Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D00748g6.5ON78978938520.0
SAKL0E00748g6.5ON77469225150.0
KLTH0C11616g6.5ON74070623890.0
Ecym_30076.5ON76973623860.0
Kwal_56.223296.5ON77670823800.0
ACR022W6.5ON75471023510.0
Kpol_1045.836.5ON74868421870.0
TDEL0G046606.5ON73965021620.0
ZYRO0F00396g6.5ON73268921600.0
CAGL0A01133g6.5ON80169321490.0
Suva_16.356.5ON76770821240.0
TPHA0J002206.5ON74068121170.0
Smik_6.4786.5ON77369721050.0
YPL270W (MDL2)6.5ON77362320970.0
NDAI0I027306.5ON83259821010.0
Skud_16.76.5ON77365220880.0
NCAS0D022106.5ON77370420780.0
TBLA0A071906.5ON79468420700.0
KNAG0E028006.5ON74169819600.0
KAFR0B064806.5ON75168918600.0
Kpol_2000.791.67ON70764314650.0
TPHA0B046201.67ON72064014450.0
SAKL0C02244g1.67ON71261214360.0
NDAI0A005601.67ON71462414330.0
KLLA0C01991g1.67ON70663214240.0
TDEL0C063501.67ON69361214220.0
NCAS0B087001.67ON71565514230.0
Skud_12.2531.67ON69263113940.0
ZYRO0F17050g1.67ON71461613840.0
KLTH0F02024g1.67ON73462913850.0
YLR188W (MDL1)1.67ON69563213771e-180
Smik_12.2481.67ON69662813671e-179
AFR683C1.67ON67761613591e-178
Suva_10.2841.67ON69362813611e-178
Ecym_10721.67ON68360713561e-177
Kwal_33.133081.67ON70663813531e-176
TBLA0A053001.67ON70761313051e-169
CAGL0E00385g1.67ON60862912651e-165
SAKL0H00968g5.20ON7005195342e-57
Smik_13.5185.20ON6875305281e-56
KNAG0E013205.20ON6954555262e-56
Skud_13.4755.20ON6915685254e-56
Suva_13.4915.20ON6935655237e-56
KLLA0A10131g5.20ON7207245239e-56
NDAI0I024405.20ON7305235185e-55
YMR301C (ATM1)5.20ON6905305166e-55
CAGL0M13739g5.20ON7275205141e-54
NCAS0D024305.20ON7025155079e-54
TBLA0C070005.20ON7254425089e-54
KLTH0B09482g5.20ON6943955061e-53
YKL209C (STE6)1.527ON12905085162e-53
Kwal_26.94805.20ON7193875043e-53
KAFR0I025805.20ON7094615009e-53
Ecym_56495.20ON6965114981e-52
TDEL0F003401.527ON12574985053e-52
TDEL0G004305.20ON6965194937e-52
AGL335W5.20ON6915204911e-51
Kpol_513.235.20ON7084394912e-51
TPHA0L022705.20ON7115204902e-51
Kpol_1018.1851.527ON12765084983e-51
TBLA0B100701.527ON12965214973e-51
ZYRO0D07106g5.20ON7095194841e-50
TPHA0O001601.527ON12535204796e-49
KNAG0G001901.527ON12755144788e-49
NDAI0D015401.527ON12935044743e-48
SAKL0A10208g1.527ON13105044734e-48
Skud_11.111.527ON12955154691e-47
ZYRO0G02244g1.527ON12735194681e-47
Suva_11.111.527ON12905214645e-47
AFR432W1.527ON12845124636e-47
NCAS0G035101.527ON12885204583e-46
KAFR0E002301.527ON12705214574e-46
CAGL0K00363g1.527ON12275044531e-45
Kwal_33.155611.527ON12975224531e-45
KLLA0B14256g1.527ON12715154442e-44
Ecym_36121.527ON13155014352e-43
Smik_11.141.527ON13165084211e-41
KLTH0B01100g1.527ON12985124182e-41
CAGL0E03982g4.6ON16595183989e-39
TDEL0E056104.52ON15355343962e-38
Ecym_42658.303ON15055013933e-38
NDAI0B006405.10ON14915293924e-38
NCAS0J00160singletonON16545213925e-38
TBLA0G007104.6ON16915163908e-38
NCAS0C059304.6ON16575103872e-37
NDAI0J011508.303ON15175163853e-37
KNAG0J027304.52ON15375353801e-36
CAGL0C03289g4.6ON16485033783e-36
Suva_8.164.6ON15995283746e-36
Ecym_84184.6ON16785253721e-35
KNAG0E011204.6ON17175413721e-35
ZYRO0G07612g4.6ON16955103721e-35
NDAI0H001904.6ON16825163702e-35
YHL035C (VMR1)4.6ON15924993693e-35
CAGL0E03355g4.52ON15355123693e-35
CAGL0G00242g5.10ON14775413683e-35
TPHA0C009608.303ON15235313684e-35
NCAS0E041605.10ON15065333641e-34
KLLA0F20075g8.303ON15164853631e-34
KLLA0E00529g4.6ON16505223613e-34
SAKL0H16016g8.303ON14994853604e-34
Kpol_311.34.6ON16575183595e-34
Smik_12.484.52ON15575323586e-34
TDEL0F043008.303ON15145153579e-34
KLTH0H16038g4.6ON16495173542e-33
Skud_8.94.6ON15875333542e-33
KLLA0D04059g4.52ON15685023542e-33
CAGL0L06402g8.303ON15355233532e-33
Kwal_34.157704.6ON14365093532e-33
NCAS0B034708.303ON15124853523e-33
YLL048C (YBT1)4.6ON16615423524e-33
Skud_4.3958.303ON15164923505e-33
SAKL0H26026g4.6ON16535073506e-33
KNAG0I009908.303ON15355213497e-33
Suva_10.234.6ON16615333498e-33
Kwal_56.22747na 1ON15385343481e-32
KAFR0B056308.303ON15155203471e-32
KLTH0C09240gna 1ON15465293471e-32
Smik_8.64.6ON15855353471e-32
TDEL0G018504.6ON16424893462e-32
KAFR0C065105.10ON14575263462e-32
TPHA0F004104.52ON15705493443e-32
Skud_7.6145.10ON14775343433e-32
KLTH0B00396gsingletonON15075273434e-32
Skud_12.524.52ON15615363417e-32
KAFR0L001904.6ON16535253401e-31
Suva_10.60singletonON9905403362e-31
Suva_10.594.52ON15615393345e-31
Kwal_56.238448.303ON14945113336e-31
Kpol_1033.288.303ON15315033329e-31
ZYRO0D06160g8.303ON15254933311e-30
Smik_4.3808.303ON15164903311e-30
KAFR0I013004.52ON15365203311e-30
YGR281W (YOR1)5.10ON14775353301e-30
Suva_2.2978.303ON15164893302e-30
Skud_12.224.6ON16615263282e-30
Smik_12.114.6ON16615443283e-30
Smik_16.275.10ON14775353273e-30
TPHA0K023104.6ON16494833273e-30
KLTH0G12716g8.303ON15005173264e-30
TPHA0F001804.6ON16465053247e-30
Kpol_1060.75.10ON14605323231e-29
KNAG0K001705.10ON14425353202e-29
YDR135C (YCF1)8.303ON15154913193e-29
Suva_7.5775.10ON14785333184e-29
Kpol_YGOB_1041.454.52ON15685353185e-29
Kpol_1041.45singletonOFF15965353176e-29
Smik_11.367na 2ON15955373167e-29
SAKL0H00704g5.10ON14395153131e-28
SAKL0H23958g4.52ON15585163122e-28
Skud_18.2singletonON15805303113e-28
AGR047W8.303ON14925023104e-28
ZYRO0G22176g4.52ON15705033061e-27
KLTH0B09724g5.10ON14865113052e-27
YLL015W (BPT1)4.52ON15595353023e-27
TPHA0A056205.10ON14775223014e-27
ACL072C4.6ON16275043006e-27
Kwal_26.95325.10ON14715042925e-26
YKR104WsingletonON3062542765e-26
KLLA0C14234g5.10ON14545362916e-26
TBLA0A06840singletonON10582502899e-26
Zrou_YGOB_Anc_5.105.10ON9925352862e-25
TBLA0C071005.10ON14855342828e-25
TDEL0G003305.10ON14652612811e-24
TBLA0C06400singletonON13775362712e-23
AGL346W5.10ON14002442595e-22
TBLA0A038008.303ON15465202264e-18
Ecym_56605.10ON15363272193e-17
YKR103W (NFT1)na 2ON12182412085e-16
SAKL0D10208g1.366ON7522501977e-15
Kwal_26.87308.661ON8312001906e-14
AEL032W1.366ON7532401843e-13
ZYRO0B05588g3.133ON12702131844e-13
CAGL0K10472g1.366ON7522111824e-13
ZYRO0D11880g5.500ON14982241827e-13
TBLA0C012201.366ON7512271807e-13
ACR128C8.661ON8271861809e-13
KNAG0C019601.366ON7522331809e-13
TDEL0B057601.427ON10362461801e-12
KLTH0D10890g8.661ON8302011791e-12
Kpol_175.1singletonON13772951791e-12
KAFR0C045401.366ON7522381782e-12
Kpol_1043.431.366ON7522401772e-12
ZYRO0G01144g1.366ON7522341762e-12
KLLA0A10857g1.366ON7522361753e-12
YFR009W (GCN20)1.366ON7522321754e-12
NDAI0A042005.500ON15512251754e-12
Smik_7.3131.366ON7522321745e-12
ZYRO0B14762gsingletonON15152301755e-12
KAFR0A037908.661ON8762151745e-12
TBLA0D043501.427ON11192381746e-12
KNAG0B038705.500ON15132031746e-12
TBLA0D017805.500ON15952031737e-12
TDEL0D040403.220ON15002321738e-12
NDAI0H035701.366ON7552031729e-12
Suva_6.841.366ON7522341719e-12
TPHA0D04700singletonON15102271729e-12
Skud_14.404na 3ON14242461721e-11
TBLA0D01820singletonON15512021721e-11
NCAS0A120605.500ON15432331721e-11
TPHA0D011708.661ON9152611711e-11
KAFR0C05210na 4ON14932211711e-11
YOL075C3.133ON12942281701e-11
KAFR0C052205.500ON14992761702e-11
TPHA0L015008.517ON15192311702e-11
Smik_15.843.133ON12952291692e-11
TPHA0A023101.366ON7522341673e-11
NCAS0A085701.427ON10602401673e-11
KNAG0I005301.427ON10472501674e-11
Kwal_34.162401.366ON7522401664e-11
KLTH0H13442g1.366ON7522401664e-11
ZYRO0D11836gna 5ON14622331664e-11
Kwal_23.51613.220ON14892331665e-11
ZYRO0D11858gna 4ON15032201665e-11
CAGL0M01760gsingletonON14993091666e-11
Skud_6.951.366ON7522321646e-11
YNR070W (PDR18)na 3ON13332341657e-11
SAKL0H21010gsingletonON14472131657e-11
Smik_14.399na 3ON14212031657e-11
ZYRO0E04092g1.427ON10622351647e-11
ZYRO0F07018g8.661ON8612381647e-11
TBLA0A024405.500ON16212211648e-11
Suva_15.913.133ON13022281649e-11
Smik_15.3335.500ON15102361649e-11
KNAG0A021008.517ON15052181641e-10
KNAG0C045005.500ON15552511641e-10
YOR153W (PDR5)5.500ON15112031631e-10
Smik_3.971.427ON10493141631e-10
NDAI0C012205.500ON15092031631e-10
KAFR0C00820na 6ON15172491631e-10
ZYRO0D17710gsingletonON14862291631e-10
KAFR0E03460na 5ON15462221621e-10
CAGL0I04862g3.220ON15072381621e-10
Skud_4.2623.220ON15012311622e-10
Ecym_27141.366ON7482331612e-10
YPL147W (PXA1)8.661ON8701961612e-10
KLTH0A01914g3.220ON14992541612e-10
Suva_16.1638.661ON8701941612e-10
Smik_6.3448.661ON8701961602e-10
Ecym_24108.661ON8281901602e-10
Ecym_36043.220ON14742091612e-10
NDAI0E012408.661ON8972391602e-10
Suva_2.5835.500ON15372211612e-10
NCAS0D005801.366ON7532341592e-10
KAFR0E03450na 4ON15532221603e-10
ZYRO0A04114g3.220ON15182541603e-10
CAGL0F02717g5.500ON15422321603e-10
KLLA0F11484g8.661ON8452101593e-10
NCAS0E016303.220ON15652491594e-10
Skud_4.6805.500ON14452171594e-10
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D00748g
         (789 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D00748g Chr4 complement(69839..72208) [2370 bp, 789 aa] {ON...  1488   0.0  
SAKL0E00748g Chr5 complement(50683..53007) [2325 bp, 774 aa] {ON...   973   0.0  
KLTH0C11616g Chr3 (956011..958233) [2223 bp, 740 aa] {ON} simila...   924   0.0  
Ecym_3007 Chr3 complement(14335..16644) [2310 bp, 769 aa] {ON} s...   923   0.0  
Kwal_56.22329 s56 complement(50448..52778) [2331 bp, 776 aa] {ON...   921   0.0  
ACR022W Chr3 (395427..397691) [2265 bp, 754 aa] {ON} Syntenic ho...   910   0.0  
Kpol_1045.83 s1045 (193070..195316) [2247 bp, 748 aa] {ON} (1930...   847   0.0  
TDEL0G04660 Chr7 (850475..852694) [2220 bp, 739 aa] {ON} Anc_6.5...   837   0.0  
ZYRO0F00396g Chr6 complement(39330..41528) [2199 bp, 732 aa] {ON...   836   0.0  
CAGL0A01133g Chr1 (112037..114442) [2406 bp, 801 aa] {ON} simila...   832   0.0  
Suva_16.35 Chr16 (46072..48375) [2304 bp, 767 aa] {ON} YPL270W (...   822   0.0  
TPHA0J00220 Chr10 complement(51873..54095) [2223 bp, 740 aa] {ON...   820   0.0  
Smik_6.478 Chr6 complement(788399..790720) [2322 bp, 773 aa] {ON...   815   0.0  
YPL270W Chr16 (30482..32803) [2322 bp, 773 aa] {ON}  MDL2Mitocho...   812   0.0  
NDAI0I02730 Chr9 complement(640429..642927) [2499 bp, 832 aa] {O...   813   0.0  
Skud_16.7 Chr16 (9624..11945) [2322 bp, 773 aa] {ON} YPL270W (REAL)   808   0.0  
NCAS0D02210 Chr4 (410709..413030) [2322 bp, 773 aa] {ON} Anc_6.5      805   0.0  
TBLA0A07190 Chr1 complement(1792994..1795378) [2385 bp, 794 aa] ...   801   0.0  
KNAG0E02800 Chr5 (562361..564586) [2226 bp, 741 aa] {ON} Anc_6.5...   759   0.0  
KAFR0B06480 Chr2 complement(1344413..1346668) [2256 bp, 751 aa] ...   721   0.0  
Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa] ...   568   0.0  
TPHA0B04620 Chr2 complement(1085725..1087887) [2163 bp, 720 aa] ...   561   0.0  
SAKL0C02244g Chr3 (201281..203419) [2139 bp, 712 aa] {ON} simila...   557   0.0  
NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {O...   556   0.0  
KLLA0C01991g Chr3 (160778..162898) [2121 bp, 706 aa] {ON} simila...   553   0.0  
TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa] ...   552   0.0  
NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1...   552   0.0  
Skud_12.253 Chr12 (474886..476964) [2079 bp, 692 aa] {ON} YLR188...   541   0.0  
ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]...   537   0.0  
KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} simila...   538   0.0  
YLR188W Chr12 (528300..530387) [2088 bp, 695 aa] {ON}  MDL1Mitoc...   535   e-180
Smik_12.248 Chr12 (475233..477323) [2091 bp, 696 aa] {ON} YLR188...   531   e-179
AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}...   528   e-178
Suva_10.284 Chr10 (500972..503053) [2082 bp, 693 aa] {ON} YLR188...   528   e-178
Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar t...   526   e-177
Kwal_33.13308 s33 (166479..168599) [2121 bp, 706 aa] {ON} YLR188...   525   e-176
TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1...   507   e-169
CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar ...   491   e-165
SAKL0H00968g Chr8 (107767..109869) [2103 bp, 700 aa] {ON} highly...   210   2e-57
Smik_13.518 Chr13 complement(850174..852237) [2064 bp, 687 aa] {...   207   1e-56
KNAG0E01320 Chr5 (261901..263988) [2088 bp, 695 aa] {ON} Anc_5.2...   207   2e-56
Skud_13.475 Chr13 complement(841033..843108) [2076 bp, 691 aa] {...   206   4e-56
Suva_13.491 Chr13 complement(849300..851381) [2082 bp, 693 aa] {...   206   7e-56
KLLA0A10131g Chr1 complement(889688..891850) [2163 bp, 720 aa] {...   206   9e-56
NDAI0I02440 Chr9 complement(556154..558346) [2193 bp, 730 aa] {O...   204   5e-55
YMR301C Chr13 complement(867555..869627) [2073 bp, 690 aa] {ON} ...   203   6e-55
CAGL0M13739g Chr13 complement(1347781..1349964) [2184 bp, 727 aa...   202   1e-54
NCAS0D02430 Chr4 (462683..464791) [2109 bp, 702 aa] {ON} Anc_5.20     199   9e-54
TBLA0C07000 Chr3 complement(1688965..1691142) [2178 bp, 725 aa] ...   200   9e-54
KLTH0B09482g Chr2 complement(777282..779366) [2085 bp, 694 aa] {...   199   1e-53
YKL209C Chr11 complement(42423..46295) [3873 bp, 1290 aa] {ON}  ...   203   2e-53
Kwal_26.9480 s26 complement(1236178..1238337) [2160 bp, 719 aa] ...   198   3e-53
KAFR0I02580 Chr9 complement(520294..522423) [2130 bp, 709 aa] {O...   197   9e-53
Ecym_5649 Chr5 complement(1310682..1312772) [2091 bp, 696 aa] {O...   196   1e-52
TDEL0F00340 Chr6 complement(53876..57649) [3774 bp, 1257 aa] {ON...   199   3e-52
TDEL0G00430 Chr7 (89431..91521) [2091 bp, 696 aa] {ON} Anc_5.20 ...   194   7e-52
AGL335W Chr7 (82640..84715) [2076 bp, 691 aa] {ON} Syntenic homo...   193   1e-51
Kpol_513.23 s513 complement(65118..67244) [2127 bp, 708 aa] {ON}...   193   2e-51
TPHA0L02270 Chr12 complement(473597..475732) [2136 bp, 711 aa] {...   193   2e-51
Kpol_1018.185 s1018 (464370..468200) [3831 bp, 1276 aa] {ON} (46...   196   3e-51
TBLA0B10070 Chr2 (2422767..2426657) [3891 bp, 1296 aa] {ON} Anc_...   196   3e-51
ZYRO0D07106g Chr4 (616125..618254) [2130 bp, 709 aa] {ON} simila...   191   1e-50
TPHA0O00160 Chr15 complement(16002..19763) [3762 bp, 1253 aa] {O...   189   6e-49
KNAG0G00190 Chr7 complement(20457..24284) [3828 bp, 1275 aa] {ON...   188   8e-49
NDAI0D01540 Chr4 (369687..373568) [3882 bp, 1293 aa] {ON} Anc_1....   187   3e-48
SAKL0A10208g Chr1 (894334..898266) [3933 bp, 1310 aa] {ON} simil...   186   4e-48
Skud_11.11 Chr11 complement(25896..29783) [3888 bp, 1295 aa] {ON...   185   1e-47
ZYRO0G02244g Chr7 (169369..173190) [3822 bp, 1273 aa] {ON} simil...   184   1e-47
Suva_11.11 Chr11 complement(26032..29904) [3873 bp, 1290 aa] {ON...   183   5e-47
AFR432W Chr6 (1213211..1217065) [3855 bp, 1284 aa] {ON} Syntenic...   182   6e-47
NCAS0G03510 Chr7 (652949..656815) [3867 bp, 1288 aa] {ON} Anc_1....   181   3e-46
KAFR0E00230 Chr5 complement(47473..51285) [3813 bp, 1270 aa] {ON...   180   4e-46
CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {...   179   1e-45
Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON} YKL...   179   1e-45
KLLA0B14256g Chr2 (1248654..1252469) [3816 bp, 1271 aa] {ON} sim...   175   2e-44
Ecym_3612 Chr3 (1167419..1171366) [3948 bp, 1315 aa] {ON} simila...   172   2e-43
Smik_11.14 Chr11 complement(26603..30553) [3951 bp, 1316 aa] {ON...   166   1e-41
KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {O...   165   2e-41
CAGL0E03982g Chr5 (378442..383421) [4980 bp, 1659 aa] {ON} simil...   157   9e-39
TDEL0E05610 Chr5 (1038912..1043519) [4608 bp, 1535 aa] {ON} Anc_...   157   2e-38
Ecym_4265 Chr4 (560254..564771) [4518 bp, 1505 aa] {ON} similar ...   155   3e-38
NDAI0B00640 Chr2 (141258..145733) [4476 bp, 1491 aa] {ON} Anc_5.10    155   4e-38
NCAS0J00160 Chr10 complement(12361..17325) [4965 bp, 1654 aa] {O...   155   5e-38
TBLA0G00710 Chr7 (157927..163002) [5076 bp, 1691 aa] {ON} Anc_4....   154   8e-38
NCAS0C05930 Chr3 (1220180..1225153) [4974 bp, 1657 aa] {ON} Anc_...   153   2e-37
NDAI0J01150 Chr10 complement(262920..267473) [4554 bp, 1517 aa] ...   152   3e-37
KNAG0J02730 Chr10 complement(512373..516986) [4614 bp, 1537 aa] ...   150   1e-36
CAGL0C03289g Chr3 (328799..333745) [4947 bp, 1648 aa] {ON} simil...   150   3e-36
Suva_8.16 Chr8 complement(29573..34372) [4800 bp, 1599 aa] {ON} ...   148   6e-36
Ecym_8418 Chr8 (874901..879937) [5037 bp, 1678 aa] {ON} similar ...   147   1e-35
KNAG0E01120 Chr5 (214592..219745) [5154 bp, 1717 aa] {ON} Anc_4....   147   1e-35
ZYRO0G07612g Chr7 complement(601181..606268) [5088 bp, 1695 aa] ...   147   1e-35
NDAI0H00190 Chr8 complement(20586..25634) [5049 bp, 1682 aa] {ON...   147   2e-35
YHL035C Chr8 complement(27978..32756) [4779 bp, 1592 aa] {ON}  V...   146   3e-35
CAGL0E03355g Chr5 complement(307479..312086) [4608 bp, 1535 aa] ...   146   3e-35
CAGL0G00242g Chr7 complement(20428..24861) [4434 bp, 1477 aa] {O...   146   3e-35
TPHA0C00960 Chr3 (204061..208632) [4572 bp, 1523 aa] {ON} Anc_8....   146   4e-35
NCAS0E04160 Chr5 (818254..822774) [4521 bp, 1506 aa] {ON} Anc_5.10    144   1e-34
KLLA0F20075g Chr6 complement(1868786..1873336) [4551 bp, 1516 aa...   144   1e-34
KLLA0E00529g Chr5 complement(39173..44125) [4953 bp, 1650 aa] {O...   143   3e-34
SAKL0H16016g Chr8 (1396707..1401206) [4500 bp, 1499 aa] {ON} sim...   143   4e-34
Kpol_311.3 s311 (5480..10453) [4974 bp, 1657 aa] {ON} (5480..104...   142   5e-34
Smik_12.48 Chr12 (103624..108297) [4674 bp, 1557 aa] {ON} YLL015...   142   6e-34
TDEL0F04300 Chr6 complement(802866..807410) [4545 bp, 1514 aa] {...   142   9e-34
KLTH0H16038g Chr8 (1376941..1381890) [4950 bp, 1649 aa] {ON} sim...   140   2e-33
Skud_8.9 Chr8 complement(16026..20789) [4764 bp, 1587 aa] {ON} Y...   140   2e-33
KLLA0D04059g Chr4 complement(338422..343128) [4707 bp, 1568 aa] ...   140   2e-33
CAGL0L06402g Chr12 (720723..725330) [4608 bp, 1535 aa] {ON} high...   140   2e-33
