSFSYNGD-YLATCCRDKKLRVWDIRK-QE 215

Query: 293 PLHSMAGHEDSVTSLEFSPHQDGLLTSSG----SDRRIIMWDLFNI 334
            +    GH                L ++G    SDR+I +WD FNI
Sbjct: 216 VVSEGQGHSSPKNQRVVWLGNSDRLATTGFSKLSDRQIGVWDAFNI 261

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 46/101 (45%), Gaps = 10/101 (9%)

Query: 291 QKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL-----FNIGAEQQPDDAYD 345
           Q PL    GH   +   +F P  D ++ SS  D +I +W++     F+  A+ +  +  D
Sbjct: 73  QIPL--FRGHTAQILDTDFDPFNDQIIASSSDDTKIAIWEIPSDYSFH-NAQDEDGNTKD 129

Query: 346 GVPELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENVLQIW 386
             P  F+M  GH   V    ++     ++ S   ++ ++IW
Sbjct: 130 VTPVKFLM--GHTRKVGHVLYHPTASNILASSSLDHTVRIW 168

>TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON}
           Anc_3.22 YOL138C
          Length = 1310

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 59/249 (23%), Positives = 99/249 (39%), Gaps = 47/249 (18%)

Query: 91  TSSKPSVSDDAKENELS--HRQSKIKIVRKFKHEQEVTRARYMPQSPNIIATLNGAGIVY 148
           T++  S+S+ A  + L+  HRQ K+  +   K               N +A    + ++ 
Sbjct: 155 TTASSSISNAAVSSNLNKRHRQLKLSTIADVKTG--------FNNYKNYVAICAKSTVIS 206

Query: 149 IFDRNIKEK-DHGAIASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDV-TSTANKS 206
           I+D N  EK D   I S+S H        FN   S  L+S   DG + +WD+ T + N S
Sbjct: 207 IYDINKAEKLDKTLITSYSEHTRAVNSFDFNMVDSNLLISGGQDGCIKIWDLRTGSLNGS 266

Query: 207 PSQTFDVHT--DIVNDCKW---HEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFN 261
                +++T  D + D KW   + F S              H + +    +K +    F 
Sbjct: 267 TRSDININTASDSIRDVKWMPGYNFAS--------------HGSATANLRRKNNSGYKF- 311

Query: 262 TLAFSKRSENLLAAAGTDSNVYL-YDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSS 320
                        A+  DS + L +D+R+       +  H      L + P+QD ++T  
Sbjct: 312 -------------ASIHDSGLLLKFDIRQPSHAERKINAHTGPGLCLNWHPNQDYIVT-G 357

Query: 321 GSDRRIIMW 329
           G D +  +W
Sbjct: 358 GRDGKCCLW 366

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 54/117 (46%), Gaps = 21/117 (17%)

Query: 236 EDNTL-IIH---DTNSDRAIQKLSVSSAFN---------TLAFSKRS----ENLLAAAGT 278
           ED T+ +IH   DT +  +I   +VSS  N         T+A  K      +N +A    
Sbjct: 142 EDKTISLIHNFTDTTASSSISNAAVSSNLNKRHRQLKLSTIADVKTGFNNYKNYVAICAK 201

Query: 279 DSNVYLYDLRRLQKP----LHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331
            + + +YD+ + +K     + S + H  +V S +F+     LL S G D  I +WDL
Sbjct: 202 STVISIYDINKAEKLDKTLITSYSEHTRAVNSFDFNMVDSNLLISGGQDGCIKIWDL 258

>Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {ON}
           similar to Ashbya gossypii AGL234W
          Length = 646

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 71/161 (44%), Gaps = 13/161 (8%)

Query: 185 LLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHD 244
           L + ++D  + +WD++S   K    T   H   +    +      L  + S D T+ I D
Sbjct: 384 LATGAEDKLIRIWDLSS---KKILMTLQGHEQDIYSLDYFPAGDKLV-SGSGDRTVRIWD 439

Query: 245 TNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYD------LRRLQKPLHSMA 298
             + +    LS+     T+A S      +AA   D  V ++D      + RL        
Sbjct: 440 LRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWDSETGFLVERLDSENELST 499

Query: 299 GHEDSVTSLEFSPHQDGLLTSSGS-DRRIIMWDLFNIGAEQ 338
           GH+DSV S+ F+  +DG    SGS DR + +WDL  +  ++
Sbjct: 500 GHKDSVYSVVFT--RDGRSVVSGSLDRSVKLWDLRGLNGQK 538

>TPHA0C00860 Chr3 (180116..181252) [1137 bp, 378 aa] {ON} Anc_8.316
           YDR142C
          Length = 378

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 55/226 (24%), Positives = 91/226 (40%), Gaps = 39/226 (17%)

Query: 141 LNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVT 200
           L G G ++I D  I E+      +    ++  + L++N     Q+L A  DG++ L+D  
Sbjct: 35  LVGNGKLFILD--IDERGKIKENNIFITQDCLFDLSWNELHENQVLVAQGDGSLRLFD-- 90

Query: 201 STANKSPSQTFDVHTDIVNDCKWHEFQSSLF------GTV------------------SE 236
           +T  K P   F  H   V  C W+      F      G V                  SE
Sbjct: 91  TTLQKYPIGIFKEHKKEVLSCNWNLITKGTFVSSSWDGAVKMWSPLREQSLLTLLPKSSE 150

Query: 237 DNTLIIHD--------TNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLR 288
            ++ I H+         N++++   L          FS    NL+A    +S + L+D R
Sbjct: 151 QSSKINHNQIAKIPPHVNNNQSTPILQNKDCVYQAQFSPHDNNLIACCSGNSYITLFDTR 210

Query: 289 RLQKPL--HSMAGHEDSVT-SLEFSPHQDGLLTSSGSDRRIIMWDL 331
                   +S   H    T +L+F+ ++  +L SSG+D  I +WD+
Sbjct: 211 EQNNRFNNNSFIAHSGLETLTLDFNKYRPTVLASSGADNSIKIWDM 256

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/274 (20%), Positives = 107/274 (39%), Gaps = 60/274 (21%)

Query: 136 NIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQLLSASDDGTVA 195
           N +    G G + +FD  +++     I  F  HK+      +N    G  +S+S DG V 
Sbjct: 75  NQVLVAQGDGSLRLFDTTLQKY---PIGIFKEHKKEVLSCNWNLITKGTFVSSSWDGAVK 131

Query: 196 LWD------VTSTANKSPSQTFDVH----------------------TDIVNDCKWHEFQ 227
           +W       + +   KS  Q+  ++                       D V   ++    
Sbjct: 132 MWSPLREQSLLTLLPKSSEQSSKINHNQIAKIPPHVNNNQSTPILQNKDCVYQAQFSPHD 191

Query: 228 SSLFGTVSEDNTLIIHDT-------NSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDS 280
           ++L    S ++ + + DT       N++  I    + +   TL F+K    +LA++G D+
Sbjct: 192 NNLIACCSGNSYITLFDTREQNNRFNNNSFIAHSGLETL--TLDFNKYRPTVLASSGADN 249

Query: 281 NVYLYDLRRLQ------------KPL---HSMAGHEDSVTSLEFSPHQDGLLTSSGSDRR 325
           ++ ++D+R ++             P+        H+ +V  + +SPHQ  LL S+  D  
Sbjct: 250 SIKIWDMRMIRNNNSNNTVMPTSNPICMNEIRKAHDLAVRRVVWSPHQSNLLLSTSYDMT 309

Query: 326 IIMWDLFN-----IGAEQQPDDAYDGVPELFMMH 354
             +W  F+     I  +    D   G+ + F  H
Sbjct: 310 SKVWKDFSFDGSKITGKTNSIDPGSGLIKTFHHH 343

 Score = 33.9 bits (76), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 43/228 (18%), Positives = 85/228 (37%), Gaps = 41/228 (17%)

Query: 119 FKHEQEVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFN 178
            +++  V +A++ P   N+IA  +G   + +FD   +       +  ++       L FN
Sbjct: 176 LQNKDCVYQAQFSPHDNNLIACCSGNSYITLFDTREQNNRFNNNSFIAHSGLETLTLDFN 235