Kwal_34.15770 s34 complement(51755..56065) [4311 bp, 1436 aa] {O...   140   2e-33
NCAS0B03470 Chr2 complement(606008..610546) [4539 bp, 1512 aa] {...   140   3e-33
YLL048C Chr12 complement(41280..46265) [4986 bp, 1661 aa] {ON}  ...   140   4e-33
Skud_4.395 Chr4 complement(694806..699356) [4551 bp, 1516 aa] {O...   139   5e-33
SAKL0H26026g Chr8 (2287664..2292625) [4962 bp, 1653 aa] {ON} sim...   139   6e-33
KNAG0I00990 Chr9 (188695..193302) [4608 bp, 1535 aa] {ON} Anc_8....   139   7e-33
Suva_10.23 Chr10 complement(44719..49704) [4986 bp, 1661 aa] {ON...   139   8e-33
Kwal_56.22747 s56 (262824..267440) [4617 bp, 1538 aa] {ON} YLL01...   138   1e-32
KAFR0B05630 Chr2 complement(1156621..1161168) [4548 bp, 1515 aa]...   138   1e-32
KLTH0C09240g Chr3 complement(766620..771260) [4641 bp, 1546 aa] ...   138   1e-32
Smik_8.6 Chr8 complement(11717..16474) [4758 bp, 1585 aa] {ON} Y...   138   1e-32
TDEL0G01850 Chr7 (369839..374767) [4929 bp, 1642 aa] {ON} Anc_4....   137   2e-32
KAFR0C06510 Chr3 (1306097..1310470) [4374 bp, 1457 aa] {ON} Anc_...   137   2e-32
TPHA0F00410 Chr6 (98503..103215) [4713 bp, 1570 aa] {ON} Anc_4.5...   137   3e-32
Skud_7.614 Chr7 (1027230..1031663) [4434 bp, 1477 aa] {ON} YGR28...   136   3e-32
KLTH0B00396g Chr2 complement(38234..42757) [4524 bp, 1507 aa] {O...   136   4e-32
Skud_12.52 Chr12 (107860..112545) [4686 bp, 1561 aa] {ON} YLL015...   135   7e-32
KAFR0L00190 Chr12 complement(21836..26797) [4962 bp, 1653 aa] {O...   135   1e-31
Suva_10.60 Chr10 (123173..126145) [2973 bp, 990 aa] {ON} YLL015W...   134   2e-31
Suva_10.59 Chr10 (121460..126142) [4683 bp, 1561 aa] {ON} YLL015...   133   5e-31
Kwal_56.23844 s56 complement(733654..738138) [4485 bp, 1494 aa] ...   132   6e-31
Kpol_1033.28 s1033 complement(69924..74519) [4596 bp, 1531 aa] {...   132   9e-31
ZYRO0D06160g Chr4 (524435..529012) [4578 bp, 1525 aa] {ON} highl...   132   1e-30
Smik_4.380 Chr4 complement(684148..688698) [4551 bp, 1516 aa] {O...   132   1e-30
KAFR0I01300 Chr9 complement(262852..267462) [4611 bp, 1536 aa] {...   132   1e-30
YGR281W Chr7 (1052824..1057257) [4434 bp, 1477 aa] {ON}  YOR1Pla...   131   1e-30
Suva_2.297 Chr2 complement(518369..522919) [4551 bp, 1516 aa] {O...   131   2e-30
Skud_12.22 Chr12 complement(31933..36918) [4986 bp, 1661 aa] {ON...   130   2e-30
Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON...   130   3e-30
Smik_16.27 Chr16 complement(40287..44720) [4434 bp, 1477 aa] {ON...   130   3e-30
TPHA0K02310 Chr11 (497267..502216) [4950 bp, 1649 aa] {ON} Anc_4...   130   3e-30
KLTH0G12716g Chr7 (1080818..1085320) [4503 bp, 1500 aa] {ON} hig...   130   4e-30
TPHA0F00180 Chr6 complement(23050..27990) [4941 bp, 1646 aa] {ON...   129   7e-30
Kpol_1060.7 s1060 complement(13248..17630) [4383 bp, 1460 aa] {O...   129   1e-29
KNAG0K00170 Chr11 complement(15700..20028) [4329 bp, 1442 aa] {O...   127   2e-29
YDR135C Chr4 complement(723004..727551) [4548 bp, 1515 aa] {ON} ...   127   3e-29
Suva_7.577 Chr7 (1007741..1012177) [4437 bp, 1478 aa] {ON} YGR28...   127   4e-29
Kpol_YGOB_1041.45 s1041 complement(118923..123629) [4707 bp, 156...   127   5e-29
Kpol_1041.45 s1041 complement(118923..123713) [4791 bp, 1596 aa]...   126   6e-29
Smik_11.367 Chr11 (644116..648903) [4788 bp, 1595 aa] {ON} YKR10...   126   7e-29
SAKL0H00704g Chr8 (85322..89641) [4320 bp, 1439 aa] {ON} similar...   125   1e-28
SAKL0H23958g Chr8 complement(2062067..2066743) [4677 bp, 1558 aa...   124   2e-28
Skud_18.2 Chr18 (5442..10184) [4743 bp, 1580 aa] {ON} YHL035C (R...   124   3e-28
AGR047W Chr7 (802679..807157) [4479 bp, 1492 aa] {ON} Syntenic h...   124   4e-28
ZYRO0G22176g Chr7 (1822665..1827377) [4713 bp, 1570 aa] {ON} sim...   122   1e-27
KLTH0B09724g Chr2 complement(796023..800483) [4461 bp, 1486 aa] ...   122   2e-27
YLL015W Chr12 (116432..121111) [4680 bp, 1559 aa] {ON}  BPT1ABC ...   120   3e-27
TPHA0A05620 Chr1 (1273220..1277653) [4434 bp, 1477 aa] {ON} Anc_...   120   4e-27
ACL072C Chr3 complement(224562..229445) [4884 bp, 1627 aa] {ON} ...   120   6e-27
Kwal_26.9532 s26 complement(1256241..1260656) [4416 bp, 1471 aa]...   117   5e-26
YKR104W Chr11 (656836..657756) [921 bp, 306 aa] {ON} Putative tr...   110   5e-26
KLLA0C14234g Chr3 (1234598..1238962) [4365 bp, 1454 aa] {ON} sim...   116   6e-26
TBLA0A06840 Chr1 (1666910..1670086) [3177 bp, 1058 aa] {ON} Anc_...   115   9e-26
Zrou_YGOB_Anc_5.10 Chr3 complement(92067..95045) [2979 bp, 992 a...   114   2e-25
TBLA0C07100 Chr3 (1721628..1726085) [4458 bp, 1485 aa] {ON}           113   8e-25
TDEL0G00330 Chr7 complement(58587..62984) [4398 bp, 1465 aa] {ON...   112   1e-24
TBLA0C06400 Chr3 complement(1545011..1549144) [4134 bp, 1377 aa]...   108   2e-23
AGL346W Chr7 (61232..65434) [4203 bp, 1400 aa] {ON} Syntenic hom...   104   5e-22
TBLA0A03800 Chr1 complement(947158..951798) [4641 bp, 1546 aa] {...    92   4e-18
Ecym_5660 Chr5 complement(1331316..1335926) [4611 bp, 1536 aa] {...    89   3e-17
YKR103W Chr11 (653080..656736) [3657 bp, 1218 aa] {ON}  NFT1Puta...    85   5e-16
SAKL0D10208g Chr4 complement(855378..857636) [2259 bp, 752 aa] {...    80   7e-15
Kwal_26.8730 s26 complement(918498..920993) [2496 bp, 831 aa] {O...    78   6e-14
AEL032W Chr5 (572196..574457) [2262 bp, 753 aa] {ON} Syntenic ho...    75   3e-13
ZYRO0B05588g Chr2 (440556..444368) [3813 bp, 1270 aa] {ON} simil...    75   4e-13
CAGL0K10472g Chr11 (1020845..1023103) [2259 bp, 752 aa] {ON} hig...    75   4e-13
ZYRO0D11880g Chr4 (1003647..1008143) [4497 bp, 1498 aa] {ON} sim...    75   7e-13
TBLA0C01220 Chr3 complement(263093..265348) [2256 bp, 751 aa] {O...    74   7e-13
ACR128C Chr3 complement(573251..575734) [2484 bp, 827 aa] {ON} S...    74   9e-13
KNAG0C01960 Chr3 complement(380896..383154) [2259 bp, 752 aa] {O...    74   9e-13
TDEL0B05760 Chr2 (1017816..1020926) [3111 bp, 1036 aa] {ON} Anc_...    74   1e-12
KLTH0D10890g Chr4 complement(891012..893504) [2493 bp, 830 aa] {...    74   1e-12
Kpol_175.1 s175 complement(1..4131) [4131 bp, 1377 aa] {ON} comp...    74   1e-12
KAFR0C04540 Chr3 complement(907385..909643) [2259 bp, 752 aa] {O...    73   2e-12
Kpol_1043.43 s1043 complement(86642..88900) [2259 bp, 752 aa] {O...    73   2e-12
ZYRO0G01144g Chr7 (89341..91599) [2259 bp, 752 aa] {ON} highly s...    72   2e-12
KLLA0A10857g Chr1 complement(941784..944042) [2259 bp, 752 aa] {...    72   3e-12
YFR009W Chr6 (162488..164746) [2259 bp, 752 aa] {ON}  GCN20Posit...    72   4e-12
NDAI0A04200 Chr1 complement(948224..952879) [4656 bp, 1551 aa] {...    72   4e-12
Smik_7.313 Chr7 (524077..526335) [2259 bp, 752 aa] {ON} YFR009W ...    72   5e-12
ZYRO0B14762g Chr2 (1201028..1205575) [4548 bp, 1515 aa] {ON} sim...    72   5e-12
KAFR0A03790 Chr1 complement(770906..773536) [2631 bp, 876 aa] {O...    72   5e-12
TBLA0D04350 Chr4 complement(1076344..1079703) [3360 bp, 1119 aa]...    72   6e-12
KNAG0B03870 Chr2 complement(741637..746178) [4542 bp, 1513 aa] {...    72   6e-12
TBLA0D01780 Chr4 complement(438830..443617) [4788 bp, 1595 aa] {...    71   7e-12
TDEL0D04040 Chr4 complement(738550..743052) [4503 bp, 1500 aa] {...    71   8e-12
NDAI0H03570 Chr8 complement(872905..875172) [2268 bp, 755 aa] {O...    71   9e-12
Suva_6.84 Chr6 complement(145289..147547) [2259 bp, 752 aa] {ON}...    70   9e-12
TPHA0D04700 Chr4 (1026978..1031510) [4533 bp, 1510 aa] {ON}            71   9e-12
Skud_14.404 Chr14 (733442..737716) [4275 bp, 1424 aa] {ON} YNR07...    71   1e-11
TBLA0D01820 Chr4 (448516..453171) [4656 bp, 1551 aa] {ON}              71   1e-11
NCAS0A12060 Chr1 (2388467..2393098) [4632 bp, 1543 aa] {ON} Anc_...    71   1e-11
TPHA0D01170 Chr4 complement(245675..248422) [2748 bp, 915 aa] {O...    70   1e-11
KAFR0C05210 Chr3 (1037177..1041658) [4482 bp, 1493 aa] {ON}            70   1e-11
YOL075C Chr15 complement(189658..193542) [3885 bp, 1294 aa] {ON}...    70   1e-11
KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON} Anc_...    70   2e-11
TPHA0L01500 Chr12 (311715..316274) [4560 bp, 1519 aa] {ON} Anc_8...    70   2e-11
Smik_15.84 Chr15 complement(153969..157856) [3888 bp, 1295 aa] {...    70   2e-11
TPHA0A02310 Chr1 (483447..485705) [2259 bp, 752 aa] {ON} Anc_1.3...    69   3e-11
NCAS0A08570 Chr1 (1693304..1696486) [3183 bp, 1060 aa] {ON} Anc_...    69   3e-11
KNAG0I00530 Chr9 (88076..91219) [3144 bp, 1047 aa] {ON} Anc_1.42...    69   4e-11
Kwal_34.16240 s34 (257762..260020) [2259 bp, 752 aa] {ON} YFR009...    69   4e-11
KLTH0H13442g Chr8 complement(1175860..1178118) [2259 bp, 752 aa]...    69   4e-11
ZYRO0D11836g Chr4 (993707..998095) [4389 bp, 1462 aa] {ON} simil...    69   4e-11
Kwal_23.5161 s23 (1040608..1045077) [4470 bp, 1489 aa] {ON} YDR0...    69   5e-11
ZYRO0D11858g Chr4 (998646..1003157) [4512 bp, 1503 aa] {ON} high...    69   5e-11
CAGL0M01760g Chr13 (203616..208115) [4500 bp, 1499 aa] {ON} high...    69   6e-11
Skud_6.95 Chr6 complement(175462..177720) [2259 bp, 752 aa] {ON}...    68   6e-11
YNR070W Chr14 (765375..769376) [4002 bp, 1333 aa] {ON}  PDR18Put...    68   7e-11
SAKL0H21010g Chr8 (1835185..1839528) [4344 bp, 1447 aa] {ON} sim...    68   7e-11
Smik_14.399 Chr14 (709641..713906) [4266 bp, 1421 aa] {ON} YNR07...    68   7e-11
ZYRO0E04092g Chr5 (308495..311683) [3189 bp, 1062 aa] {ON} simil...    68   7e-11
ZYRO0F07018g Chr6 complement(571276..573861) [2586 bp, 861 aa] {...    68   7e-11
TBLA0A02440 Chr1 complement(582029..586894) [4866 bp, 1621 aa] {...    68   8e-11
Suva_15.91 Chr15 complement(162469..166377) [3909 bp, 1302 aa] {...    68   9e-11
Smik_15.333 Chr15 (575791..580323) [4533 bp, 1510 aa] {ON} YOR15...    68   9e-11
KNAG0A02100 Chr1 complement(177773..182290) [4518 bp, 1505 aa] {...    68   1e-10
KNAG0C04500 Chr3 complement(882896..887563) [4668 bp, 1555 aa] {...    68   1e-10
YOR153W Chr15 (619840..624375) [4536 bp, 1511 aa] {ON}  PDR5Plas...    67   1e-10
Smik_3.97 Chr3 complement(133624..136773) [3150 bp, 1049 aa] {ON...    67   1e-10
NDAI0C01220 Chr3 (246762..251291) [4530 bp, 1509 aa] {ON} Anc_5....    67   1e-10
KAFR0C00820 Chr3 (157878..162431) [4554 bp, 1517 aa] {ON}              67   1e-10
ZYRO0D17710g Chr4 complement(1466189..1470649) [4461 bp, 1486 aa...    67   1e-10
KAFR0E03460 Chr5 complement(695361..700001) [4641 bp, 1546 aa] {...    67   1e-10
CAGL0I04862g Chr9 complement(438338..442861) [4524 bp, 1507 aa] ...    67   1e-10
Skud_4.262 Chr4 (456192..460697) [4506 bp, 1501 aa] {ON} YDR011W...    67   2e-10
Ecym_2714 Chr2 (1380718..1382964) [2247 bp, 748 aa] {ON} similar...    67   2e-10
YPL147W Chr16 (273255..275867) [2613 bp, 870 aa] {ON}  PXA1Subun...    67   2e-10
KLTH0A01914g Chr1 complement(165071..169570) [4500 bp, 1499 aa] ...    67   2e-10
Suva_16.163 Chr16 (282462..285074) [2613 bp, 870 aa] {ON} YPL147...    67   2e-10
Smik_6.344 Chr6 complement(548373..550985) [2613 bp, 870 aa] {ON...    66   2e-10
Ecym_2410 Chr2 (797543..800029) [2487 bp, 828 aa] {ON} similar t...    66   2e-10
Ecym_3604 Chr3 complement(1143009..1147433) [4425 bp, 1474 aa] {...    67   2e-10
NDAI0E01240 Chr5 (244737..247430) [2694 bp, 897 aa] {ON} Anc_8.661     66   2e-10
Suva_2.583 Chr2 (1030711..1035324) [4614 bp, 1537 aa] {ON} YDR40...    67   2e-10
NCAS0D00580 Chr4 (96350..98611) [2262 bp, 753 aa] {ON} Anc_1.366       66   2e-10
KAFR0E03450 Chr5 complement(689571..694232) [4662 bp, 1553 aa] {...    66   3e-10
ZYRO0A04114g Chr1 complement(328582..333138) [4557 bp, 1518 aa] ...    66   3e-10
CAGL0F02717g Chr6 (261361..265989) [4629 bp, 1542 aa] {ON}             66   3e-10
KLLA0F11484g Chr6 (1052991..1055528) [2538 bp, 845 aa] {ON} simi...    66   3e-10
NCAS0E01630 Chr5 complement(308563..313260) [4698 bp, 1565 aa] {...    66   4e-10
Skud_4.680 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR40...    66   4e-10
Skud_4.681 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR40...    66   4e-10
Suva_3.37 Chr3 complement(47453..50614) [3162 bp, 1053 aa] {ON} ...    65   4e-10
NDAI0B02870 Chr2 complement(726822..730625) [3804 bp, 1267 aa] {...    65   4e-10
SAKL0H06908g Chr8 (605838..608348) [2511 bp, 836 aa] {ON} simila...    65   4e-10
CAGL0M07293g Chr13 complement(733072..737619) [4548 bp, 1515 aa]...    65   4e-10
KAFR0C01200 Chr3 (240350..244171) [3822 bp, 1273 aa] {ON} Anc_3....    65   4e-10
SAKL0F01606g Chr6 (133318..135144) [1827 bp, 608 aa] {ON} highly...    65   5e-10
Suva_8.204 Chr8 (368920..373455) [4536 bp, 1511 aa] {ON} YOR153W...    65   5e-10
NCAS0H02420 Chr8 (477754..482316) [4563 bp, 1520 aa] {ON} Anc_5....    65   5e-10
CAGL0M02387g Chr13 (280372..282942) [2571 bp, 856 aa] {ON} simil...    65   5e-10
KAFR0F01460 Chr6 (284981..288154) [3174 bp, 1057 aa] {ON} Anc_1....    65   5e-10
KNAG0G01040 Chr7 (221426..225631) [4206 bp, 1401 aa] {ON}  YIL013C     65   5e-10
KLTH0G19448g Chr7 (1676895..1681355) [4461 bp, 1486 aa] {ON} sim...    65   5e-10
Kwal_0.327 s0 complement(154643..157702) [3060 bp, 1019 aa] {ON}...    65   6e-10
KNAG0A02980 Chr1 (363468..366083) [2616 bp, 871 aa] {ON} Anc_8.6...    65   6e-10
ABR125C Chr2 complement(623888..628354) [4467 bp, 1488 aa] {ON} ...    65   6e-10
SAKL0D09394g Chr4 complement(780019..783102) [3084 bp, 1027 aa] ...    65   6e-10
KAFR0E03440 Chr5 complement(684043..688692) [4650 bp, 1549 aa] {...    65   6e-10
KLLA0B09702g Chr2 complement(842245..846801) [4557 bp, 1518 aa] ...    65   7e-10
CAGL0L07744g Chr12 (851958..855125) [3168 bp, 1055 aa] {ON} simi...    65   7e-10
KNAG0K01350 Chr11 complement(265564..270069) [4506 bp, 1501 aa] ...    65   7e-10
KAFR0E03480 Chr5 complement(701160..705818) [4659 bp, 1552 aa] {...    65   7e-10
TDEL0A03640 Chr1 (646252..650781) [4530 bp, 1509 aa] {ON} Anc_5....    65   8e-10
NCAS0E01650 Chr5 complement(319448..323914) [4467 bp, 1488 aa] {...    65   8e-10
NCAS0B05300 Chr2 (980856..984677) [3822 bp, 1273 aa] {ON} Anc_3....    65   8e-10
Suva_5.134 Chr5 complement(199609..201441) [1833 bp, 610 aa] {ON...    64   8e-10
Skud_15.317 Chr15 (568579..573117) [4539 bp, 1512 aa] {ON} YOR15...    65   9e-10
TDEL0B01210 Chr2 complement(219068..223606) [4539 bp, 1512 aa] {...    64   9e-10
Kpol_513.9 s513 (23141..27682) [4542 bp, 1513 aa] {ON} (23141..2...    64   9e-10
Kwal_27.9666 s27 complement(9636..14060) [4425 bp, 1474 aa] {ON}...    64   1e-09
NDAI0G01850 Chr7 complement(409416..413918) [4503 bp, 1500 aa] {...    64   1e-09
KNAG0K00950 Chr11 complement(186381..190235) [3855 bp, 1284 aa] ...    64   1e-09
YDR406W Chr4 (1279210..1283799) [4590 bp, 1529 aa] {ON}  PDR15Pl...    64   1e-09
KLLA0F21692g Chr6 complement(2014152..2018729) [4578 bp, 1525 aa...    64   1e-09
TBLA0G02820 Chr7 (745762..750297) [4536 bp, 1511 aa] {ON} Anc_3....    64   1e-09
NDAI0E02950 Chr5 complement(620841..625379) [4539 bp, 1512 aa] {...    64   1e-09
Ecym_1194 Chr1 (393697..395526) [1830 bp, 609 aa] {ON} similar t...    64   1e-09
NCAS0F00410 Chr6 (70678..75273) [4596 bp, 1531 aa] {ON}                64   1e-09
Smik_4.678 Chr4 (1200036..1204637) [4602 bp, 1533 aa] {ON} YDR40...    64   1e-09
Smik_4.244 Chr4 (445916..450421) [4506 bp, 1501 aa] {ON} YDR011W...    64   1e-09
Skud_16.135 Chr16 (244860..247472) [2613 bp, 870 aa] {ON} YPL147...    64   1e-09
YDR011W Chr4 (465919..470424) [4506 bp, 1501 aa] {ON}  SNQ2Plasm...    64   1e-09
KAFR0A01180 Chr1 (225692..230218) [4527 bp, 1508 aa] {ON} Anc_8....    64   2e-09
TBLA0H03470 Chr8 (847762..852312) [4551 bp, 1516 aa] {ON} Anc_8....    64   2e-09
TDEL0D02370 Chr4 (460691..462952) [2262 bp, 753 aa] {ON} Anc_1.3...    63   2e-09
SAKL0H10670g Chr8 complement(918091..922620) [4530 bp, 1509 aa] ...    64   2e-09
SAKL0C05654g Chr3 complement(532258..536787) [4530 bp, 1509 aa] ...    64   2e-09
NCAS0E00480 Chr5 (81549..83381) [1833 bp, 610 aa] {ON}                 63   2e-09
KAFR0C00830 Chr3 (163830..168284) [4455 bp, 1484 aa] {ON} Anc_3....    64   2e-09
TDEL0A06070 Chr1 complement(1064071..1066689) [2619 bp, 872 aa] ...    63   2e-09
NCAS0B01530 Chr2 complement(249743..252349) [2607 bp, 868 aa] {O...    63   2e-09
SAKL0G08008g Chr7 complement(673391..678040) [4650 bp, 1549 aa] ...    63   2e-09
KLLA0D04554g Chr4 complement(385733..388801) [3069 bp, 1022 aa] ...    63   2e-09
NDAI0G01840 Chr7 complement(404289..408797) [4509 bp, 1502 aa] {...    63   2e-09
SAKL0C11616g Chr3 complement(1041794..1046248) [4455 bp, 1484 aa...    63   2e-09
Smik_17.26 Chr17 complement(23946..28454) [4509 bp, 1502 aa] {ON...    63   3e-09
KLLA0D03476g Chr4 (296287..300969) [4683 bp, 1560 aa] {ON} simil...    63   3e-09
YCR011C Chr3 complement(133724..136873) [3150 bp, 1049 aa] {ON} ...    63   3e-09
AGL142C Chr7 complement(434247..438740) [4494 bp, 1497 aa] {ON} ...    63   3e-09
KLTH0G01452g Chr7 (105741..107564) [1824 bp, 607 aa] {ON} highly...    62   3e-09
KLTH0H12760g Chr8 complement(1083450..1086512) [3063 bp, 1020 aa...    62   4e-09
YER036C Chr5 complement(223367..225199) [1833 bp, 610 aa] {ON}  ...    62   4e-09
SAKL0C08074g Chr3 complement(747926..751699) [3774 bp, 1257 aa] ...    62   4e-09
AFR232C Chr6 complement(859612..861435) [1824 bp, 607 aa] {ON} S...    62   4e-09
NCAS0E01640 Chr5 complement(313479..317987) [4509 bp, 1502 aa] {...    62   4e-09
TDEL0D06020 Chr4 complement(1087102..1088934) [1833 bp, 610 aa] ...    62   4e-09
Kpol_1053.48 s1053 complement(92949..93236,93239..96817) [3867 b...    62   4e-09
NCAS0C02250 Chr3 complement(418244..422770) [4527 bp, 1508 aa] {...    62   5e-09
Ecym_8014 Chr8 (37756..42309) [4554 bp, 1517 aa] {ON} similar to...    62   5e-09
Kpol_1036.28 s1036 (70446..70928,73046..77023) [4461 bp, 1486 aa...    62   5e-09
Kpol_1050.26 s1050 complement(62452..64284) [1833 bp, 610 aa] {O...    62   6e-09
SAKL0C11704g Chr3 (1050447..1054979) [4533 bp, 1510 aa] {ON} sim...    62   6e-09
YOR328W Chr15 (931803..936497) [4695 bp, 1564 aa] {ON}  PDR10ATP...    62   6e-09
Smik_15.508 Chr15 (881347..886047) [4701 bp, 1566 aa] {ON} YOR32...    62   6e-09
Kpol_1035.32 s1035 (76084..76926) [843 bp, 280 aa] {ON} (76084.....    60   7e-09
Suva_7.3 Chr7 complement(6379..10671) [4293 bp, 1430 aa] {ON} YN...    62   7e-09
KLLA0D03432g Chr4 (287805..292256) [4452 bp, 1483 aa] {ON} simil...    62   7e-09
TPHA0M00640 Chr13 complement(117604..122076) [4473 bp, 1490 aa] ...    62   7e-09
Skud_5.145 Chr5 complement(221173..223005) [1833 bp, 610 aa] {ON...    61   7e-09
Smik_5.159 Chr5 complement(228179..230011) [1833 bp, 610 aa] {ON...    61   8e-09
ZYRO0E08800g Chr5 complement(702554..704386) [1833 bp, 610 aa] {...    61   8e-09
TBLA0F01040 Chr6 (252002..255817) [3816 bp, 1271 aa] {ON} Anc_3....    61   9e-09
TBLA0I01760 Chr9 (392252..397147) [4896 bp, 1631 aa] {ON} Anc_3....    61   1e-08
Suva_8.379 Chr8 (672487..677184) [4698 bp, 1565 aa] {ON} YPL058C...    61   1e-08
SAKL0C06996g Chr3 complement(649424..654061) [4638 bp, 1545 aa] ...    61   1e-08
Kwal_47.19116 s47 complement(1101559..1103382) [1824 bp, 607 aa]...    60   1e-08
NDAI0I03020 Chr9 complement(713821..715650) [1830 bp, 609 aa] {O...    60   1e-08
TPHA0O01000 Chr15 (185595..188630) [3036 bp, 1011 aa] {ON} Anc_1...    60   1e-08
TPHA0A04220 Chr1 complement(948357..952811) [4455 bp, 1484 aa] {...    61   1e-08
Kpol_1037.47 s1037 (114295..118818) [4524 bp, 1507 aa] {ON} (114...    60   1e-08
Kpol_1049.23 s1049 complement(67726..68058) [333 bp, 110 aa] {ON...    55   1e-08
Kpol_1050.16 s1050 complement(38346..41489) [3144 bp, 1047 aa] {...    60   1e-08
KLLA0F08833g Chr6 (822039..822860) [822 bp, 273 aa] {ON} similar...    59   2e-08
Ecym_2737 Chr2 (1425670..1428726) [3057 bp, 1018 aa] {ON} simila...    60   2e-08
TBLA0C01780 Chr3 complement(421045..423711) [2667 bp, 888 aa] {O...    60   2e-08
Suva_16.256 Chr16 complement(448846..453387) [4542 bp, 1513 aa] ...    60   2e-08
TPHA0A00840 Chr1 complement(163812..167750) [3939 bp, 1312 aa] {...    60   3e-08
Smik_16.179 Chr16 complement(321239..325774) [4536 bp, 1511 aa] ...    60   3e-08
ZYRO0F08888g Chr6 (716318..720880) [4563 bp, 1520 aa] {ON} highl...    60   3e-08
YPL058C Chr16 complement(445842..450377) [4536 bp, 1511 aa] {ON}...    60   3e-08
KAFR0C03470 Chr3 (707203..708039) [837 bp, 278 aa] {ON} Anc_8.42...    58   3e-08
ZYRO0F08866g Chr6 (709888..714450) [4563 bp, 1520 aa] {ON} highl...    60   3e-08
TPHA0A05890 Chr1 complement(1334117..1335949) [1833 bp, 610 aa] ...    59   3e-08
TBLA0I03330 Chr9 complement(806242..808074) [1833 bp, 610 aa] {O...    59   4e-08
TDEL0E00840 Chr5 complement(172712..175192) [2481 bp, 826 aa] {O...    59   4e-08
KLLA0A01452g Chr1 (130078..131901) [1824 bp, 607 aa] {ON} highly...    59   4e-08
NDAI0G05020 Chr7 (1217458..1220751) [3294 bp, 1097 aa] {ON} Anc_...    59   5e-08
NCAS0F00790 Chr6 complement(158502..162704) [4203 bp, 1400 aa] {...    59   5e-08
Skud_3.76 Chr3 complement(116029..119199) [3171 bp, 1056 aa] {ON...    59   5e-08
CAGL0I08019g Chr9 complement(783133..786990) [3858 bp, 1285 aa] ...    58   7e-08
Kpol_1012.10 s1012 complement(20013..20741,21318..21326,21750..2...    58   8e-08
Skud_16.225 Chr16 complement(410106..414641) [4536 bp, 1511 aa] ...    58   8e-08
ABR126W Chr2 (628624..633162) [4539 bp, 1512 aa] {ON} Non-synten...    58   1e-07
SAKL0G16280g Chr7 (1408229..1410607) [2379 bp, 792 aa] {ON} simi...    57   1e-07
AER190W Chr5 (994534..997569) [3036 bp, 1011 aa] {ON} Syntenic h...    57   2e-07
Smik_9.181 Chr9 complement(302896..307125) [4230 bp, 1409 aa] {O...    57   2e-07
CAGL0C02343g Chr3 (236112..236391,236790..238672) [2163 bp, 720 ...    57   2e-07
Skud_15.495 Chr15 (871539..876233) [4695 bp, 1564 aa] {ON} YOR32...    57   2e-07
KAFR0K01230 Chr11 (254346..258488) [4143 bp, 1380 aa] {ON}  YIL013C    57   2e-07
KNAG0B00460 Chr2 (76565..78547) [1983 bp, 660 aa] {ON} Anc_3.534...    57   2e-07
Ecym_3605 Chr3 (1148339..1152817) [4479 bp, 1492 aa] {ON} simila...    57   2e-07
ZYRO0B13266g Chr2 (1074171..1076639) [2469 bp, 822 aa] {ON} simi...    57   2e-07
Suva_9.192 Chr9 complement(316679..320920) [4242 bp, 1413 aa] {O...    57   2e-07
Kwal_27.12711 s27 (1342807..1346547) [3741 bp, 1246 aa] {ON} YOL...    57   2e-07
YIL013C Chr9 complement(328207..332442) [4236 bp, 1411 aa] {ON} ...    57   2e-07
KLLA0C04477g Chr3 complement(409543..413304) [3762 bp, 1253 aa] ...    56   3e-07
KAFR0G03010 Chr7 (623976..628094) [4119 bp, 1372 aa] {ON}  YIL013C     56   3e-07
NDAI0H01280 Chr8 complement(308593..312771) [4179 bp, 1392 aa] {...    56   4e-07
TBLA0A01150 Chr1 (262829..266992) [4164 bp, 1387 aa] {ON}              56   4e-07
AER091W Chr5 (809767..812172) [2406 bp, 801 aa] {ON} Syntenic ho...    55   5e-07
TPHA0B01940 Chr2 (434881..437436) [2556 bp, 851 aa] {ON} Anc_4.2...    55   7e-07
CAGL0F01419g Chr6 complement(142623..146819) [4197 bp, 1398 aa] ...    55   7e-07
NDAI0A03750 Chr1 complement(849511..851118) [1608 bp, 535 aa] {O...    54   8e-07
SAKL0B01518g Chr2 complement(148745..149542) [798 bp, 265 aa] {O...    53   9e-07
NCAS0I00670 Chr9 (111140..115240) [4101 bp, 1366 aa] {ON}              55   1e-06
KAFR0J02700 Chr10 complement(515978..517804) [1827 bp, 608 aa] {...    54   1e-06
Skud_15.174 Chr15 (310212..314393) [4182 bp, 1393 aa] {ON} YALI0...    54   1e-06
Skud_15.78 Chr15 complement(148836..152720) [3885 bp, 1294 aa] {...    54   1e-06
Smik_15.185 Chr15 (316883..321064) [4182 bp, 1393 aa] {ON} YNR07...    54   1e-06
KLTH0E15796g Chr5 (1400194..1403937) [3744 bp, 1247 aa] {ON} sim...    54   1e-06
TBLA0D02530 Chr4 complement(629614..630444) [831 bp, 276 aa] {ON...    52   2e-06
Suva_15.188 Chr15 (324904..329088) [4185 bp, 1394 aa] {ON} YOR01...    54   2e-06
KAFR0C02740 Chr3 complement(537867..539465) [1599 bp, 532 aa] {O...    52   3e-06
KNAG0L00680 Chr12 complement(105318..109460) [4143 bp, 1380 aa] ...    53   4e-06
YOR011W Chr15 (349679..353863) [4185 bp, 1394 aa] {ON}  AUS1Plas...    52   5e-06
NCAS0C03820 Chr3 complement(774039..774923) [885 bp, 294 aa] {ON...    50   7e-06
Kwal_33.15623 s33 (1193685..1195373) [1689 bp, 562 aa] {ON} YFR0...    51   8e-06
YFL028C Chr6 complement(79344..80213) [870 bp, 289 aa] {ON}  CAF...    50   1e-05
Skud_11.38 Chr11 complement(72504..75071) [2568 bp, 855 aa] {ON}...    50   2e-05
NDAI0G03160 Chr7 complement(744284..745141) [858 bp, 285 aa] {ON...    49   2e-05
Kwal_26.6702 s26 complement(29426..31279) [1854 bp, 617 aa] {ON}...    50   2e-05
NDAI0A08370 Chr1 complement(1924865..1929079) [4215 bp, 1404 aa]...    50   3e-05
Ecym_1500 Chr1 (1027467..1028318) [852 bp, 283 aa] {ON} similar ...    48   4e-05
Kpol_1002.105 s1002 complement(266533..268176) [1644 bp, 547 aa]...    49   4e-05
Smik_6.50 Chr6 complement(94583..95452) [870 bp, 289 aa] {ON} YF...    47   8e-05
Skud_9.159 Chr9 complement(298165..302388) [4224 bp, 1407 aa] {O...    48   1e-04
Kwal_YGOB_56.23429 s56 complement(532059..532313,532316..533998)...    48   1e-04
Kwal_56.23429 s56 complement(532382..533998) [1617 bp, 539 aa] {...    47   1e-04
KNAG0D02010 Chr4 complement(335815..337413) [1599 bp, 532 aa] {O...    47   1e-04
KLTH0H07942g Chr8 complement(696683..698269) [1587 bp, 528 aa] {...    47   1e-04
TBLA0A08720 Chr1 complement(2139184..2140668) [1485 bp, 494 aa] ...    47   1e-04
Suva_6.30 Chr6 complement(52879..53748) [870 bp, 289 aa] {ON} YF...    46   2e-04
SAKL0H19294g Chr8 complement(1703651..1705213) [1563 bp, 520 aa]...    47   2e-04
KLLA0C17556g Chr3 complement(1544404..1546227) [1824 bp, 607 aa]...    47   2e-04
KNAG0D04550 Chr4 (824870..827338) [2469 bp, 822 aa] {ON} Anc_4.2...    47   2e-04
Kpol_1055.54 s1055 complement(131851..134565) [2715 bp, 904 aa] ...    47   2e-04
TPHA0L00810 Chr12 (157823..161944) [4122 bp, 1373 aa] {ON}             47   2e-04
Ecym_3232 Chr3 complement(431386..433830) [2445 bp, 814 aa] {ON}...    47   2e-04
TDEL0C00680 Chr3 complement(110674..111519) [846 bp, 281 aa] {ON...    45   3e-04
KAFR0I02110 Chr9 (433759..436896) [3138 bp, 1045 aa] {ON} Anc_1....    47   3e-04
TBLA0A05970 Chr1 (1471379..1474975) [3597 bp, 1198 aa] {ON} Anc_...    46   3e-04
Ecym_1312 Chr1 complement(630006..633140) [3135 bp, 1044 aa] {ON...    46   3e-04
TPHA0D00450 Chr4 complement(76541..77377) [837 bp, 278 aa] {ON} ...    45   3e-04
TDEL0B04340 Chr2 complement(764357..766018) [1662 bp, 553 aa] {O...    46   4e-04
AGR125W Chr7 (987077..988900) [1824 bp, 607 aa] {ON} Syntenic ho...    46   4e-04
Kwal_56.24221 s56 complement(908983..912147) [3165 bp, 1054 aa] ...    46   4e-04
Skud_6.42 Chr6 complement(82602..83471) [870 bp, 289 aa] {ON} YF...    45   4e-04
SAKL0H17996g Chr8 (1607260..1609323) [2064 bp, 687 aa] {ON} high...    46   4e-04
Kwal_YGOB_56.24219 s56 complement(908618..909109,909112..912147)...    46   4e-04
KLTH0H03300g Chr8 (295271..298801) [3531 bp, 1176 aa] {ON} simil...    46   4e-04
KNAG0I01340 Chr9 complement(258887..262024) [3138 bp, 1045 aa] {...    46   5e-04
TBLA0G02050 Chr7 complement(537114..540098) [2985 bp, 994 aa] {O...    46   5e-04
KNAG0F01740 Chr6 (326444..329950) [3507 bp, 1168 aa] {ON} Anc_6....    45   6e-04
AAL028W Chr1 (291808..294942) [3135 bp, 1044 aa] {ON} Syntenic h...    45   6e-04
YDR091C Chr4 complement(626708..628534) [1827 bp, 608 aa] {ON}  ...    45   7e-04
CAGL0G05093g Chr7 complement(483230..484864) [1635 bp, 544 aa] {...    45   7e-04
SAKL0A03586g Chr1 (328346..331885) [3540 bp, 1179 aa] {ON} simil...    45   0.001
NCAS0B04350 Chr2 complement(786960..788561) [1602 bp, 533 aa] {O...    45   0.001
TPHA0H01820 Chr8 complement(415382..418765) [3384 bp, 1127 aa] {...    45   0.001
KAFR0G03410 Chr7 (702624..705056) [2433 bp, 810 aa] {ON} Anc_4.2...    45   0.001
KLTH0D15246g Chr4 (1257193..1259589) [2397 bp, 798 aa] {ON} simi...    45   0.001
NCAS0D03950 Chr4 (737216..740788) [3573 bp, 1190 aa] {ON} Anc_6....    45   0.001
Smik_12.322 Chr12 (581596..584730) [3135 bp, 1044 aa] {ON} YLR24...    45   0.001
YLR249W Chr12 (636780..639914) [3135 bp, 1044 aa] {ON}  YEF3Gamm...    44   0.001
Suva_10.346 Chr10 (604006..607140) [3135 bp, 1044 aa] {ON} YLR24...    44   0.001
Kpol_487.13 s487 complement(50878..54012) [3135 bp, 1044 aa] {ON...    44   0.001
KNAG0E03270 Chr5 complement(655376..656218) [843 bp, 280 aa] {ON...    43   0.002
ZYRO0E07634g Chr5 complement(593495..597025) [3531 bp, 1176 aa] ...    44   0.002
Suva_2.220 Chr2 (374470..376092) [1623 bp, 540 aa] {ON} YDR061W ...    44   0.002
Smik_4.299 Chr4 (540966..542588) [1623 bp, 540 aa] {ON} YDR061W ...    44   0.002
KLTH0H11902g Chr8 (1017096..1020230) [3135 bp, 1044 aa] {ON} hig...    44   0.002
Skud_16.52 Chr16 (95317..98853) [3537 bp, 1178 aa] {ON} YPL226W ...    44   0.002
KAFR0H03200 Chr8 complement(610545..613694) [3150 bp, 1049 aa] {...    44   0.002
YDR061W Chr4 (574164..575783) [1620 bp, 539 aa] {ON} Protein wit...    44   0.002
ZYRO0F03234g Chr6 complement(273742..274569) [828 bp, 275 aa] {O...    43   0.002
Kwal_23.4045 s23 complement(543590..545875) [2286 bp, 761 aa] {O...    44   0.002
Kpol_1002.29 s1002 (89520..93068) [3549 bp, 1182 aa] {ON} (89520...    44   0.002
YPL226W Chr16 (121767..125357) [3591 bp, 1196 aa] {ON}  NEW1ATP ...    44   0.002
Ecym_5560 Chr5 complement(1134384..1136207) [1824 bp, 607 aa] {O...    44   0.002
KAFR0A07090 Chr1 complement(1427525..1431157) [3633 bp, 1210 aa]...    44   0.002
Skud_12.330 Chr12 (583354..586488) [3135 bp, 1044 aa] {ON} YLR24...    44   0.002
Smik_4.334 Chr4 complement(592554..594380) [1827 bp, 608 aa] {ON...    44   0.002
NDAI0G00810 Chr7 (169366..172515) [3150 bp, 1049 aa] {ON} Anc_1....    44   0.002
KLLA0C16115g Chr3 (1405766..1409317) [3552 bp, 1183 aa] {ON} sim...    44   0.002
Smik_6.431 Chr6 complement(699005..702574) [3570 bp, 1189 aa] {O...    44   0.002
CAGL0D00352g Chr4 complement(42946..45531) [2586 bp, 861 aa] {ON...    44   0.002
TBLA0F03760 Chr6 complement(924333..926159) [1827 bp, 608 aa] {O...    43   0.003
NCAS0A02680 Chr1 (510902..513559) [2658 bp, 885 aa] {ON} Anc_4.287     43   0.003
Kwal_0.167 s0 (88989..92123) [3135 bp, 1044 aa] {ON} YNL014W (HE...    43   0.003
CAGL0B03487g Chr2 complement(345399..348536) [3138 bp, 1045 aa] ...    43   0.003
NDAI0I00960 Chr9 complement(226758..230396) [3639 bp, 1212 aa] {...    43   0.003
Suva_16.80 Chr16 (131166..134702) [3537 bp, 1178 aa] {ON} YPL226...    43   0.003
CAGL0D03674g Chr4 (370066..373626) [3561 bp, 1186 aa] {ON} highl...    43   0.003
YNL014W Chr14 (606319..609453) [3135 bp, 1044 aa] {ON}  HEF3Tran...    43   0.003
Suva_14.333 Chr14 (585838..588972) [3135 bp, 1044 aa] {ON} YNL01...    43   0.003
TDEL0F01870 Chr6 (348408..351950) [3543 bp, 1180 aa] {ON} Anc_6....    43   0.003
Ecym_2164 Chr2 (314802..318317) [3516 bp, 1171 aa] {ON} similar ...    43   0.004
NDAI0D04610 Chr4 (1084921..1087599) [2679 bp, 892 aa] {ON} Anc_4...    43   0.004
Smik_14.315 Chr14 (564639..567773) [3135 bp, 1044 aa] {ON} YNL01...    43   0.004
AFL131W Chr6 (186656..190225) [3570 bp, 1189 aa] {ON} Syntenic h...    43   0.004
TDEL0B06150 Chr2 complement(1083103..1086237) [3135 bp, 1044 aa]...    43   0.004
NCAS0A08760 Chr1 complement(1729600..1732737) [3138 bp, 1045 aa]...    43   0.004
NCAS0A06310 Chr1 complement(1243683..1246823) [3141 bp, 1046 aa]...    43   0.004
KLLA0F12210g Chr6 (1125630..1128764) [3135 bp, 1044 aa] {ON} hig...    42   0.005
Skud_14.314 Chr14 (573040..576174) [3135 bp, 1044 aa] {ON} YNL01...    42   0.005
TBLA0D04410 Chr4 complement(1093035..1096169) [3135 bp, 1044 aa]...    42   0.005
TPHA0O00680 Chr15 (128579..131713) [3135 bp, 1044 aa] {ON} Anc_1...    42   0.005
CAGL0K12474g Chr11 (1218012..1218896) [885 bp, 294 aa] {ON} simi...    42   0.005
SAKL0D08316g Chr4 (695101..698235) [3135 bp, 1044 aa] {ON} highl...    42   0.006
NDAI0G05180 Chr7 complement(1254531..1257665) [3135 bp, 1044 aa]...    42   0.006
Skud_4.351 Chr4 complement(602770..604596) [1827 bp, 608 aa] {ON...    42   0.007
ZYRO0E05148g Chr5 complement(387268..390405) [3138 bp, 1045 aa] ...    42   0.007
Suva_11.36 Chr11 complement(70977..73538) [2562 bp, 853 aa] {ON}...    42   0.007
Smik_11.42 Chr11 complement(71610..74165) [2556 bp, 851 aa] {ON}...    42   0.008
KLTH0G14520g Chr7 (1276585..1278411) [1827 bp, 608 aa] {ON} high...    41   0.009
Kpol_1048.72 s1048 complement(202581..205715) [3135 bp, 1044 aa]...    42   0.009
TDEL0A01370 Chr1 (248469..250292) [1824 bp, 607 aa] {ON} Anc_8.2...    41   0.010
Skud_4.316 Chr4 (550218..551840) [1623 bp, 540 aa] {ON} YDR061W ...    41   0.010
KLLA0B02563g Chr2 complement(222951..225377) [2427 bp, 808 aa] {...    41   0.013
YKL188C Chr11 complement(86225..88786) [2562 bp, 853 aa] {ON}  P...    41   0.013
Ecym_5557 Chr5 (1126965..1128539) [1575 bp, 524 aa] {ON} similar...    41   0.014
TPHA0A01980 Chr1 (400671..402494) [1824 bp, 607 aa] {ON} Anc_8.2...    40   0.024
Kpol_364.12 s364 (26116..27537) [1422 bp, 473 aa] {ON} (26116..2...    40   0.025
Kwal_14.1242 s14 (250275..251084) [810 bp, 269 aa] {ON} YFL028C ...    39   0.028
Kpol_1032.48 s1032 complement(108249..110072) [1824 bp, 607 aa] ...    40   0.035
ZYRO0B11616g Chr2 complement(910480..912303) [1824 bp, 607 aa] {...    39   0.036
TPHA0H00120 Chr8 complement(11464..13092) [1629 bp, 542 aa] {ON}...    39   0.046
Suva_2.252 Chr2 complement(426492..428318) [1827 bp, 608 aa] {ON...    39   0.054
NCAS0B04030 Chr2 (730062..731888) [1827 bp, 608 aa] {ON} Anc_8.2...    39   0.062
CAGL0G08041g Chr7 complement(758811..760634) [1824 bp, 607 aa] {...    38   0.11 
Kwal_14.2052 s14 complement(589149..590720) [1572 bp, 523 aa] {O...    38   0.12 
KAFR0A02430 Chr1 (508632..510455) [1824 bp, 607 aa] {ON} Anc_8.2...    38   0.12 
ZYRO0G09130g Chr7 (732487..734034) [1548 bp, 515 aa] {ON} simila...    37   0.17 
AFR152C Chr6 complement(710014..710826) [813 bp, 270 aa] {ON} Sy...    37   0.20 
Ecym_1222 Chr1 complement(458018..462082) [4065 bp, 1354 aa] {ON...    37   0.20 
Smik_5.344 Chr5 complement(529147..535632) [6486 bp, 2161 aa] {O...    37   0.28 
KNAG0H02970 Chr8 complement(548970..550802) [1833 bp, 610 aa] {O...    35   0.54 
KLTH0G18326g Chr7 complement(1579374..1580183) [810 bp, 269 aa] ...    35   0.56 
KLLA0D02156g Chr4 complement(184520..186085) [1566 bp, 521 aa] {...    35   0.83 
NDAI0A03440 Chr1 (789010..790836) [1827 bp, 608 aa] {ON} Anc_8.2...    35   0.90 
Kwal_27.12817 s27 (1386470..1389226) [2757 bp, 919 aa] {ON} YDR4...    34   1.5  
ADR011C Chr4 complement(721693..724926) [3234 bp, 1077 aa] {ON} ...    34   1.5  
Smik_2.369 Chr2 complement(659801..661306) [1506 bp, 501 aa] {ON...    33   2.1  
SAKL0A06908g Chr1 (612325..613836) [1512 bp, 503 aa] {ON} simila...    33   3.0  
NCAS0B02520 Chr2 (422176..422730) [555 bp, 184 aa] {ON} Anc_8.47...    32   4.3  
NDAI0F01880 Chr6 complement(456673..458262) [1590 bp, 529 aa] {O...    33   4.6  
Smik_8.98 Chr8 complement(150304..152475) [2172 bp, 723 aa] {ON}...    32   6.0  
TDEL0C01300 Chr3 (222485..223504) [1020 bp, 339 aa] {ON} Anc_8.1...    32   6.9  
KLTH0H06380g Chr8 (559500..561026) [1527 bp, 508 aa] {ON} simila...    32   7.2  
YHR031C Chr8 complement(170799..172970) [2172 bp, 723 aa] {ON}  ...    32   8.0  