Query: 179 PTVSGQLLSASDDGTVALWDVTSTANKSPSQTF-------------DVHTDIVNDCKWHE 225
                 L S+  D ++ +WD+    N + + T                H   V    W  
Sbjct: 236 KYRPTVLASSGADNSIKIWDMRMIRNNNSNNTVMPTSNPICMNEIRKAHDLAVRRVVWSP 295

Query: 226 FQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLY 285
            QS+L  + S D T             K+    +F+    + ++ ++   +G        
Sbjct: 296 HQSNLLLSTSYDMT------------SKVWKDFSFDGSKITGKTNSIDPGSG-------- 335

Query: 286 DLRRLQKPLHSMAGHEDSVTSLEFSP-HQDGLLTSSGSDRRIIMWDLF 332
               L K  H    H + V   ++S   Q G + ++G D ++ +W+ F
Sbjct: 336 ----LIKTFHH---HTEFVFGADWSLWGQPGFIATTGWDSKVYIWNCF 376

>Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON}
           YCR084C (REAL)
          Length = 709

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/156 (27%), Positives = 69/156 (44%), Gaps = 11/156 (7%)

Query: 235 SEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYD------LR 288
           S D T+ I D  + +    LS+     T+A S      +AA   D  V ++D      + 
Sbjct: 500 SGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVE 559

Query: 289 RLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGS-DRRIIMWDLFNIGAEQQPDDAYDGV 347
           RL     S  GH+DSV S+ F+  +DG    SGS DR + +W+L N   +        G 
Sbjct: 560 RLDSENESGTGHKDSVYSVVFT--RDGHSVVSGSLDRSVKLWNLQNANNKSDSKAPNSGT 617

Query: 348 PELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENVL 383
            E+  +  GH+  V   +   N  +++   ++  VL
Sbjct: 618 CEVTYI--GHKDFVLSVATTQNDEYILSGSKDRGVL 651

>KLTH0H06160g Chr8 complement(538741..540465) [1725 bp, 574 aa] {ON}
           similar to uniprot|P26309 Saccharomyces cerevisiae
           YGL116W CDC20 Cell-cycle regulated activator of
           anaphase- promoting complex/cyclosome (APC/C) which is
           required for metaphase/anaphase transition directs
           ubiquitination of mitotic cyclins Pds1p and other
           anaphase inhibitors potential Cdc28p substrate
          Length = 574

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 55/233 (23%), Positives = 105/233 (45%), Gaps = 26/233 (11%)

Query: 137 IIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQLLSASDDGTVAL 196
           +IAT   +G ++I D  ++ K+H  ++++  H+    G+++ P    Q+ S S+D TV +
Sbjct: 333 LIATGAKSGEIHIND--VRIKNH-IVSTWEEHRGEVCGISYRPD-GLQVASGSNDNTVVI 388

Query: 197 WDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIH--DTNSDRAIQKL 254
           WD  ++    P      HT  V    W    ++L  T        IH  +T +      +
Sbjct: 389 WDTRTSL---PQHIKRQHTAAVKALAWSPDINNLLATGGGQTDKHIHFWNTTTGARTGSI 445

Query: 255 SVSSAFNTLAFSKR------SENLLAAAGTDSN---VYLYDLR-RLQKPLHSMAGHEDSV 304
           +  S  ++L + +          ++A  G   N   VY YD + ++ + +H+   HE  +
Sbjct: 446 NTGSQVSSLHWGQSYNANTIQREIVATGGNPENAVSVYNYDTKFKVAEIVHA---HEARI 502

Query: 305 TSLEFSPHQDG-LLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGG 356
            S + SP  DG +L + G D  +  + +F     ++P    DG   L +++ G
Sbjct: 503 CSSQLSP--DGTVLATVGGDENLKFYKVFEP-RRKRPQGVCDGESLLGLLNVG 552

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.130    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,406,598
Number of extensions: 2147501
Number of successful extensions: 9692
Number of sequences better than 10.0: 1049
Number of HSP's gapped: 8302
Number of HSP's successfully gapped: 1710
Length of query: 408
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 296
Effective length of database: 40,638,807
Effective search space: 12029086872
Effective search space used: 12029086872
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 67 (30.4 bits)