>KLLA0D00748g Chr4 complement(69839..72208) [2370 bp, 789 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 789

 Score = 1488 bits (3852), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 738/789 (93%), Positives = 738/789 (93%)

Query: 1   MLKPVXXXXXXXXXXXXXXXXSNPLLSITRRFDDRLSLPISSIRTLNYAVNRFGEMKGNQ 60
           MLKPV                SNPLLSITRRFDDRLSLPISSIRTLNYAVNRFGEMKGNQ
Sbjct: 1   MLKPVLGLRGSIGRGRGLLALSNPLLSITRRFDDRLSLPISSIRTLNYAVNRFGEMKGNQ 60

Query: 61  RFPSAGIRSFSITLRNRNEASDVGGNGKHQEGEDKTPDKKTNKPSSTVSGGLADVKRLFY 120
           RFPSAGIRSFSITLRNRNEASDVGGNGKHQEGEDKTPDKKTNKPSSTVSGGLADVKRLFY
Sbjct: 61  RFPSAGIRSFSITLRNRNEASDVGGNGKHQEGEDKTPDKKTNKPSSTVSGGLADVKRLFY 120

Query: 121 LARHDWKMLVLAVSLLTVSCTIGMAVPKVIGLVLDATKNALXXXXXXXXXXXLEDSKSLT 180
           LARHDWKMLVLAVSLLTVSCTIGMAVPKVIGLVLDATKNAL           LEDSKSLT
Sbjct: 121 LARHDWKMLVLAVSLLTVSCTIGMAVPKVIGLVLDATKNALSGSNTNNGNGGLEDSKSLT 180

Query: 181 LDDLPPIVGDIQLYDXXXXXXXXXXXXTMANFGRVVLLKILGERLVARLRSNVIKKTMHH 240
           LDDLPPIVGDIQLYD            TMANFGRVVLLKILGERLVARLRSNVIKKTMHH
Sbjct: 181 LDDLPPIVGDIQLYDFFLLFGGALLIGTMANFGRVVLLKILGERLVARLRSNVIKKTMHH 240

Query: 241 DMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGMMFHISSTLASVL 300
           DMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGMMFHISSTLASVL
Sbjct: 241 DMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGMMFHISSTLASVL 300

Query: 301 FLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYN 360
           FLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYN
Sbjct: 301 FLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYN 360

Query: 361 NAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYT 420
           NAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYT
Sbjct: 361 NAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYT 420

Query: 421 EYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIKSTTGKAFKPLNGKVEFQHVSFS 480
           EYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIKSTTGKAFKPLNGKVEFQHVSFS
Sbjct: 421 EYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIKSTTGKAFKPLNGKVEFQHVSFS 480

Query: 481 YPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITK 540
           YPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITK
Sbjct: 481 YPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITK 540

Query: 541 LSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNG 600
           LSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNG
Sbjct: 541 LSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNG 600

Query: 601 YETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKS 660
           YETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKS
Sbjct: 601 YETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKS 660

Query: 661 KELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLLTXXXXXXXX 720
           KELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLLT        
Sbjct: 661 KELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLLTEPSEQQHS 720

Query: 721 XXXXYAPPAITQESEPQTEENGKDDSGEDQNSDHEENSQDQNEKRLQEEVIHQVLEDISH 780
               YAPPAITQESEPQTEENGKDDSGEDQNSDHEENSQDQNEKRLQEEVIHQVLEDISH
Sbjct: 721 QHQQYAPPAITQESEPQTEENGKDDSGEDQNSDHEENSQDQNEKRLQEEVIHQVLEDISH 780

Query: 781 DQKTSTLRP 789
           DQKTSTLRP
Sbjct: 781 DQKTSTLRP 789

>SAKL0E00748g Chr5 complement(50683..53007) [2325 bp, 774 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 774

 Score =  973 bits (2515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/692 (68%), Positives = 574/692 (82%), Gaps = 28/692 (4%)

Query: 99  KKTNKPSSTVSG-GLADVKRLFYLARHDWKMLVLAVSLLTVSCTIGMAVPKVIGLVLDAT 157
           KK  + +S  SG G  ++ RLF LARHDWK+L++A+SLLT+SC+IGMAVPKVIG+VLD  
Sbjct: 110 KKEQESTSGNSGAGYKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVA 169

Query: 158 KNALXXXXXXXXXXXLEDSKSLTLDDLPPIVGDIQLYDXXXXXXXXXXXXTMANFGRVVL 217
           KNA+             D K   L DLPP+V  + LYD            T ANFGRVVL
Sbjct: 170 KNAIT-----------SDEKPKDLRDLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVL 218

Query: 218 LKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFK 277
           L+ILGE+LVARLRSNVIKKT+H D EF+DRNKVGDL+SRL +DAY+VSRSMTQNISDGFK
Sbjct: 219 LRILGEKLVARLRSNVIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFK 278

Query: 278 ALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAE 337
           A+ICGGVGIGMMFHISSTLA+ LFLFAPPLLVGATIYG KIR+ISR+LQQ++GNLTKVAE
Sbjct: 279 AIICGGVGIGMMFHISSTLATALFLFAPPLLVGATIYGRKIRSISRDLQQSTGNLTKVAE 338

Query: 338 EQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLA 397
           EQLSG+KTVQSFVAE KE+ RYN+A+R+VF+VGK+EA TNATFFSST+VLGDFSFL+VLA
Sbjct: 339 EQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLA 398

Query: 398 YGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTI 457
           YGSHLVLQG+L+IGDLTAFMLYTEY+GSAVFGLS FYSELMKGAGAA+RLFEL D++P+I
Sbjct: 399 YGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSI 458

Query: 458 KSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIA 517
            +T G  + P  G+++F++VSFSYPTR  NQIF +LNFTI+ GSNVC+VGPSGRGKSTIA
Sbjct: 459 YATKGVPYVPGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIA 518

Query: 518 SLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPS 577
           SLLL+YYNPTSG+I +DGQDI+K+S+KSLRR LGVVQQEPILMSG+IR+NITYGV   P+
Sbjct: 519 SLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPT 578

Query: 578 MEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDE 637
           ++EIRSV+KKCFCH FI+KF +GYET+IGP+GALLSGGQKQRIAIARAL+ KP ILILDE
Sbjct: 579 IDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDE 638

Query: 638 ATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFK 697
           ATSALDVESEGAINYTLG+LMKS+++TIISIAHRLSTIRRSENVIVLG DGSVVEMGKFK
Sbjct: 639 ATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFK 698

Query: 698 DLYANHDSALHKLLTXXXXXXXXXXXXYAPPAITQESEPQTEENGKDDSGEDQNSDHEEN 757
           +LYA+ +S L+KLL              A    ++ +    E+N      E  N + +E 
Sbjct: 699 ELYASKESKLYKLLNEK-----------AKDTTSKMNAETVEKNDPSPKTEKLNDEEKE- 746

Query: 758 SQDQNEKRLQEEVIHQVLEDISHDQKTSTLRP 789
                ++R++E+V++QVL+D+++DQK+++LRP
Sbjct: 747 ----EQRRIEEQVLNQVLDDMNYDQKSTSLRP 774

>KLTH0C11616g Chr3 (956011..958233) [2223 bp, 740 aa] {ON} similar
           to uniprot|P33311 Saccharomyces cerevisiae YPL270W MDL2
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane
          Length = 740

 Score =  924 bits (2389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/706 (65%), Positives = 547/706 (77%), Gaps = 55/706 (7%)

Query: 84  GGNGKHQEGEDKTPDKKTNKPSSTVSGGLADVKRLFYLARHDWKMLVLAVSLLTVSCTIG 143
           GG   ++  E+K+   KTN           ++ RL  LARHDWK+L +A+ LLT+S T+G
Sbjct: 90  GGKANNESTEEKS---KTN---------YREILRLIRLARHDWKLLSVAIGLLTISSTVG 137

Query: 144 MAVPKVIGLVLDATKNALXXXXXXXXXXXLEDSKSLTLDDLPPIVGDIQLYDXXXXXXXX 203
           M +PKVIG+VLDA KNA               S  +TL+DLPPI+  + ++D        
Sbjct: 138 MTIPKVIGIVLDAVKNASGGF-----------SGPMTLEDLPPIIYGLGMFDFLAIFAGI 186

Query: 204 XXXXTMANFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYI 263
               T+ANFGR+VLL++LGE+LVARLRSNVIKK +H D EF+DRNKVGDL+SRL +DAY+
Sbjct: 187 LVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYV 246

Query: 264 VSRSMTQNISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISR 323
           VSRSMTQN+SDGFKA+ICGGVGIGMM +IS++L S LFLFAPPLLVGA IYG KIR ISR
Sbjct: 247 VSRSMTQNVSDGFKAIICGGVGIGMMINISASLTSALFLFAPPLLVGALIYGKKIRMISR 306

Query: 324 ELQQASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSS 383
           ELQ+++GNLTKV+EEQLSG+KT+Q+FVAEGKE+HRYNNA+R+VF+ GKKEA TNATFFSS
Sbjct: 307 ELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSS 366

Query: 384 TNVLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGA 443
           T +LGD SFL+VLAYGSHLVLQG L++GDLTAFMLYTEYTGSAVFGLS FYSELMKGAGA
Sbjct: 367 TGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGA 426

Query: 444 ATRLFELLDYKPTIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNV 503
           A+RLFE+ D+   IK ++GK + P  G+++F+ VSFSYPTR  NQIF  LNFTIEPGSNV
Sbjct: 427 ASRLFEMTDHTSQIKPSSGKPYVPSWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNV 486

Query: 504 CIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGT 563
           C+VGPSGRGKSTIASLLLRYY+P SG+I++DGQ+I+KLS KSLRR LGVVQQEP+LMSG+
Sbjct: 487 CVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGS 546

Query: 564 IRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIA 623
           IR N+TYG++ + +M+EIRSVAKKCFCH FI+KFP GYET+IGPRGA LSGGQKQRIAIA
Sbjct: 547 IRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIA 606

Query: 624 RALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIV 683
           RAL+ KPKILILDEATSALDVESEGAINYTLGRLM+S+ELTIISIAHRLSTIRRSENVIV
Sbjct: 607 RALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIV 666

Query: 684 LGIDGSVVEMGKFKDLYANHDSALHKLLTXXXXXXXXXXXXYAPPAITQESEPQTEENGK 743
           LG DGSVVEMGKFK+LYAN  S L KLL                                
Sbjct: 667 LGNDGSVVEMGKFKELYANDQSELFKLL-------------------------------- 694

Query: 744 DDSGEDQNSDHEENSQDQNEKRLQEEVIHQVLEDISHDQKTSTLRP 789
           +D    Q      NS +  E  + ++V+ QV  D + DQK+S L P
Sbjct: 695 NDKKPTQLQSQSRNSVETKENEVDDQVLEQVANDFNLDQKSSKLTP 740

>Ecym_3007 Chr3 complement(14335..16644) [2310 bp, 769 aa] {ON}
           similar to Ashbya gossypii ACR022W
          Length = 769

 Score =  923 bits (2386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/736 (63%), Positives = 564/736 (76%), Gaps = 34/736 (4%)

Query: 63  PSAGIRSFSITLRNRNEASDVGGNGKHQEGEDKTPDKKTNKPSSTVSGGLADVKRLFYLA 122
           P  G  S S T ++ +      GNG+    +D   D +  K +S    G  +V RL  LA
Sbjct: 59  PKRGYSSLSKTKKDND------GNGRGLLKDDN--DTQVQKETSV---GWREVLRLCSLA 107

Query: 123 RHDWKMLVLAVSLLTVSCTIGMAVPKVIGLVLDATKNALXXXXXXXXXXXL---EDSKSL 179
           +HDWK+L +A+ LL+VSCTIGMAVPKVIGLVLDATKN L               ED +SL
Sbjct: 108 KHDWKLLAVAIGLLSVSCTIGMAVPKVIGLVLDATKNTLKSSYEKGSQDLEGVNEDKESL 167

Query: 180 ------TLDDLPPIVGDIQLYDXXXXXXXXXXXXTMANFGRVVLLKILGERLVARLRSNV 233
                 +LD LPPIVG + +                ANFGRVVLLKI+GERLV+RLRS V
Sbjct: 168 IAGPIASLDALPPIVGTLSITQFVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQV 227

Query: 234 IKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGMMFHIS 293
           IK+TMHHD+EF+DRNKVGDL+SR G+DAY+VSRSMTQN+SDGFKA+ICGGVG+GMMFHIS
Sbjct: 228 IKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHIS 287

Query: 294 STLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEEQLSGIKTVQSFVAEG 353
           STL SV+ LFAPPLLVGA IYG KI AISR+LQQ+SGNLT+VAEEQL+GI+T++SFVAE 
Sbjct: 288 STLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEK 347

Query: 354 KEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAYGSHLVLQGNLTIGDL 413
           KE+ RYN+A+RQ+F VGK+EAFTNATFFSST +LGD SF++VL YG++LVLQG L+IGDL
Sbjct: 348 KEIRRYNDAIRQLFYVGKREAFTNATFFSSTTILGDMSFVIVLLYGANLVLQGALSIGDL 407

Query: 414 TAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIKSTTGKAFKPLNGKVE 473
           TAFMLYTEYTGS+VFGLSTFYSELMKGAGAA+RLFEL+D+K +++S    A  P  GK+E
Sbjct: 408 TAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQGKIE 467

Query: 474 FQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILV 533
           F+ VSFSYPTR +NQIFK ++FTIEPGSNVCIVGPSG+GKSTI SLLLR+Y+P  G IL+
Sbjct: 468 FRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILI 527

Query: 534 DGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAF 593
           D  DI+K ++KSLRR LGVVQQEP LMSGTIR+NITYG+S  P+M+EIR V+K+CFCH F
Sbjct: 528 DNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGF 587

Query: 594 ISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYT 653
           I+KFP+GY+T+IGPRGA LSGGQ+QRIAIARAL+ KPKILILDEATSALDVESEGAINYT
Sbjct: 588 ITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYT 647

Query: 654 LGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLLTX 713
           LG LM+SKELTIISIAHRLSTIRRSEN+IV+G DGSVVE+GKF  LY N +S L KLL  
Sbjct: 648 LGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNE 707

Query: 714 XXXXXXXXXXXYAPPAITQESEPQTEENGKDDSGEDQNSDHEENSQDQNEKRLQEEVIHQ 773
                               S+ +   +   DS ++ ++   E+   ++   + ++V+  
Sbjct: 708 KDHDLV--------------SKSENTSDIPPDSPKNDDASGLEHLVAEDVASINDKVVKN 753

Query: 774 VLEDISHDQKTSTLRP 789
           VL DI+HD+ +STLRP
Sbjct: 754 VLNDITHDKNSSTLRP 769

>Kwal_56.22329 s56 complement(50448..52778) [2331 bp, 776 aa] {ON}
           YPL270W (MDL2) - ATP-binding cassette (ABC) transporter
           family member [contig 186] FULL
          Length = 776

 Score =  921 bits (2380), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/708 (65%), Positives = 543/708 (76%), Gaps = 46/708 (6%)

Query: 88  KHQEGEDKTPDKKTNKPSSTVSG------GLADVKRLFYLARHDWKMLVLAVSLLTVSCT 141
           K  E + KTP  K ++ S T+        G  +V RLF LA HDWK+L  A+ LL +S  
Sbjct: 109 KTVESQAKTPADKESQKSGTMEDEESPNMGYKEVIRLFKLATHDWKLLTFAIGLLAISSV 168

Query: 142 IGMAVPKVIGLVLDATKNALXXXXXXXXXXXLEDSKSLTLDDLPPIVGDIQLYDXXXXXX 201
           IGM++PKVIG+VLDA KN                +  + LDDLPPIV D+ +Y+      
Sbjct: 169 IGMSIPKVIGMVLDAIKNTYSSA-----------TGPVGLDDLPPIVNDLSMYEFLGIFA 217

Query: 202 XXXXXXTMANFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADA 261
                 T+ANFGR+VLL++LGE+LVARLRSNVI+K +H D EF+DRNKVGDL+SRL +DA
Sbjct: 218 GALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDA 277

Query: 262 YIVSRSMTQNISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAI 321
           Y+VSRSMTQN+SDGFKA+ICGGVGIGMM +IS +L S L +FAPPLL+GA IYG +IR I
Sbjct: 278 YVVSRSMTQNVSDGFKAIICGGVGIGMMVNISISLTSALLMFAPPLLIGALIYGKRIRMI 337

Query: 322 SRELQQASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFF 381
           SR+LQ+++GNLT+V+EEQLSG+KT+QSFVAEGKE+ RYN A+R+VF  GKKEA TNATFF
Sbjct: 338 SRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFF 397

Query: 382 SSTNVLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGA 441
           SSTNVLGD SFL+VLAYGSHLVLQG LT+GDLTAFMLYTEYTGSAVFGLS FYSELMKGA
Sbjct: 398 SSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGA 457

Query: 442 GAATRLFELLDYKPTIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGS 501
           GAA+RLFE+ D+ P+IK T GK + P +GK+ F+ VSFSYPTR  NQIF  LNFTIEPGS
Sbjct: 458 GAASRLFEMTDHAPSIKPTAGKPYVPGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGS 517

Query: 502 NVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMS 561
           NVCIVGPSGRGKSTI SLLLRYYNP+SG+I +D QDI++LS KSLRR LGVVQQEP+LMS
Sbjct: 518 NVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMS 577

Query: 562 GTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIA 621
           G+I+ N+TYG+  + SM+EIRSVAKKCFCH F++KFPNGY+TIIGPRGA LSGGQKQRIA
Sbjct: 578 GSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIA 637

Query: 622 IARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENV 681
           IARAL+ KPKILILDEATSALDVESEGAINYTLG+LMKSKELTIISIAHRLSTIRRSENV
Sbjct: 638 IARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENV 697

Query: 682 IVLGIDGSVVEMGKFKDLYANHDSALHKLLTXXXXXXXXXXXXYAPPAITQESEPQTEEN 741
           IVLG DGSVVE+GKFKDLYA+  S L+KLL                P    +S+P+    
Sbjct: 698 IVLGNDGSVVEVGKFKDLYADQQSELYKLLNDKKRDK---------PTPRVQSDPE---- 744

Query: 742 GKDDSGEDQNSDHEENSQDQNEKRLQEEVIHQVLEDISHDQKTSTLRP 789
                      D E+  Q  N+ R       QV  D + DQK+S L P
Sbjct: 745 ----------KDREQEHQIDNQVR------EQVANDFNLDQKSSKLTP 776

>ACR022W Chr3 (395427..397691) [2265 bp, 754 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL270W (MDL2)
          Length = 754

 Score =  910 bits (2351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/710 (64%), Positives = 547/710 (77%), Gaps = 31/710 (4%)

Query: 80  ASDVGGNG------KHQEGEDKTPDKKTNKPS---STVSGGLADVKRLFYLARHDWKMLV 130
           A+ VGG G      K  E E K  +K+  +PS        G  +V RL  L + DWK+L+
Sbjct: 63  AARVGGEGTPSPRDKEHEQERKV-EKRPAEPSRAQPAKPAGWHEVFRLLRLVKPDWKLLL 121

Query: 131 LAVSLLTVSCTIGMAVPKVIGLVLDATKNALXXXXXXXXXXXLEDSKSLTLDDLPPIVGD 190
            A+ LLT+SC+IGMAVPKVIGLVLDATK+A+            E    ++L D+P I+G+
Sbjct: 122 AALGLLTISCSIGMAVPKVIGLVLDATKDAVAQAEKN------ETGAPMSLLDMPSIIGN 175

Query: 191 IQLYDXXXXXXXXXXXXTMANFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKV 250
             L D            + ANFGR+ LLK+LGERLVARLR+ VIKKT+HHD EF+DRNKV
Sbjct: 176 FTLVDVLAAFAGALLVGSAANFGRMFLLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKV 235

Query: 251 GDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVG 310
           GDL+SRLG+DAYIVSRSMT NISDG KA +CGGVG+GMMFHISSTL S + +FAPPLL+ 
Sbjct: 236 GDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIA 295

Query: 311 ATIYGNKIRAISRELQQASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVG 370
           ATIYG +IRAISRELQQ++GNLT+V+EEQ +GIKT++SFVAEGKE+ RYN AVR++FNV 
Sbjct: 296 ATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVA 355

Query: 371 KKEAFTNATFFSSTNVLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGL 430
           K+E  T+ATFFS TNVLGD SFLLVLAYGSHLVLQG L++G LTAFMLYTEYTGS+VFGL
Sbjct: 356 KREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGL 415

Query: 431 STFYSELMKGAGAATRLFELLDYKPTIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIF 490
           S FYSELMKGAGAA+RLFEL DYK ++ ST G+ F P +G++EF+ VSFSYPTR T+QIF
Sbjct: 416 SNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDGRIEFKDVSFSYPTRPTSQIF 475

Query: 491 KDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQL 550
           K L  TI PGSNVCIVGPSGRGKSTIASLLLR+Y+  SG IL+DGQDI+K+S+KSLR+ L
Sbjct: 476 KKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHL 535

Query: 551 GVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGA 610
           GVVQQEP+LMSGTIR+NITYG+S  PSM+EIR+VAKKCFCH FI+KFP+GY+T+IGPRGA
Sbjct: 536 GVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGA 595

Query: 611 LLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAH 670
           LLSGGQ+QRIAIARAL+ KPKILILDEATSALDVESEGAINYTLGRLM+SKE+TI+SIAH
Sbjct: 596 LLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAH 655

Query: 671 RLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLLTXXXXXXXXXXXXYAPPAI 730
           RLSTIRRSEN++VLG DGSV+E GKF DLY + DS L KLL              A PA 
Sbjct: 656 RLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNEHASEPAKPEASPA-PAQ 714

Query: 731 TQESEPQTEENGKDDSGEDQNSDHEENSQDQNEKRLQEEVIHQVLEDISH 780
            + S PQ  +  +D  G +               RL EEVI  VLED + 
Sbjct: 715 EEASAPQAADIPRDIEGGNL--------------RLNEEVIKHVLEDTAR 750

>Kpol_1045.83 s1045 (193070..195316) [2247 bp, 748 aa] {ON}
           (193072..195318) [2247 nt, 749 aa]
          Length = 748

 Score =  847 bits (2187), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/684 (60%), Positives = 515/684 (75%), Gaps = 42/684 (6%)

Query: 112 LADVKRLFYLARHDWKMLVLAVSLLTVSCTIGMAVPKVIGLVLDATKNALXXXXXXXXXX 171
           L+D+KRL  LA+ DWK+L+ A+SLL+VSC IGM++PK+IG+VLD  K  +          
Sbjct: 99  LSDLKRLARLAKRDWKLLLTAISLLSVSCLIGMSLPKIIGIVLDELKQIM---------- 148

Query: 172 XLEDSKSLTLDDLPPIVGDIQLYDXXXXXXXXXXXXTMANFGRVVLLKILGERLVARLRS 231
               +   T+DD+P I   + LY+            T AN+GRV+LL++L ER+VARLR+
Sbjct: 149 ---SNPDFTVDDVPEIAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRA 205

Query: 232 NVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGMMFH 291
           NVIKKTMH D EF+D NKVGDL+SRL +DAY+VSRS+TQ +SDGFKA++CG VGIGMM  
Sbjct: 206 NVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMIS 265

Query: 292 ISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEEQLSGIKTVQSFVA 351
           IS  L++ L    PP+++ A+ +G  IR  SR+LQ+A+G+LTKVAEEQ SGIKTVQSFVA
Sbjct: 266 ISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVA 325

Query: 352 EGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAYGSHLVLQGNLTIG 411
           E KE+ RYN+A+R +FNVGK+ AF NA FFS T VLGD SFL+VLAYGS+LVL G+L+IG
Sbjct: 326 EQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIG 385

Query: 412 DLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIKSTTGKAFKPLNGK 471
           DLTA+M+YTEYTGS++FGLSTFYSE+M+GAGAA+RLFEL D  P+I  T GK F P  G+
Sbjct: 386 DLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKFVPNKGE 445

Query: 472 VEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKI 531
           +EF++VSFSYPTR +NQIFK+L+F I+ GSNVCIVGPSGRGKSTIASLLLRYYNPT+G+I
Sbjct: 446 IEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQI 505

Query: 532 LVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCH 591
            VDGQDI+K+SSKSLRR + +VQQEP+LMSGTIR+NITYG+  +P+ +E+RS+ KKCFCH
Sbjct: 506 FVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCH 565

Query: 592 AFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAIN 651
            FI+KFPN Y+TI+GP G LLSGGQKQRIAIARAL+ KP ILILDEATSALDVESEGAIN
Sbjct: 566 NFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAIN 625

Query: 652 YTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLL 711
           YT G+LMKSK +TIISIAHRLSTIRRSENVIVLG DGSV E+GKFK+LYA+  S L KLL
Sbjct: 626 YTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLL 685

Query: 712 TXXXXXXXXXXXXYAPPAITQESEPQTEENGKDDSGEDQNSDHEENSQDQNE-------K 764
                                  E  T    + ++ EDQ  D EE    +N        +
Sbjct: 686 ----------------------HEKATRSERQQNTAEDQEIDPEETINIENSTPESDITQ 723

Query: 765 RLQEEVIHQVLEDISHDQKTSTLR 788
            L E  I + + D++ D K  T R
Sbjct: 724 ELLENPIKEAIMDVAADNKPITPR 747

>TDEL0G04660 Chr7 (850475..852694) [2220 bp, 739 aa] {ON} Anc_6.5
           YPL270W
          Length = 739

 Score =  837 bits (2162), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/650 (63%), Positives = 507/650 (78%), Gaps = 11/650 (1%)

Query: 111 GLADVKRLFYLARHDWKMLVLAVSLLTVSCTIGMAVPKVIGLVLDATKNALXXXXXXXXX 170
           GL DV RL  LA+ DWK+LV+A++LLTVSC IGM +PKVIG++LD  K  L         
Sbjct: 90  GLKDVVRLLMLAKPDWKLLVIAITLLTVSCGIGMTIPKVIGMILDVLKTGLETNEG---- 145

Query: 171 XXLEDSKSLTLDDLPPIVGDIQLYDXXXXXXXXXXXXTMANFGRVVLLKILGERLVARLR 230
                   +++ D+PPI     +Y+             +AN+GR+VLL+IL ER+VARLR
Sbjct: 146 ----KDGPISMADVPPIFMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERVVARLR 201

Query: 231 SNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGMMF 290
           +NVIKKT+H D EF+DR+KVGDL+SRLG+DAY+VSRSMTQ +SDGFKALICGGVG+GMM 
Sbjct: 202 ANVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGVGMMV 261

Query: 291 HISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEEQLSGIKTVQSFV 350
            IS  L+ +L LF PP+L  A+I+G KIR  S +LQ+A+G LT+V+EEQLSG++TVQSFV
Sbjct: 262 SISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFV 321

Query: 351 AEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAYGSHLVLQGNLTI 410
           AE KE+HRY++A+R +FNVGK+ A+ NA FF++T+ LGD SFL+VLAYGS+LVLQG LTI
Sbjct: 322 AEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTI 381

Query: 411 GDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIKSTTGKAFKPLNG 470
           GDLTAFMLYTEYTGS+VFGL++FYSELM+G GAATRLFEL D  P+IK TTGK F P  G
Sbjct: 382 GDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVPGKG 441

Query: 471 KVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGK 530
           ++ F+ V+FSYPTR  N IF+D++  I  GSNVC+VGPSGRGKSTIA LLLR+YNP+SG+
Sbjct: 442 EIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQ 501

Query: 531 ILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFC 590
           I +DGQDI+KL+ KSLRR +G+VQQEP+LMSGT+R+NITYG++  PS EEIR VAK+CFC
Sbjct: 502 IFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFC 561

Query: 591 HAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAI 650
           H FI KFP+GY+T+IGP+GALLSGGQKQRIAIARAL+ KP IL+LDEATSALDVESEGAI
Sbjct: 562 HNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAI 621

Query: 651 NYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
           NYT G+LMKSK +TI+SIAHRLSTIRRSEN+IVLG DGSVVE GKFK+L+A+  S L KL
Sbjct: 622 NYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFADPSSELSKL 681

Query: 711 LTXXXXXXXXXXXXYAPPAITQESEPQTEENGKDDSGEDQNSDHEENSQD 760
           L             Y+P A  Q   P+ E N K+   E  +   EE  +D
Sbjct: 682 LNEKSSRSENSSSSYSPNASEQ---PEDEANQKNAPEEAHDDSVEEILKD 728

>ZYRO0F00396g Chr6 complement(39330..41528) [2199 bp, 732 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 732

 Score =  836 bits (2160), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/689 (60%), Positives = 516/689 (74%), Gaps = 28/689 (4%)

Query: 24  PLLSITRRFDDRLSLPISSIRTLNYAVNRFGEMKGNQRFPSAGIRSFSITLRNRNEASDV 83
           P+  I R        P+S IR LN               P   + S  I +R  ++ S  
Sbjct: 7   PVPRILRPLSKSQLRPLSYIRPLNIVR------------PQISLISIRIGVRWNSQLS-- 52

Query: 84  GGNGKHQEGEDKTPDKKTNKPSSTVSGGLADVKRLFYLARHDWKMLVLAVSLLTVSCTIG 143
                 QE     P K+  +P         D  RLF LA+ DW++L  A++LLT+SC IG
Sbjct: 53  ----PSQEENRPKPVKQILEPIQKKESSYKDAVRLFSLAKRDWRLLCAAIALLTISCVIG 108

Query: 144 MAVPKVIGLVLDATKNALXXXXXXXXXXXLEDSKSLTLDDLPPIVGDIQLYDXXXXXXXX 203
           M++PKVIGLVLD  +  +            +D +++ +DDL PI   + +Y         
Sbjct: 109 MSIPKVIGLVLDVLRKGIEG----------KDLQNVNMDDLGPIAFGLTIYQFLGVFAGL 158

Query: 204 XXXXTMANFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYI 263
               T ANF R+V+L+IL ER+VARLRS V+ KT+H D EFYD +KVGDL+SRLG+DAY+
Sbjct: 159 LLVGTAANFARIVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYV 218

Query: 264 VSRSMTQNISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISR 323
           VSRSMTQ +SDGFKALICGGVGIGMM  IS  L+ VL  FAPP+L  A+++G KIR  S+
Sbjct: 219 VSRSMTQKVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSK 278

Query: 324 ELQQASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSS 383
           +LQ+A+G LT+VAEEQLSG+KTVQSFVAE +E+HRYN A+R ++NVG+K AF NA FF+S
Sbjct: 279 DLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTS 338

Query: 384 TNVLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGA 443
           T +LGD SF++VL YGS+LVLQG+LTIGDLTAFMLYTEYTGS+VFGL+TFYSELM+G GA
Sbjct: 339 TTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGA 398

Query: 444 ATRLFELLDYKPTIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNV 503
           A+RLF+L D+  +I  T G+ + P  G +EF++VSFSYPTR  NQIFKD+N  + PGSNV
Sbjct: 399 ASRLFDLTDHISSISPTKGQKYIPGKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNV 458

Query: 504 CIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGT 563
           CIVGPSGRGKSTIA LLLRYYNPT+G+ILVDGQDI+K++ K+LRR +G+VQQEPILMSGT
Sbjct: 459 CIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGT 518

Query: 564 IRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIA 623
           IR+NITYG++   + EEIRSVAK+CFCH FI+KFP+GY+T+IG +GALLSGGQ+QRIAIA
Sbjct: 519 IRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIA 578

Query: 624 RALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIV 683
           RAL+ KP IL+LDEATSALDVESEGAINYT G+LMKS  +TI+SIAHRLSTI+RSENVIV
Sbjct: 579 RALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIV 638

Query: 684 LGIDGSVVEMGKFKDLYANHDSALHKLLT 712
           LG DGSV+E GKFK+L+AN +S L KLLT
Sbjct: 639 LGKDGSVIEAGKFKELFANPNSELCKLLT 667

>CAGL0A01133g Chr1 (112037..114442) [2406 bp, 801 aa] {ON} similar
           to uniprot|P33311 Saccharomyces cerevisiae YPL270w MDL2
          Length = 801

 Score =  832 bits (2149), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/693 (59%), Positives = 519/693 (74%), Gaps = 27/693 (3%)

Query: 39  PISSIRTLNYAVNRFGEMKGNQRFPSAGIRSFSITLRNRNEASDVGGNGKHQEGEDKTPD 98
           P ++ R LN   N +    GN     A ++S S T + +NE  D   + K +E + +T +
Sbjct: 63  PFTAHRALN---NEYNTTAGN-----ASVKSQSAT-KEKNE-EDRKYSKKEKEEQSETKE 112

Query: 99  KKTNKPSSTVSGGLADVKRLFYLARHDWKMLVLAVSLLTVSCTIGMAVPKVIGLVLDATK 158
             +            D+ RL  L R DWK+L+ AV LLT+SC+IGM +PKVIGL+LD  K
Sbjct: 113 NHSE---------FRDIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLK 163

Query: 159 NALXXXXXXXXXXXLEDSKSLTLDDLPPIVGDIQLYDXXXXXXXXXXXXTMANFGRVVLL 218
           NAL             D + +++D LPPIV  +  Y+              AN+GR++LL
Sbjct: 164 NALAANSV--------DGQPVSIDKLPPIVFGLSFYEFLGGFALALLVGIAANYGRIILL 215

Query: 219 KILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKA 278
           ++L ERLVARLR+ VIKKT+H D EF+D +KVGDL+SRLG+DAY+VSRSMTQ +SDGFKA
Sbjct: 216 RVLSERLVARLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKA 275

Query: 279 LICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEE 338
           LICG VGIGMM  +S  L+ +L +F PP+++ A+++G +I   SRELQ+A+G+LTKVAEE
Sbjct: 276 LICGSVGIGMMLALSPQLSCLLLVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEE 335

Query: 339 QLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAY 398
           QLSGIKTVQSFVAE +E++RYN A+R +FN+GKK A  NA FFSST+ +GD SFL VL +
Sbjct: 336 QLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGF 395

Query: 399 GSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIK 458
           GS+LVLQ +LTIGDLTAFM+YTEYTG+++FGLSTFYSE+M+GAGAA+RLFEL D  P+I 
Sbjct: 396 GSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSIS 455

Query: 459 STTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIAS 518
           +T G  +KP NG++EF++VSF+YPTR +N IFK+LNF IE GSNVCIVGPSGRGKST+A 
Sbjct: 456 TTKGVKYKPGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVAL 515

Query: 519 LLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSM 578
           LL +YY P+SG+IL+DGQ+I  L+SKSLRR +G+VQQEPILMSGTIR+NI YG++  P+ 
Sbjct: 516 LLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTK 575

Query: 579 EEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEA 638
           +EIR VAK+CFCH FI++F + Y+T+IGP G LLSGGQKQRIAIARAL+ KP+ILILDEA
Sbjct: 576 DEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEA 635

Query: 639 TSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKD 698
           TSALDVESEGAINYT G+LMK KE+TI+SIAHRLSTIRRSENVIVLG DGSVVEMGKFK+
Sbjct: 636 TSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKE 695

Query: 699 LYANHDSALHKLLTXXXXXXXXXXXXYAPPAIT 731
           L+ +  S L +LL               PP  T
Sbjct: 696 LWDDPTSELSQLLNEKSTPHQTTNITVTPPPTT 728

>Suva_16.35 Chr16 (46072..48375) [2304 bp, 767 aa] {ON} YPL270W
           (REAL)
          Length = 767

 Score =  822 bits (2124), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/708 (59%), Positives = 520/708 (73%), Gaps = 44/708 (6%)

Query: 99  KKTNKPS-STVSGGLADVKRLFYLARHDWKMLVLAVSLLTVSCTIGMAVPKVIGLVLDAT 157
           K+  KP+  + S    D+ RLF LA+ DWK+L+ A+ LLT+SC+IGM++PKVIG+VLD  
Sbjct: 85  KQPAKPAYQSKSDDYKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLDT- 143

Query: 158 KNALXXXXXXXXXXXLEDSKSLTLDDLPPIVGDIQLYDXXXXXXXXXXXXTMANFGRVVL 217
                          L+ S      DL   +  + LY+             +ANFGR +L
Sbjct: 144 ---------------LKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLIGCVANFGRFIL 188

Query: 218 LKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFK 277
           L+IL ER+VARLR++VIKKT+H D EF+D +KVGDL+SRLG+DAY+VSRSMTQ +SDG K
Sbjct: 189 LRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVK 248

Query: 278 ALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAE 337
           ALICG VG+GMM  +S  L+ +L  F PP+L  A+++G +IR  S++LQ+A+G LT+VAE
Sbjct: 249 ALICGVVGVGMMCSLSPQLSVLLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAE 308

Query: 338 EQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLA 397
           EQLSGIKTVQSFVAEG E+ RYN A+R +F VGK  AFTNA FF++T++LGD SFL VLA
Sbjct: 309 EQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLA 368

Query: 398 YGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTI 457
           YGS+LVLQ  L+IGDLTAFMLYTEYTG+AVFGLSTFYSE+M+GAGAA+RLFEL D KP+I
Sbjct: 369 YGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSI 428

Query: 458 KSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIA 517
             T G  +KP  G +EF+ VSFSYPTR + QIFK LNF I PGS+VCIVGPSGRGKSTIA
Sbjct: 429 SPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIA 488

Query: 518 SLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPS 577
            LLLRYYNPT+G I++D QDITK++ KSLRR +G+VQQEP+LMSGTIR+NITYG++  P+
Sbjct: 489 LLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPT 548

Query: 578 MEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDE 637
            EEIRSVAK+CFCH FI+KFPN Y+T+IGP G LLSGGQKQRIAIARAL+ KP +LILDE
Sbjct: 549 KEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDE 608

Query: 638 ATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFK 697
           ATSALDVESEGAINYT G+LMKSK +TI+SIAHRLSTIRRSENVIVLG DGSVVEMGKFK
Sbjct: 609 ATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFK 668

Query: 698 DLYANHDSALHKLLTXXXXXXXXXXXXYAPPAITQESEPQTEENGKDDSGEDQNSDHE-- 755
           +LY+N  SAL +LL                P  +++ +   ++N K++  ED+N D    
Sbjct: 669 ELYSNPTSALSQLLNERTA-----------PVPSEQQQQVEKDNEKEEPNEDENHDQRNE 717

Query: 756 -----ENSQDQNEKRLQ---------EEVIHQVLEDISHDQKTSTLRP 789
                 +  D N K L+         EE +  VL+D + +     L P
Sbjct: 718 GDDGSNHDNDSNNKPLESKDKKSDDIEESVEHVLKDAAKEANPIKLSP 765

>TPHA0J00220 Chr10 complement(51873..54095) [2223 bp, 740 aa] {ON}
           Anc_6.5 YPL270W
          Length = 740

 Score =  820 bits (2117), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/681 (61%), Positives = 508/681 (74%), Gaps = 24/681 (3%)

Query: 95  KTPDKKTNKPSSTVSGGLADVKRLFYLARHDWKMLVLAVSLLTVSCTIGMAVPKVIGLVL 154
           KT   +   P S   G   D+KRL  LA+ DWK+L +AV LLTVSCTIGM++PKVIG+VL
Sbjct: 59  KTTAPQVRVPKSRNDGN--DIKRLLSLAKKDWKLLCIAVGLLTVSCTIGMSLPKVIGMVL 116

Query: 155 DATKNALXXXXXXXXXXXLEDSK------SLTLDDLPPIVGDIQLYDXXXXXXXXXXXXT 208
           D  KNA+            ED++      S+   +LPPI   + LY+            T
Sbjct: 117 DLLKNAISKS---------EDAELGSADLSIESSELPPIAFGLSLYEFLGCIGAALLIGT 167

Query: 209 MANFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSM 268
            ANFGRVVLL++L ER+VARLRS VIKKT+H D EF+D NKVGDL+SRLG+DAY+VSRSM
Sbjct: 168 AANFGRVVLLRVLSERVVARLRSQVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSM 227

Query: 269 TQNISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQA 328
           TQ +SDGFKAL+CGGVG+GMM  IS  L++ L  F PP+++ +  +G  IR  SR+LQ+A
Sbjct: 228 TQKVSDGFKALLCGGVGVGMMVSISPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEA 287

Query: 329 SGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLG 388
           +G LT+V+EEQ SG+KTVQ+FVAE +E+ RYNN ++ V+NVGK+ AF NA  F+ T+ LG
Sbjct: 288 TGQLTRVSEEQFSGVKTVQAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLG 347

Query: 389 DFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLF 448
           D SFLLVLAYGS+LVL G L+IGDLTA+M+YTE TGSAVFGLS+FYSE+M+G GAA+RLF
Sbjct: 348 DMSFLLVLAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLF 407

Query: 449 ELLDYKPTIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGP 508
           EL D  P I  TTGK + P  G++EF++VSF+YPTR  +QIFK LNF IEPGSNVCIVGP
Sbjct: 408 ELTDRIPMISPTTGKKYIPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGP 467

Query: 509 SGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENI 568
           SGRGKSTIASLLL+YY PT+G I VDGQDI+KL+SKSLRR +G+VQQEPILMSG+IR+NI
Sbjct: 468 SGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNI 527

Query: 569 TYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLN 628
           TYG++ + + EEIR V K+CFCH FI+KFP+ Y+TI+GP G LLSGGQKQRIAIARALL 
Sbjct: 528 TYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLK 587

Query: 629 KPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDG 688
           KP +LILDEATSALDVESE AINYT G+LMK KE+TIISIAHRLSTIRRSE VIVLG DG
Sbjct: 588 KPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDG 647

Query: 689 SVVEMGKFKDLYANHDSALHKLLTXXXXXXXXXXXXYAPPAITQESEPQTEENGKDDSGE 748
           SVVE+GKFK L+ N  S L +LL                PA T E E Q  +N  ++S  
Sbjct: 648 SVVEIGKFKTLFGNPLSELSQLLNEKSTINERNPN--EKPAETPEQESQ--KNAANESIV 703

Query: 749 DQNSDHEENSQDQNEKRLQEE 769
           D   + E     QN+ R Q+E
Sbjct: 704 DVVLEEE---ILQNDIRSQDE 721

>Smik_6.478 Chr6 complement(788399..790720) [2322 bp, 773 aa] {ON}
           YPL270W (REAL)
          Length = 773

 Score =  815 bits (2105), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/697 (59%), Positives = 514/697 (73%), Gaps = 50/697 (7%)

Query: 114 DVKRLFYLARHDWKMLVLAVSLLTVSCTIGMAVPKVIGLVLDATKNALXXXXXXXXXXXL 173
           D+ RLF LA+ DWK+L+ A+ LLT+SC+IGM++PKVIG+VLD                 L
Sbjct: 104 DIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLDT----------------L 147

Query: 174 EDSKSLTLDDLPPIVGDIQLYDXXXXXXXXXXXXTMANFGRVVLLKILGERLVARLRSNV 233
           + S      DL   +  + LY+              ANFGR +LL+IL ER+VARLR++V
Sbjct: 148 KTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHV 207

Query: 234 IKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGMMFHIS 293
           IKKT+H D EF+D +KVGDL+SRLG+DAY+VSRSMTQ +SDG KALICG VG+GMM  +S
Sbjct: 208 IKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLS 267

Query: 294 STLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEEQLSGIKTVQSFVAEG 353
             L+ +L  F PP+L  A+++G +IR  S++LQ+A+G LT+VAEEQLSGIKTVQSFVAEG
Sbjct: 268 PQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEG 327

Query: 354 KEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAYGSHLVLQGNLTIGDL 413
            E+ RYN A+R +F VGK  AFTNA FF++T++LGD SFL VLAYGS+LVLQ  L+IGDL
Sbjct: 328 NELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQSQLSIGDL 387

Query: 414 TAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIKSTTGKAFKPLNGKVE 473
           TAFMLYTEYTG+AVFGLSTFYSE+M+GAGAA+RLFEL D KP+I  T G  ++P  G +E
Sbjct: 388 TAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPERGVIE 447

Query: 474 FQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILV 533
           F+ VSFSYPTR + QIFK LNF I PGS+VCIVGPSGRGKSTIA LLLRYYNPT+G I++
Sbjct: 448 FKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMI 507

Query: 534 DGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAF 593
           D QDITKL+ KSLRRQ+G+VQQEP+LMSGTIR+NITYG++  P+ EEIRSVAK+CFCH F
Sbjct: 508 DNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF 567

Query: 594 ISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYT 653
           I+KFPN Y+T+IGP G LLSGGQKQRIAIARAL+ KP ILILDEATSALDVESEGAINYT
Sbjct: 568 ITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYT 627

Query: 654 LGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLLTX 713
            G+LMKSK +TI+SIAHRLSTIRRSENVIVLG DGSVVEMGKFK+LYAN  SAL +LL  
Sbjct: 628 FGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNE 687

Query: 714 XXXXXXXXXXXYAP-PAITQESEPQTEENGKDDSGEDQNSDHEENS-------------- 758
                       AP P+  Q    + EE  K+D+ E +  D +                 
Sbjct: 688 RA----------APGPSDQQLQIEKVEE--KEDTNEGEKHDQQNKQDDDNSHNNHDNDSN 735

Query: 759 ------QDQNEKRLQEEVIHQVLEDISHDQKTSTLRP 789
                 +D+N + ++E V H +L+D + +     L P
Sbjct: 736 NQSLEVKDKNSENIEESVEH-LLKDAAKEANPIKLTP 771

>YPL270W Chr16 (30482..32803) [2322 bp, 773 aa] {ON}
           MDL2Mitochondrial inner membrane half-type ATP-binding
           cassette (ABC) transporter, required for respiratory
           growth at high temperature; similar to human TAP1 and
           TAP2 implicated in bare lymphocyte syndrome and
           Wegener-like granulomatosis
          Length = 773

 Score =  812 bits (2097), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/623 (64%), Positives = 486/623 (78%), Gaps = 29/623 (4%)

Query: 89  HQEGEDKTPDKKTNKPSSTVSGGLADVKRLFYLARHDWKMLVLAVSLLTVSCTIGMAVPK 148
           H + + KT D K             D+ RLF LA+ DWK+L+ A+ LLT+SC+IGM++PK
Sbjct: 92  HAKEQSKTDDYK-------------DIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPK 138

Query: 149 VIGLVLDATKNALXXXXXXXXXXXLEDSKSLTLDDLPPIVGDIQLYDXXXXXXXXXXXXT 208
           VIG+VLD                 L+ S      DL   +  + LY+             
Sbjct: 139 VIGIVLDT----------------LKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLIGC 182

Query: 209 MANFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSM 268
            ANFGR +LL+IL ER+VARLR+NVIKKT+H D EF+D +KVGDL+SRLG+DAY+VSRSM
Sbjct: 183 AANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSM 242

Query: 269 TQNISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQA 328
           TQ +SDG KALICG VG+GMM  +S  L+ +L  F PP+L  A+++G +IR  S++LQ+A
Sbjct: 243 TQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEA 302

Query: 329 SGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLG 388
           +G LT+VAEEQLSGIKTVQSFVAEG E+ RYN A+R +F VGK  AFTNA FF++T++LG
Sbjct: 303 TGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLG 362

Query: 389 DFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLF 448
           D SFL VLAYGS+LVLQ  L+IGDLTAFMLYTEYTG+AVFGLSTFYSE+M+GAGAA+RLF
Sbjct: 363 DLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLF 422

Query: 449 ELLDYKPTIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGP 508
           EL D KP+I  T G  +KP  G +EF+ VSFSYPTR + QIFK+LNF I PGS+VCIVGP
Sbjct: 423 ELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGP 482

Query: 509 SGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENI 568
           SGRGKSTIA LLLRYYNPT+G I +D QDI+KL+ KSLRR +G+VQQEP+LMSGTIR+NI
Sbjct: 483 SGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNI 542

Query: 569 TYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLN 628
           TYG++  P+ EEIRSVAK+CFCH FI+KFPN Y+T+IGP G LLSGGQKQRIAIARAL+ 
Sbjct: 543 TYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIK 602

Query: 629 KPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDG 688
           KP ILILDEATSALDVESEGAINYT G+LMKSK +TI+SIAHRLSTIRRSENVIVLG DG
Sbjct: 603 KPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDG 662

Query: 689 SVVEMGKFKDLYANHDSALHKLL 711
           SVVEMGKFK+LYAN  SAL +LL
Sbjct: 663 SVVEMGKFKELYANPTSALSQLL 685

>NDAI0I02730 Chr9 complement(640429..642927) [2499 bp, 832 aa] {ON}
           Anc_6.5
          Length = 832

 Score =  813 bits (2101), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/598 (65%), Positives = 487/598 (81%), Gaps = 13/598 (2%)

Query: 114 DVKRLFYLARHDWKMLVLAVSLLTVSCTIGMAVPKVIGLVLDATKNALXXXXXXXXXXXL 173
           DV RLF L + D+K+L+++++LLT+SCTIGM +PK+IGL+LDA K+              
Sbjct: 162 DVFRLFLLVKKDYKLLIVSLTLLTISCTIGMMIPKIIGLILDALKSV----------ATT 211

Query: 174 EDSKSLTLDDLPPIVGDIQLYDXXXXXXXXXXXXTMANFGRVVLLKILGERLVARLRSNV 233
            D  S      P I+  + LY+              AN+GR++LL+IL ERLVARLRS V
Sbjct: 212 PDGGS---SPPPTIMFGLTLYEFLGGFSVALFIGCAANYGRLILLRILSERLVARLRSVV 268

Query: 234 IKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGMMFHIS 293
           +K T+H D EF+D +KVGDL+SRLGAD+YIVSRS+TQ ISDG K+LICGGVGIGMM  +S
Sbjct: 269 MKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELS 328

Query: 294 STLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEEQLSGIKTVQSFVAEG 353
             L+SVL  F  P+++ A+I+G +IR  SRELQ A+G LT+V+EEQL+G++TVQSFVAE 
Sbjct: 329 MDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQ 388

Query: 354 KEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAYGSHLVLQGNLTIGDL 413
           +E+ R+N+++R++F+VGK+ AF NA FF+ST+++GD SFL VL YGS+LVL G+LTIGDL
Sbjct: 389 REIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDL 448

Query: 414 TAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIKSTTGKAFKPLNGKVE 473
           TAFMLYTEYTG+A+FGLSTFYSE+M+GAGAA+RLFEL D  PTI+ T GK + P  G++E
Sbjct: 449 TAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYTPGKGEIE 508

Query: 474 FQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILV 533
           F++VSF+YPTR +NQIFK LNF I+PGSNVCIVGPSG+GKSTIA LLL YYNPTSG+IL+
Sbjct: 509 FKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILI 568

Query: 534 DGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAF 593
           DGQDITKL+SKSLRRQ+ VVQQEP+LMSGTIR+NITYG++ +P+ EEIR+VAK+CFCH F
Sbjct: 569 DGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNF 628

Query: 594 ISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYT 653
           I KFP  Y+T IGP G LLSGGQKQRIAIARAL+ KP ILILDEATSALDVESEGAINYT
Sbjct: 629 IVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYT 688

Query: 654 LGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLL 711
            G+LMKSK +TI+SIAHRLSTIRRSEN+IVLG DGSVVEMGKFK+L+A+  S L KLL
Sbjct: 689 FGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFADPTSELSKLL 746

>Skud_16.7 Chr16 (9624..11945) [2322 bp, 773 aa] {ON} YPL270W (REAL)
          Length = 773

 Score =  808 bits (2088), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/652 (62%), Positives = 496/652 (76%), Gaps = 27/652 (4%)

Query: 99  KKTNKPSSTVSGGLADVKRLFYLARHDWKMLVLAVSLLTVSCTIGMAVPKVIGLVLDATK 158
           K    P  + +    D+ RLF LA+ DWK+L+ A+ LLT+SC+IGM++PKVIG+VLD   
Sbjct: 89  KPARPPQRSKTDDYKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLDT-- 146

Query: 159 NALXXXXXXXXXXXLEDSKSLTLDDLPPIVGDIQLYDXXXXXXXXXXXXTMANFGRVVLL 218
                         L+ S      +L   +  + LY+              ANFGR +LL
Sbjct: 147 --------------LKTSSGSDFFELKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILL 192

Query: 219 KILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKA 278
           +IL ER+VARLR++VIKKT+H D EF+D +KVGDL+SRLG+DAY+VSRSMTQ +SDG KA
Sbjct: 193 RILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKA 252

Query: 279 LICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEE 338
           LICG VG+GMM  +S  L+ +L  F PP+L  A+++G +IR  S++LQ+A+G LT+VAEE
Sbjct: 253 LICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEE 312

Query: 339 QLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAY 398
           QLSGIKTVQSFVAEG E+ RYN A+R +F VGK  AFTNA FF++T++LGD SFL VLAY
Sbjct: 313 QLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAY 372

Query: 399 GSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIK 458
           GS+LVLQ  L+IGDLTAFMLYTEYTG+AVFGLSTFYSE+M+GAGAA+RLFEL D KP+I 
Sbjct: 373 GSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSIS 432

Query: 459 STTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIAS 518
            T G  +KP  G VEF+ VSFSYPTR + QIFK+LNF I PGS+VCIVGPSGRGKSTIA 
Sbjct: 433 PTAGHKYKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIAL 492

Query: 519 LLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSM 578
           LLLRYYNP++G I++D QDITK++ KSLRR +G+VQQEP+LMSGTIR+NITYG++  P+ 
Sbjct: 493 LLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTK 552

Query: 579 EEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEA 638
           EEIRSVAK+CFCH FI+KFPN Y+T+IG RG LLSGGQKQRIAIARAL+ KP ILILDEA
Sbjct: 553 EEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEA 612

Query: 639 TSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKD 698
           TSALDVESEGAINYT G LMKSK +TIISIAHRLSTIRRSENVIVLG DGSVVEMGKFK 
Sbjct: 613 TSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKK 672

Query: 699 LYANHDSALHKLLTXXXXXXXXXXXXYAPPAITQESEPQTEENGKDDSGEDQ 750
           LYAN  SAL +LL              A P  + + +   ++N  ++S E++
Sbjct: 673 LYANPTSALSQLLNER-----------AAPGPSDQQQQIEKDNENEESTEEK 713

>NCAS0D02210 Chr4 (410709..413030) [2322 bp, 773 aa] {ON} Anc_6.5
          Length = 773

 Score =  805 bits (2078), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/704 (57%), Positives = 524/704 (74%), Gaps = 50/704 (7%)

Query: 90  QEGEDKTPDKKTNKPSST--VSGGLADVKRLFYLARHDWKMLVLAVSLLTVSCTIGMAVP 147
           Q  ++K P  + N  S++       +DV RLF L + DWK+L++A++LLT+SC IGM +P
Sbjct: 100 QSKDNKQPSLQGNPLSTSEEPKSNFSDVIRLFLLVKTDWKLLLVALTLLTISCVIGMMIP 159

Query: 148 KVIGLVLDATKNALXXXXXXXXXXXLEDSKSLTLDDLPP--IVGDIQLYDXXXXXXXXXX 205
           KVIG++LD+ K              ++ +     ++ PP  ++  + +Y+          
Sbjct: 160 KVIGIILDSLK--------------VQTATQSEGEEAPPPIMMFGLTIYEFLGGFSIALL 205

Query: 206 XXTMANFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVS 265
              MANFGR++LL+IL ERLVARLRS VIK+T+H D +FYD +K GDL+SRLGADAYIVS
Sbjct: 206 AGCMANFGRLILLRILSERLVARLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVS 265

Query: 266 RSMTQNISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISREL 325
           RS+TQ ISDGFK+LICGGVG+GMM  +S  L++VL +   P+++ A+I+G +IR  SREL
Sbjct: 266 RSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSREL 325

Query: 326 QQASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTN 385
           Q A+G LT+V+EEQL+G+KTVQSFVAE +E+ R+N A+R +F+VGK+ AF NA FF+ST+
Sbjct: 326 QDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTS 385

Query: 386 VLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAAT 445
           ++GD SFL VL YGS+LVL G+LTIGDLTAFMLYTEYTG+++FGLSTFYSE+M+GAGAA+
Sbjct: 386 LVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAAS 445

Query: 446 RLFELLDYKPTIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCI 505
           RLFEL DY P I+ T GK + P  G++EF++VSFSYPTR  NQIFK+LNF IEPGSNVCI
Sbjct: 446 RLFELTDYVPEIRPTLGKTYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCI 505

Query: 506 VGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIR 565
           VGPSG+GKSTIA LLL YYNPTSG+IL+DGQDITK++SKSLRR+LG+VQQEP+LMSG+IR
Sbjct: 506 VGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIR 565

Query: 566 ENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARA 625
           +NITYG++  P+ EEIR VAK+CFCH FI+KFP+ Y+T IGP G LLSGGQKQRIAIARA
Sbjct: 566 DNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARA 625

Query: 626 LLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLG 685
           L+ KP ILILDEATSALDVESEGAINYT G+LMK+K +TI+SIAHRLSTIRRSENVIVLG
Sbjct: 626 LIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLG 685

Query: 686 IDGSVVEMGKFKDLYANHDSALHKLLTXXXXXXXXXXXXYAPPAITQESEPQTEENGKDD 745
            DGSV+EMGKFK+L+++  S L KLL                           E++ +  
Sbjct: 686 NDGSVIEMGKFKELFSDPSSELSKLL--------------------------NEKSSRKK 719

Query: 746 SGEDQNSDHEENSQDQNEKRLQ------EEVIHQVLEDISHDQK 783
           +  D  S   E   D   + ++      E+ +H VL D++ + K
Sbjct: 720 TKSDPISSAPEVDADATGEPVEPIDPAIEDALHSVLNDVTSESK 763

>TBLA0A07190 Chr1 complement(1792994..1795378) [2385 bp, 794 aa]
           {ON} Anc_6.5 YPL270W
          Length = 794

 Score =  801 bits (2070), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/684 (58%), Positives = 510/684 (74%), Gaps = 38/684 (5%)

Query: 111 GLADVKRLFYLARHDWKMLVLAVSLLTVSCTIGMAVPKVIGLVLDATKNALXXXXXXXXX 170
           G +++ RL  +   DWK+L+LA++LLT+SC+IGMA+PKVIGLVLDA KN +         
Sbjct: 144 GRSELARLVLMTLRDWKLLLLAITLLTISCSIGMAIPKVIGLVLDALKNVMT-------- 195

Query: 171 XXLEDSKSLTLDDLPPIVGDIQLYDXXXXXXXXXXXXTMANFGRVVLLKILGERLVARLR 230
              +   SL   DLPPI   + LY             TM N+GR +LL++L ER+VARLR
Sbjct: 196 ---DSPSSLETSDLPPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLR 252

Query: 231 SNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGMMF 290
           S+VIKKT+H D EF+D+NKVGDL+SRLG+DAY+VSRS+TQ +SDGFKA++CGG GIGMM 
Sbjct: 253 SHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCGGAGIGMMI 312

Query: 291 HISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEEQLSGIKTVQSFV 350
            IS  L+S L +FAP +++ A+I+G KIR IS  LQ+A+G LT+V+EEQL+G+KTVQSFV
Sbjct: 313 SISPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFV 372

Query: 351 AEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAYGSHLVLQGNLTI 410
           AE KE+ RYNNA+R ++N+GK  A  N+ F +ST+V+GD SFL+VLAYGS+LVL G+LTI
Sbjct: 373 AEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTI 432

Query: 411 GDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIKSTTGKAFKPLNG 470
           GDLTAFMLYT+YT +++FGLS FYSE+M+G GAA RLF+L D  P I+ T G+ F P +G
Sbjct: 433 GDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKFIPGDG 492

Query: 471 KVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGK 530
            +EF+++ F+YPTR  NQ+FK+LNF IEPG++VCIVGPSGRGKSTIA LLLRYYNP+SG+
Sbjct: 493 CIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQ 552

Query: 531 ILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFC 590
           IL+D QDI KL+ KSLR+ +G+VQQEP+LMSG+IR+NITYG+ R+ + +EIR V+K+CFC
Sbjct: 553 ILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFC 612

Query: 591 HAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAI 650
           H FI+KFP+ YETIIGP G LLSGGQKQRIAIARAL+ KPKILILDEATSALDVESEGAI
Sbjct: 613 HNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAI 672

Query: 651 NYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
           NYT G+LMKSK +TI+SIAHRLSTIRRSE +IVLG DGSVVE GKFK+LYA+  S L KL
Sbjct: 673 NYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKL 732

Query: 711 LTXXXXXXXXXXXXYAPPAITQESEPQTEENGKD-----DSGEDQNSDHEENSQDQNEKR 765
           L                      +E Q+  N K+      S  +   D E N    +   
Sbjct: 733 L----------------------NEKQSRANKKEAPLPPQSDGENGDDFEGNGTPASPPS 770

Query: 766 LQEEVIHQVLEDISHDQKTSTLRP 789
           L   ++  VL+++S D     + P
Sbjct: 771 LHNNLVTDVLKEVSDDSSPLKIAP 794

>KNAG0E02800 Chr5 (562361..564586) [2226 bp, 741 aa] {ON} Anc_6.5
           YPL270W
          Length = 741

 Score =  759 bits (1960), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/698 (55%), Positives = 497/698 (71%), Gaps = 36/698 (5%)

Query: 94  DKTPDKKTNKPSSTV------SGGLADVKRLFYLARHDWKMLVLAVSLLTVSCTIGMAVP 147
           D TP +   +P+  V       G   D+ RLF L + DWK+L+ A++LLTVSC IGM +P
Sbjct: 64  DVTPKEPEKQPAVVVHPKPEDEGTYKDIWRLFLLVKSDWKLLMSALTLLTVSCGIGMCIP 123

Query: 148 KVIGLVLDATKNALXXXXXXXXXXXLEDSKSLTLDDLPPIVGDIQLYDXXXXXXXXXXXX 207
           KVIG VLD+                L+D +     +L  ++ D+ L              
Sbjct: 124 KVIGTVLDS----------------LKDIQGKEFSEL--MIWDMSLKHFFYGLSGLLLLG 165

Query: 208 TMANFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRS 267
             AN+ RV+LL+IL E LVA+LR+NVIK  +H D +F+D  KVGDL+SR+G DA+IVSRS
Sbjct: 166 CGANYVRVILLRILSENLVAKLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRS 225

Query: 268 MTQNISDGFKALICGGVGIGMMFHISSTLA-SVLFLFAPPLLVGATIYGNKIRAISRELQ 326
           +TQ ISDG KA+  G  G+GMM  IS  L+ S+L L   PLL+ A ++G +IR  S++LQ
Sbjct: 226 ITQKISDGVKAVFIGSAGVGMMLSISIPLSCSILILMGSPLLLSAKVFGKQIRDNSKKLQ 285

Query: 327 QASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNV 386
           + + NLT+V+EEQ +GIKT+QSFVAE  E+H++N ++R++F VGK+ AF NA FF++ ++
Sbjct: 286 EVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASI 345

Query: 387 LGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATR 446
           +GD SFL+VL+YGS LV Q  L++GDLTAFMLYTEYTG+A+F LS F+SE+M+GAGAA+R
Sbjct: 346 IGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASR 405

Query: 447 LFELLDYKPTIKSTTGKAFKPLNG-KVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCI 505
           +FEL D KP I  T G  F P  G ++EF++VSF+YPTR T  IF++LNF IE GSNVCI
Sbjct: 406 IFELTDLKPRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCI 465

Query: 506 VGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIR 565
           VGPSG+GKSTIA LLL YYNP+ G+IL+DGQDI+ LS+KSLRR +G+VQQEPILMSGTIR
Sbjct: 466 VGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIR 525

Query: 566 ENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARA 625
           +NITYG++  P+ EEIRSVAK+CFCH FI++FP+ Y+T IGP G LLSGGQKQRIAIARA
Sbjct: 526 DNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARA 585

Query: 626 LLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLG 685
           L+ KP +LILDEATSALDVESEGAINYT G+LMKSK +TI+SIAHRLSTIRRSENVIVLG
Sbjct: 586 LIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLG 645

Query: 686 IDGSVVEMGKFKDLYANHDSALHKLLTXXXXXXXXXXXXYAPPAITQESEPQTEENGKDD 745
            DGSVVE GKFK+L+AN  S L KLL              A P I  +   QT E     
Sbjct: 646 NDGSVVEQGKFKELFANPASELSKLLREKSSGNN------AAPEIQPQEISQTIEEDPSF 699

Query: 746 SGEDQNSDHEENSQDQNEKRLQEEVIHQVLEDISHDQK 783
           SGE   +      + + E     E I++VL+DIS + K
Sbjct: 700 SGEATPASSVTGFKAETEA----ETINEVLKDISTEGK 733

>KAFR0B06480 Chr2 complement(1344413..1346668) [2256 bp, 751 aa]
           {ON} Anc_6.5 YPL270W
          Length = 751

 Score =  721 bits (1860), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/689 (55%), Positives = 489/689 (70%), Gaps = 35/689 (5%)

Query: 100 KTNKPSSTVSGG-LADVKRLFYLARHDWKMLVLAVSLLTVSCTIGMAVPKVIGLVLDATK 158
           +T K +ST +G    D+KRL  L + D K+LVLA+ LLT+SC+IGMA+PK+IG +LD  +
Sbjct: 70  RTLKTASTDNGSSWRDLKRLTVLIKKDIKLLVLAIVLLTISCSIGMAIPKIIGTILDTLR 129

Query: 159 NALXXXXXXXXXXXLEDSKSLTLDDLPPIVGDIQLYDXXXXXXXXXXXXTMANFGRVVLL 218
           N              E+  SL+       + +I L                ANFGRVV+L
Sbjct: 130 N------------NYENLTSLSQIK----ILNIPLSTFLMGVGITLIFGCFANFGRVVIL 173

Query: 219 KILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKA 278
           +I+ ERLV+RLRS V+K  +H D+EF+D  KVGDL+SR+G DA++VSRS+T  ++DG ++
Sbjct: 174 RIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRS 233

Query: 279 LICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEE 338
              G  GIG+M  +S  L   LF   PP++   +++G +IR  S++LQ  +G+LT+V EE
Sbjct: 234 GFIGIFGIGLMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEE 293

Query: 339 QLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAY 398
           Q +GI+TVQ FVAE  E+ R+NN +R++F VGK+ AF N  FF+S +++GD  FL+VL Y
Sbjct: 294 QFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTY 353

Query: 399 GSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIK 458
           GS+LV+ G+++IGDLTAFMLYTEYTG+A+FGLS+FYSELM+G GAA+R+FE+ D +P IK
Sbjct: 354 GSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIK 413

Query: 459 STTGKA-FKPLN----GKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGK 513
           STTG+A FKPLN     ++EF++VSF YPTR TNQIFK+LNF +  GSNVCIVGPSGRGK
Sbjct: 414 STTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGK 473

Query: 514 STIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVS 573
           STIASLLL +YN  SG+IL+DGQDI  L++KSLRR++G+VQQEPILMSGTIR+NITYG++
Sbjct: 474 STIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLT 533

Query: 574 RQPSMEEIRSVAKKCFCHAFISKFPNGYE--TIIGPRGALLSGGQKQRIAIARALLNKPK 631
            +PS EEIR VAK+CFCH FI+KFP+ Y+     G  G  LSGGQKQRIAIARAL+ KP 
Sbjct: 534 EEPSKEEIRLVAKQCFCHNFITKFPDTYDTTIGSGSSGTSLSGGQKQRIAIARALIKKPN 593

Query: 632 ILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVV 691
           ILILDEATSALDVESEGAINYT G++MKSK +TI+SIAHRLSTIRR E+VIVLG DGSVV
Sbjct: 594 ILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVV 653

Query: 692 EMGKFKDLYANHDSALHKLLTXXXXXXXXXXXXYAPPAIT---------QESEPQTEENG 742
           EMGKFK+LY N  S L KLL               PP            +E++  +EENG
Sbjct: 654 EMGKFKELYDNPTSELSKLLNEKSSTKEATPQPVNPPPFIDLQTNPEEKKEADNASEENG 713

Query: 743 K--DDSGEDQNSDHEENSQDQNEKRLQEE 769
              DDS ED +      S D + K    E
Sbjct: 714 AKLDDSKEDVSVPDNMTSSDDSLKEAVNE 742

>Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa]
           {ON} complement(175048..177171) [2124 nt, 708 aa]
          Length = 707

 Score =  568 bits (1465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/643 (49%), Positives = 409/643 (63%), Gaps = 13/643 (2%)

Query: 76  NRNEASDVGGNGKHQEGEDKTPDK-KTNKPSSTVSGGLADVKRLFYLARHDWKMLVLAVS 134
           N ++AS        QE E K P K +   P  +   G  DVKRLF LAR +   + +A+ 
Sbjct: 60  NISDASSTVNAVAAQERELKIPPKIQKLTPDESGRSGFKDVKRLFELARPETFYISIALL 119

Query: 135 LLTVSCTIGMAVPKVIGLVLDATKNALXXXXXXXXXXXLEDSKSLTLDDLPPIVG--DIQ 192
           L+ +S  + M VP VIG +LD  K                  K    D+   I G   +Q
Sbjct: 120 LIFISSAVSMVVPSVIGKLLDIAKPPSADEENGKGVSEKLKEKE---DEDKKIYGLTALQ 176

Query: 193 LYDXXXXXXXXXXXXTMANFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGD 252
            Y              +AN GR+++LK+ GERLVARLR+  +K  +  +  F D NKVGD
Sbjct: 177 FY---TALGVVFTVGALANTGRIIILKVTGERLVARLRTRTMKAALEQEAAFLDSNKVGD 233

Query: 253 LLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGAT 312
           L+SRL  DA IV++S+TQN+SDG +A++ G VG GMM +IS  L SV+ L  PPL   A 
Sbjct: 234 LISRLSTDASIVAKSVTQNVSDGTRAILQGFVGFGMMSYISWQLTSVMLLLIPPLGAMAI 293

Query: 313 IYGNKIRAISRELQQASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKK 372
           IYG KIR +SR+LQ + G LTKVAEEQL+  +T+Q++  E KE+HRY   VR VF++G K
Sbjct: 294 IYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKKEIHRYATEVRNVFDIGYK 353

Query: 373 EAFTNATFFSSTNVLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLST 432
           EA T+  FF ST ++G+ + L +L  G++++  G LT+G+L++FM+Y  YTGS++FGLST
Sbjct: 354 EAVTSGLFFGSTGLVGNTALLSLLVVGTNMISSGALTVGELSSFMMYAVYTGSSLFGLST 413

Query: 433 FYSELMKGAGAATRLFELLDYKPTIKSTTGKAFKPLNGK-VEFQHVSFSYPTRKTNQIFK 491
           FYSELMKGAGAA R+FEL D KP IK T GK    L GK VEF++VSF YPTR   QIF+
Sbjct: 414 FYSELMKGAGAAARVFELSDRKPAIKPTIGKDPITLFGKTVEFKNVSFWYPTRPKQQIFQ 473

Query: 492 DLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLG 551
           D +  IEPG +VC VGPSG GKST++SLLLRYY+   G ILV G+DI   S +  RR LG
Sbjct: 474 DFSIKIEPGEHVCFVGPSGSGKSTVSSLLLRYYDVAKGSILVGGEDIKNFSLRKYRRLLG 533

Query: 552 VVQQEPILMSGTIRENITYGVSRQPSME--EIRSVAKKCFCHAFISKFPNGYETIIGPRG 609
           VVQQEP+L +GTI ENI Y V  + + E   I    +   C  F++ FP+G  T++GPRG
Sbjct: 534 VVQQEPMLFNGTILENILYSVPEEIANEPGRIERAIESANCSKFLNNFPDGLNTLVGPRG 593

Query: 610 ALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIA 669
             LSGGQKQRIA+AR  L  P ILILDEATSALD +SE  I   L +    K  T ISIA
Sbjct: 594 TQLSGGQKQRIALARTFLLDPSILILDEATSALDSQSEDIIAQNL-QARNEKGQTTISIA 652

Query: 670 HRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLLT 712
           HRLSTI+ S  V+VLG +G VVE G F++L +N  S L+ LLT
Sbjct: 653 HRLSTIKHSSRVVVLGKNGCVVETGTFQELISNPSSGLNILLT 695

>TPHA0B04620 Chr2 complement(1085725..1087887) [2163 bp, 720 aa]
           {ON} Anc_1.67 YLR188W
          Length = 720

 Score =  561 bits (1445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/640 (48%), Positives = 416/640 (65%), Gaps = 10/640 (1%)

Query: 76  NRNEASDVGGNGKHQEGEDKTPDKKTNKPSSTVSGGLADVKRLFYLARHDWKMLVLAVSL 135
           N    S  G N K  E + K     + + ++T   G  DVKRLF LA+ +   +VLA+ L
Sbjct: 60  NSTNESSKGINTKLTETQQKLEKLSSEESTNT---GFKDVKRLFTLAKPETAYIVLALVL 116

Query: 136 LTVSCTIGMAVPKVIGLVLDATKNALXXXXXXXXXXXLEDSKSLTLDDLPPIVGDIQLYD 195
           + +S T+ M VP VIG +LD + N               D+K    ++        Q + 
Sbjct: 117 ILISSTVSMVVPSVIGKLLDLSSNTSNDDTGDAKSKEKVDNKEDRDNNTIYGFTHTQFF- 175

Query: 196 XXXXXXXXXXXXTMANFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLS 255
                        +AN GR+V+LK+ GE+LVARLR+  +K  +  D  F D N+VGDL+S
Sbjct: 176 --AGLGIVFVIGAIANTGRIVILKVTGEKLVARLRTRTMKAALDQDATFLDSNRVGDLIS 233

Query: 256 RLGADAYIVSRSMTQNISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYG 315
           RL +DA IV++S+T N+SDG +A++ G VG  MM +IS  L SV+ L  PPL + A +YG
Sbjct: 234 RLSSDASIVAKSVTMNVSDGTRAILQGFVGFSMMSYISFKLTSVMVLLIPPLGIMALVYG 293

Query: 316 NKIRAISRELQQASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAF 375
            KIR +SR+LQ A G LTKVAEEQL+  KT+Q++  E KE+ RY + VR VF+VG KEA 
Sbjct: 294 KKIRNLSRQLQTAVGGLTKVAEEQLNATKTIQAYGGEKKEIRRYASEVRDVFDVGLKEAI 353

Query: 376 TNATFFSSTNVLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYS 435
           T+  FF ST ++G+ + L +L  G++++  G+LT+GDL++FM+Y  YTGS++FGLS+FYS
Sbjct: 354 TSGIFFGSTGLVGNAALLSLLLVGTNMISSGSLTVGDLSSFMMYAVYTGSSLFGLSSFYS 413

Query: 436 ELMKGAGAATRLFELLDYKPTIKSTTGKAFKPLNGK-VEFQHVSFSYPTRKTNQIFKDLN 494
           ELMKGAGAA R+FEL D KP IK T GK    L GK + FQ VSF YPTR  +++F  ++
Sbjct: 414 ELMKGAGAAARVFELDDRKPLIKPTIGKDPVTLKGKAIIFQDVSFHYPTRPNHRVFNKIS 473

Query: 495 FTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQ 554
           F IEPG ++C VGPSG GKST++ LLLRYY+ T G IL+   +I  LS +  R+ LGVVQ
Sbjct: 474 FKIEPGEHICFVGPSGSGKSTVSQLLLRYYDATEGNILIGEDNIKSLSLRKYRKLLGVVQ 533

Query: 555 QEPILMSGTIRENITYGVSRQPSME--EIRSVAKKCFCHAFISKFPNGYETIIGPRGALL 612
           QEP+L +GTI +NI Y V  + + +  ++    KK  C  F++ FP+G  TI+GPRG  L
Sbjct: 534 QEPMLFNGTIIDNILYNVPDEIASQKNKVDLAIKKSNCTKFLANFPDGLNTIVGPRGTQL 593

Query: 613 SGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRL 672
           SGGQKQRIAIAR+ L  P IL+LDEATSALD +SE  I  TL +  +++ LT ISIAHRL
Sbjct: 594 SGGQKQRIAIARSFLLDPSILLLDEATSALDTQSEDIIAMTLKK-REAEGLTTISIAHRL 652

Query: 673 STIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLLT 712
           STI+ S  V+VL  +GSVVE GKF +L AN  S L+ LL+
Sbjct: 653 STIKYSSRVVVLNKNGSVVETGKFTELIANPTSELNLLLS 692

>SAKL0C02244g Chr3 (201281..203419) [2139 bp, 712 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 712

 Score =  557 bits (1436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/612 (48%), Positives = 400/612 (65%), Gaps = 5/612 (0%)

Query: 104 PSSTVSGGLADVKRLFYLARHDWKMLVLAVSLLTVSCTIGMAVPKVIGLVLDATKNA-LX 162
           P  + + G  D+KRLF LA+ +   ++LA+  + +S  + M +P VIG +LDA K   L 
Sbjct: 94  PHDSKASGFKDIKRLFLLAKPETNSMILALVFILISGAVSMTIPSVIGKLLDAAKEGHLA 153

Query: 163 XXXXXXXXXXLEDSKSLTLDDLPPIVGDIQLYDXXXXXXXXXXXXTMANFGRVVLLKILG 222
                       DS     D    ++  +                  AN GR+VLLK+ G
Sbjct: 154 GVSASGEGVGSSDSSDNQEDSSDRLIYGLTFPQFYTALGTIFVVGAFANMGRIVLLKVTG 213

Query: 223 ERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICG 282
           E+LVARLR+  +K  +  D  F D N+VGDL+SRL +DA IVS+S+TQN+SDG +A+I G
Sbjct: 214 EKLVARLRTRTMKAALQQDATFLDNNRVGDLISRLSSDASIVSKSVTQNLSDGARAVIQG 273

Query: 283 GVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEEQLSG 342
            VG GMM  IS  L  V+ L APPL V A +YG KIR +SR+LQ + G LTKVAEEQLS 
Sbjct: 274 AVGFGMMSFISWKLTCVMTLMAPPLAVMAMVYGKKIRNLSRQLQTSVGGLTKVAEEQLSA 333

Query: 343 IKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAYGSHL 402
            +TVQ++  E +E+ RY   VR VFN+G KEA T+  FF  T  +G+ + L +L  G+ +
Sbjct: 334 ARTVQAYGGEKQEIRRYAGEVRNVFNIGLKEALTSGVFFGVTGFVGNVALLALLLTGTSM 393

Query: 403 VLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIKSTTG 462
           +  G +T+GDL++FM+Y  YTGS++FGLS+FYSELMKGAGAA R+FEL D KP I  T G
Sbjct: 394 IRSGAITVGDLSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIHPTKG 453

Query: 463 KAFKPLNGK-VEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLL 521
                L GK +EF++V+F+YPTR+ N+IF  L+  I+PG +VCIVGPSG GKSTIASLLL
Sbjct: 454 VDPVTLQGKTIEFRNVAFAYPTRRENRIFDGLSLDIQPGEHVCIVGPSGGGKSTIASLLL 513

Query: 522 RYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEI 581
           RYY+  +G+I + GQDI + + +  RR LGVVQQEP+L +GTI +NITY V  + + ++ 
Sbjct: 514 RYYDVDAGRIAIGGQDIRRFNLRKYRRLLGVVQQEPLLFNGTILDNITYAVPGELAGDDS 573

Query: 582 R--SVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEAT 639
           R      +  C  F++ FP+G ET++GPRGA +SGGQKQRIA+ARA L  P +LILDEAT
Sbjct: 574 RVSRAIGQANCTKFLANFPDGLETLVGPRGAQMSGGQKQRIALARAFLLDPAVLILDEAT 633

Query: 640 SALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDL 699
           SALD +SE  +  +L R    +  T +SIAHRLSTI+ S  VIVL   G V E G F++L
Sbjct: 634 SALDSQSEEVVAQSL-RSRSRRGKTTVSIAHRLSTIQHSSRVIVLDRHGGVGETGSFREL 692

Query: 700 YANHDSALHKLL 711
            ++ DS L +LL
Sbjct: 693 ISDPDSHLTQLL 704

>NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {ON}
           Anc_1.67
          Length = 714

 Score =  556 bits (1433), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/624 (47%), Positives = 410/624 (65%), Gaps = 16/624 (2%)

Query: 94  DKTPDKKTNKPSSTVSGGLADVKRLFYLARHDWKMLVLAVSLLTVSCTIGMAVPKVIGLV 153
           D  PD K      + S G  D++RLF LAR + + + LA+  + +S ++ M VP +IG +
Sbjct: 76  DIVPDIKGQMLRDSKSSGFKDIQRLFSLARPELRYIALALLFILISSSVSMTVPSIIGKL 135

Query: 154 LDATKNALXXXXXXXXXXXLEDSKSLTLDDLPPIVGDIQLYDXXXXXXXXXXXXTMANFG 213
           LDA K               EDSK++  D     +   Q Y              +AN G
Sbjct: 136 LDAAKKGQKENEE-------EDSKTIVPDITFFGLTRTQFY---TALGVLFLVGAIANTG 185

Query: 214 RVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNIS 273
           R+++LK+ GERLVARLR+  +K  +  D  F D N+VGDL+SRL +DA IVS+++TQN+S
Sbjct: 186 RIIILKVTGERLVARLRTRTMKAALDQDATFLDANRVGDLISRLSSDAAIVSKAVTQNVS 245

Query: 274 DGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLT 333
           DG +A+I G VG GMM ++S  L  V+ L  PPL + A +YG KIR +S++LQ++ G L+
Sbjct: 246 DGTRAIIQGFVGFGMMGYLSWKLTGVMMLMVPPLGIMALVYGRKIRNLSKQLQESVGGLS 305

Query: 334 KVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFL 393
           KVAEEQL+  KT+Q++V E  E+HRY   VR VF +G KEA T+  FF ST ++G+ + +
Sbjct: 306 KVAEEQLNATKTIQAYVGERLEIHRYATEVRNVFRIGLKEAVTSGLFFGSTGLVGNIAMI 365

Query: 394 LVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDY 453
            +L  G++++  G LT+G+L++FM+Y  YTGS++FGLS+FYSELMKGAGAA+R+FEL D 
Sbjct: 366 SLLLVGTNMIQSGTLTVGELSSFMMYAVYTGSSLFGLSSFYSELMKGAGAASRVFELNDR 425

Query: 454 KPTIKSTTGKAFKPLNGK-VEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRG 512
           KP IKST G   K L GK ++F++VSF+YP+R  ++IF +LN  I PG +VCIVG SG G
Sbjct: 426 KPLIKSTVGIDPKTLFGKSIKFENVSFTYPSRPNHKIFDNLNLEINPGEHVCIVGFSGSG 485

Query: 513 KSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGV 572
           KSTIASLLLRYY+  +G I +   DI   S +  RR +G VQQEP L +G+I +NI Y +
Sbjct: 486 KSTIASLLLRYYDVNNGSIRIGDNDIRNFSLRKYRRLIGTVQQEPSLFNGSILDNIIYAI 545

Query: 573 ----SRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLN 628
               + +   E ++   K+  C+ F+ KFP+G +T++GPRGA LSGGQKQRIA+ARA L 
Sbjct: 546 PPELTSEKQHERVQLAIKQANCNIFLGKFPDGLQTLVGPRGAQLSGGQKQRIALARAFLL 605

Query: 629 KPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDG 688
            P +LILDE+TSALD  SE  +  TL +   ++ LT ISIAHRLSTI+ S  VIV+G  G
Sbjct: 606 DPTLLILDESTSALDSLSEELVAKTL-QARSARGLTTISIAHRLSTIKHSSRVIVIGKYG 664

Query: 689 SVVEMGKFKDLYANHDSALHKLLT 712
           SVVE G F  L  N  S L+ LL+
Sbjct: 665 SVVESGPFDRLIDNPKSELNMLLS 688

>KLLA0C01991g Chr3 (160778..162898) [2121 bp, 706 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 706

 Score =  553 bits (1424), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/632 (48%), Positives = 407/632 (64%), Gaps = 37/632 (5%)

Query: 99  KKTNKPS--STVSG-----------GLADVKRLFYLARHDWKMLVLAVSLLTVSCTIGMA 145
           KK  KPS  +TV G           G  D+KRLF LA+ + + + +A+ L+ +S  + MA
Sbjct: 57  KKQGKPSLTATVKGLRLSPHDSKASGWQDIKRLFLLAKPETRSMFIALILIILSSAVSMA 116

Query: 146 VPKVIGLVLDATKNALXXXXXXXXXXXLEDSKSLTLDDLPPIVG--DIQLYDXXXXXXXX 203
           VP VIG +LD  +               E+ +    +    I G    Q Y         
Sbjct: 117 VPTVIGKLLDIAR---------------EEHEQPETEKETMIFGLTSTQFY---TALGGV 158

Query: 204 XXXXTMANFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYI 263
                +AN GR+V+LK+ GERLVARLR+  +K  +  D  F D N+VGDL+SRL +DA I
Sbjct: 159 FVVGALANVGRIVILKVTGERLVARLRTRTMKAALEQDATFLDHNRVGDLISRLSSDAGI 218

Query: 264 VSRSMTQNISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISR 323
           VS+S+TQN+SDG +A+I G VG GMM  IS  L  V+ L APPL V A +YG +IR +SR
Sbjct: 219 VSKSVTQNLSDGTRAVIQGFVGFGMMSFISWKLTCVMMLLAPPLGVMALVYGKRIRNLSR 278

Query: 324 ELQQASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSS 383
           +LQ + G LTKV+EEQLS  KT+Q++  E KE+HRY + VR+VF+VG KEA T+  FF  
Sbjct: 279 QLQTSVGELTKVSEEQLSATKTIQAYCGEKKEIHRYADEVRKVFHVGLKEALTSGAFFGV 338

Query: 384 TNVLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGA 443
           T  +G+ + L +L  G+ ++  G +T+GDL++FM+Y  YTGS++FGLS+FYSELMKGAGA
Sbjct: 339 TGFVGNVALLALLLTGTSMIKTGLMTVGDLSSFMMYAVYTGSSLFGLSSFYSELMKGAGA 398

Query: 444 ATRLFELLDYKPTIKSTTGKAFKPLNGK-VEFQHVSFSYPTRKTNQIFKDLNFTIEPGSN 502
           A R+FEL D KP I  T GK    L  K + F HV FSYPTR  + IF+DLNFT+ PG +
Sbjct: 399 AARVFELNDRKPLIHPTIGKDPVTLENKSIHFNHVKFSYPTRPQHHIFEDLNFTVRPGEH 458

Query: 503 VCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSG 562
           VCIVGPSG GKST+ASLLLRYY+  SG+I +   +I   + +  RR LGVVQQEP+L SG
Sbjct: 459 VCIVGPSGGGKSTVASLLLRYYDIGSGEIKLGNDNIRDFNLRKYRRLLGVVQQEPMLFSG 518

Query: 563 TIRENITYGVSRQPSMEEIR--SVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRI 620
           TI +NITY V ++   +E R      +  C  F++ FP+G +T +GPRG  LSGGQKQRI
Sbjct: 519 TILDNITYAVPQELVNDETRISRAIGQANCTKFLANFPDGLQTTVGPRGTQLSGGQKQRI 578

Query: 621 AIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSEN 680
           A+ARA L  P ILILDEATSALD +SE  +  +L +   ++  T ISIAHR+STI+ S  
Sbjct: 579 ALARAFLLDPSILILDEATSALDSQSEEVVAQSLQQ-RSARGKTTISIAHRVSTIQHSSR 637

Query: 681 VIVLGIDGSVVEMGKFKDLYANHDSALHKLLT 712
           VIVL   G+V E G F  L A  DS+L+KLL+
Sbjct: 638 VIVLNRHGTVAETGSFDKLIAIPDSSLNKLLS 669

>TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa]
           {ON} Anc_1.67 YLR188W
          Length = 693

 Score =  552 bits (1422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/612 (48%), Positives = 400/612 (65%), Gaps = 17/612 (2%)

Query: 104 PSSTVSGGLADVKRLFYLARHDWKMLVLAVSLLTVSCTIGMAVPKVIGLVLDATKNALXX 163
           PS     G  D+KRLF LA+ +   + LA+ L+ +S  + M +P ++G +LD  K+    
Sbjct: 82  PSDLNGSGFKDIKRLFRLAKPETLQIALALVLILISSAVSMTIPTIVGKLLDIAKDR--- 138

Query: 164 XXXXXXXXXLEDSKSLTLDDLPPIVGDIQLYDXXXXXXXXXXXXTMANFGRVVLLKILGE 223
                     +D+   T DD  P +  +                  AN GR+V+LKI GE
Sbjct: 139 ----------KDADDTTEDDEGPKIFGMTTKQFCTALLAVFLVGAAANAGRIVILKITGE 188

Query: 224 RLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGG 283
           RLVARLR+  +K  +  D  F D N+VGDL+S L +DA IV++S+TQN+SDG +A+I G 
Sbjct: 189 RLVARLRTRTMKAALDQDATFLDTNRVGDLISCLSSDASIVAKSVTQNVSDGTRAVIQGF 248

Query: 284 VGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEEQLSGI 343
           VG GMM +IS  L SV+ L  PPL + A +YG KIR +SR+LQ + G LTKV+EEQL  +
Sbjct: 249 VGFGMMGYISWQLTSVMILMIPPLGIMAVVYGRKIRNLSRQLQTSVGGLTKVSEEQLGAV 308

Query: 344 KTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAYGSHLV 403
           KT+QS+V E KE+HRY   VR VFN+G KEA T+  FF ST ++G+ S L +L  G++++
Sbjct: 309 KTIQSYVGEKKEIHRYATEVRNVFNIGLKEALTSGVFFGSTGLVGNISLLALLMVGTNMI 368

Query: 404 LQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIKSTTGK 463
             G +T+GDL++FM+Y  YTGS++FGLS+FYSELMKGAGAA R+FEL D KP I  T G+
Sbjct: 369 QNGLITVGDLSSFMMYAVYTGSSMFGLSSFYSELMKGAGAAARVFELKDRKPLIPPTIGQ 428

Query: 464 AFKPL-NGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLR 522
               L N  + F++VSF+YPTR   +IF  L+ T+EPG +VCIVGPSG GKST+ASLLLR
Sbjct: 429 DPVTLANKTIRFENVSFTYPTRLNQKIFDGLDITVEPGEHVCIVGPSGSGKSTVASLLLR 488

Query: 523 YYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGV--SRQPSMEE 580
           YY+   G+I++   +I   + +  RR LG+VQQEP L +GTI +NI Y V   R  + + 
Sbjct: 489 YYDTNEGRIMIGDHNINSFNVRKYRRLLGIVQQEPQLFNGTILDNILYTVPPERADNDDL 548

Query: 581 IRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATS 640
           I +   +  C  F++ FP+G +T++GPRGA LSGGQKQRIA+ARA L  P +LILDEATS
Sbjct: 549 ISTAIGQANCSKFLANFPDGLQTLVGPRGAQLSGGQKQRIALARAFLLDPSLLILDEATS 608

Query: 641 ALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLY 700
           ALD +SE  +  TL R+   + LT ISIAHRLSTI+    V+VLG  G VVE G F++L 
Sbjct: 609 ALDSQSEEIVAQTL-RVRVQRGLTTISIAHRLSTIKNCTRVVVLGKCGQVVESGPFEELL 667

Query: 701 ANHDSALHKLLT 712
            N  S L  LL+
Sbjct: 668 RNPLSELSILLS 679

>NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1.67
          Length = 715

 Score =  552 bits (1423), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/655 (46%), Positives = 421/655 (64%), Gaps = 25/655 (3%)

Query: 66  GIRSFSITLRNRNEA-SDVGGNGKHQEGEDKTPDKKTNKPSSTVS--GGLADVKRLFYLA 122
           GIR  ++ +R  N +  DV      ++     P  +  K S+ VS   G+ D+KRLF LA
Sbjct: 49  GIRRKTLEIRRWNSSIVDV-----KKKRSSPPPSIEVQKLSNEVSKSNGMKDIKRLFKLA 103

Query: 123 RHDWKMLVLAVSLLTVSCTIGMAVPKVIGLVLDATKNALXXXXXXXXXXXLEDSKSLTLD 182
           + + K ++LA+  + +S ++ M +P +IG +LD  K               +  K +   
Sbjct: 104 KPEAKYILLALLFIVISSSVSMTIPTIIGKLLDLAKADNDDEDGDNNA---KKEKLMIFG 160

Query: 183 DLPPIVGDIQLYDXXXXXXXXXXXXTMANFGRVVLLKILGERLVARLRSNVIKKTMHHDM 242
              P     Q Y              +AN  R+V+LK+ GERLVARLR+  +K  ++ D 
Sbjct: 161 LTKP-----QFY---TALGGLFLAGAIANASRIVILKVTGERLVARLRTRTMKAALYQDA 212

Query: 243 EFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGMMFHISSTLASVLFL 302
            F D N+VGDL+SRL +DA IV++++TQN+SDG +A+I G VG GMM  IS  L  V+ +
Sbjct: 213 SFLDTNRVGDLISRLSSDASIVAKAVTQNVSDGSRAVIQGFVGFGMMSFISWKLTCVMMI 272

Query: 303 FAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNA 362
             PPL V A +YG KIR +SR+LQ + G LTKVAEEQL+  +T+Q++  E  E+HRY   
Sbjct: 273 MVPPLGVMALVYGRKIRTLSRQLQASVGGLTKVAEEQLNATRTIQAYGGEALEIHRYATE 332

Query: 363 VRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEY 422
           VR+VF+VG KEA T+  FF ST ++G+ + + +L  G+ ++  G LT+GDL++FM+Y  Y
Sbjct: 333 VRKVFDVGLKEAVTSGLFFGSTGLVGNIAMISLLLVGTSMIQYGTLTVGDLSSFMMYAVY 392

Query: 423 TGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIKSTTGKAFKPLNGK-VEFQHVSFSY 481
           TGS++FGLS FYSELMKGAGAATR+FEL D KP IK T G   K L GK +EFQ+VSF+Y
Sbjct: 393 TGSSLFGLSGFYSELMKGAGAATRVFELNDRKPLIKPTIGYDPKSLLGKSIEFQNVSFAY 452

Query: 482 PTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKL 541
           PTR T+ I  +L+ +I+PG +VCIVGPSG GKST++SLLLRYY+ ++G I +DGQ+I + 
Sbjct: 453 PTRPTHSILNNLSISIQPGEHVCIVGPSGSGKSTVSSLLLRYYDVSTGSIKIDGQNIKEF 512

Query: 542 SSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSME----EIRSVAKKCFCHAFISKF 597
           + +  RR LGVVQQEP+L +GTI +NI Y V  + ++     +++   ++  C  F+  F
Sbjct: 513 NLRKYRRLLGVVQQEPMLFNGTILDNILYAVLSKETLTANSPDVKRALEQANCTKFLKNF 572

Query: 598 PNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRL 657
           P G  T++GPRG  LSGGQKQRIA+ARA L  P +LILDEATSALD +SE  +   L   
Sbjct: 573 PEGVNTLVGPRGTQLSGGQKQRIALARAFLLHPALLILDEATSALDSQSEEIVAKNLSER 632

Query: 658 MKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLLT 712
           ++   LT ISIAHRLSTI+ S  VIVL   GSVVE G F++L     S L+ LL+
Sbjct: 633 VELG-LTTISIAHRLSTIKHSTRVIVLDKSGSVVETGPFEELVDYSRSELNMLLS 686

>Skud_12.253 Chr12 (474886..476964) [2079 bp, 692 aa] {ON} YLR188W
           (REAL)
          Length = 692

 Score =  541 bits (1394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/631 (48%), Positives = 411/631 (65%), Gaps = 32/631 (5%)

Query: 92  GEDKTPDKKTNKPS--STVSGGLADVKRLFYLARHDWKMLVLAVSLLTVSCTIGMAVPKV 149
            E K   K T K S  ++ S G  D+KRLF L+R + K + LA+ L+ +S ++ MAVP V
Sbjct: 64  AEGKASTKPTLKLSDANSKSSGFKDIKRLFVLSRPESKYIGLALLLILISSSVSMAVPSV 123

Query: 150 IGLVLDATKNALXXXXXXXXXXXLEDSK--SLTLDDLPPIVGDIQLYDXXXXXXXXXXXX 207
           IG +LD    +              DSK   LT       +G + +              
Sbjct: 124 IGKLLDVASESDDEEDEEKA----RDSKLYGLTKKQFFTALGLVFVIG------------ 167

Query: 208 TMANFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRS 267
            +AN  R+++LKI GERLVARLR+  +K  +  D  F D N+VGDL+SRL +DA IV++S
Sbjct: 168 AVANASRIIILKITGERLVARLRTRTMKAALDQDATFLDTNRVGDLISRLSSDASIVAKS 227

Query: 268 MTQNISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQ 327
           +TQN+SDG +A+I G VG GMM  +S  L  V+ L APPL   A +YG KIR +SR+LQ 
Sbjct: 228 VTQNVSDGTRAIIQGFVGFGMMSFLSWKLTCVMMLLAPPLGAMALVYGKKIRNLSRQLQT 287

Query: 328 ASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVL 387
           + G LTKVAEEQL+  +T+Q++  E  EVHRY   VR VF++G KEA T+  FF ST ++
Sbjct: 288 SVGGLTKVAEEQLNATRTIQAYGGEKNEVHRYAKEVRNVFHIGLKEAVTSGLFFGSTGLV 347

Query: 388 GDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRL 447
           G+ + L +L  G++++  G +TIG+L++FM+Y  YTGS++FGLS+FYSELMKGAGAA R+
Sbjct: 348 GNTAMLSLLLVGTNMIQSGVMTIGELSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARV 407

Query: 448 FELLDYKPTIKSTTGK-----AFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSN 502
           FEL D KP I  T GK     A KP    V F++VSF+YPTR  +QIFKDLN TI+PG +
Sbjct: 408 FELNDRKPLIHPTIGKDPISLAHKP----VVFKNVSFTYPTRPKHQIFKDLNITIKPGEH 463

Query: 503 VCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSG 562
           VC VGPSG GKSTIASLLLRYY+  SG I  D +D+   + +  RR +G VQQEP+L +G
Sbjct: 464 VCAVGPSGSGKSTIASLLLRYYDVNSGSIEFDDEDVRNFNLRKYRRLIGYVQQEPLLFNG 523

Query: 563 TIRENITYGVSRQPSMEEIR--SVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRI 620
           TI +NI Y +  + +  E R     ++  C  F++ FP+G +T++G RGA LSGGQKQRI
Sbjct: 524 TILDNILYCIPSEIAEREDRVARAIEQANCTKFLANFPDGLQTMVGARGAQLSGGQKQRI 583

Query: 621 AIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSEN 680
           A+ARA L  P +LILDEATSALD +SE  +   L + ++ + LT ISIAHRLSTI+ S  
Sbjct: 584 ALARAFLLDPALLILDEATSALDSQSEEIVAKNLQKRVE-RGLTTISIAHRLSTIKHSTR 642

Query: 681 VIVLGIDGSVVEMGKFKDLYANHDSALHKLL 711
           +IVLG  GSVVE G F+DL A  DS L+ LL
Sbjct: 643 IIVLGKHGSVVETGSFRDLIAIPDSELNALL 673

>ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]
           {ON} similar to uniprot|P33310 Saccharomyces cerevisiae
           YLR188W MDL1 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane mediates
           export of peptides generated upon proteolysis of
           mitochondrial proteins plays a role in the regulation of
           cellular resistance to oxidative stress
          Length = 714

 Score =  537 bits (1384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/616 (47%), Positives = 393/616 (63%), Gaps = 25/616 (4%)

Query: 109 SGGLADVKRLFYLARHDWKMLVLAVSLLTVSCTIGMAVPKVIGLVLDATKNAL----XXX 164
           S G  D+ RL  LAR +   ++ A+ L+ +S T+ M +P VIG +LD  K++        
Sbjct: 87  SSGFRDITRLLGLARPEVWYIMGALCLIVISSTVSMLLPSVIGKLLDLAKSSSPSENEKQ 146

Query: 165 XXXXXXXXLEDSKSLTLDDLPP-----IVGDIQLYDXXXXXXXXXXXXTMANFGRVVLLK 219
                    +D +  T+    P     I+G I                  AN GR+++LK
Sbjct: 147 ESGDGDDKDKDKEEGTIYGFTPKQFCVIMGGI------------FVAGAFANCGRIIILK 194

Query: 220 ILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKAL 279
           + GERLVARLR+  +K  +  D  F DRN+VGDL+SRL +D+ IV++S+TQN+SDG +A+
Sbjct: 195 VTGERLVARLRTRTMKAALDQDSAFLDRNRVGDLISRLSSDSSIVAKSLTQNVSDGTRAV 254

Query: 280 ICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEEQ 339
           I G VG GMM +IS  L  V+ L  PP+   A IYG KIR +S++LQ + G LTKVAEEQ
Sbjct: 255 IQGFVGFGMMTYISWQLTCVMGLMLPPIGAMAIIYGKKIRNLSKQLQTSVGGLTKVAEEQ 314

Query: 340 LSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAYG 399
           L   KT+QS+V E KE+ RY   VRQVF++G KEA T+  FF ST  +G+ S L +L  G
Sbjct: 315 LGATKTIQSYVGEKKEIRRYAKEVRQVFDIGLKEALTSGMFFGSTGFVGNISLLALLMSG 374

Query: 400 SHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIKS 459
           + ++  G +T+GDL++FM+Y  YTG ++FGLS FYSELMKGAGAA R+FEL D KP I  
Sbjct: 375 ASMIQSGLITVGDLSSFMMYAVYTGGSMFGLSNFYSELMKGAGAAARVFELNDRKPAIAP 434

Query: 460 TTGKAFKPL-NGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIAS 518
           T GK    + N  + F+ VSF+YPTR   +IF  LN TI+PG ++CI GPSG GKSTIAS
Sbjct: 435 TLGKGPTSIRNLPISFKDVSFTYPTRLNKKIFNHLNLTIQPGEHICIAGPSGSGKSTIAS 494

Query: 519 LLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSM 578
           LL+RYY+   G I +   D+   + +  RR +GVV QEP+L +GTI ENI Y V    + 
Sbjct: 495 LLVRYYDVDQGGISIGDTDLRTFNLRKYRRLIGVVHQEPVLFNGTILENILYAVPPSVAQ 554

Query: 579 EEIRSVAK--KCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILD 636
           +E R  A   K  C  F+S FP+G ET++GPRGA LSGGQKQR+A+ARA L  P +L+LD
Sbjct: 555 DERRVSAAIGKANCSKFLSNFPDGLETLVGPRGAQLSGGQKQRVALARAFLLDPALLVLD 614

Query: 637 EATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKF 696
           EATSALD +SE  +  TL   ++ + LT ISIAHR+STI  S  V+VLG DG VVE G F
Sbjct: 615 EATSALDSQSEEIVARTLQERVR-RGLTTISIAHRISTIAHSTRVVVLGRDGFVVESGPF 673

Query: 697 KDLYANHDSALHKLLT 712
           ++L    +S L+ LL+
Sbjct: 674 QELIDRPNSELNYLLS 689

>KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 734

 Score =  538 bits (1385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/629 (48%), Positives = 407/629 (64%), Gaps = 25/629 (3%)

Query: 102 NKPSSTV------SGGLADVKRLFYLARHDWKMLVLAVSLLTVSCTIGMAVPKVIGLVLD 155
           +KPS+T+      S    D+KRLF LAR + K +  A+ L+ +S ++ M VP VIG ++D
Sbjct: 68  SKPSTTLTSEEQNSSSWKDIKRLFQLARPESKSMFFALVLIILSSSVSMLVPGVIGKLMD 127

Query: 156 ATK----NALXXXXXXXXXXXLEDSKSLTLDDLPPIVGDIQLYDXXXXXXXXXXXXTMAN 211
             K    ++              D  +    D   ++  + L                AN
Sbjct: 128 VAKEDGTSSSEADGKRGDATDKTDGSTAADTDSEKLILGLTLPQFYGGLFSLFVVGAAAN 187

Query: 212 FGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQN 271
            GR+V+LK+ GE+LVARLR+  +K  +  D  F D NKVGDL+SRL +DA IVS+S+TQN
Sbjct: 188 MGRIVILKVTGEKLVARLRTRTLKAALQQDASFLDNNKVGDLISRLSSDASIVSKSLTQN 247

Query: 272 ISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGN 331
           +SDG ++LI G VG GMM +IS  L  V+ L APPL V A +YG KIR +SR LQ + G 
Sbjct: 248 MSDGTRSLIQGFVGFGMMSYISWKLTCVMMLLAPPLAVMALVYGRKIRNLSRTLQASVGG 307

Query: 332 LTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFS 391
           LTK AEEQLS  +T+Q++  E + +  Y   VRQV+ VG KEA T+  FF  T ++G+ +
Sbjct: 308 LTKAAEEQLSATRTIQAYGGEKQAIRHYAKEVRQVYQVGLKEALTSGGFFGLTGLVGNSA 367

Query: 392 FLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELL 451
            L +L  G+ ++  G +T+GDL++FM+Y  YTGS++FG+S+FYSELMKGAGAA R+FEL 
Sbjct: 368 VLALLLTGTSMISTGAMTVGDLSSFMIYAVYTGSSLFGMSSFYSELMKGAGAAARVFELN 427

Query: 452 DYKPTIKSTTGK-----AFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIV 506
           D KP I  T G+     A KP    VEF+ V F+YPTR+ + IF+DL+  I+PG +VCIV
Sbjct: 428 DRKPAIHPTKGRDPVSLARKP----VEFKKVHFAYPTRRQHVIFEDLSLRIDPGEHVCIV 483

Query: 507 GPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRE 566
           GPSG GKST+ASLLLR+Y+  +G IL+ GQ+I   + +  RR +G+VQQEP+L +GTI E
Sbjct: 484 GPSGGGKSTVASLLLRFYDVDAGAILIGGQNIADFNLRKYRRLVGIVQQEPMLFNGTILE 543

Query: 567 NITYGVSRQPSMEEIRSVAK---KCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIA 623
           NI Y V ++   EE   VA+   +  C AF+S FP+G +T++GPRG  LSGGQKQRIA+A
Sbjct: 544 NILYTVPQRLLNEEDGRVARAIGQANCSAFLSSFPDGLQTMVGPRGTQLSGGQKQRIALA 603

Query: 624 RALLNKPKILILDEATSALDVESEGAINYTL-GRLMKSKELTIISIAHRLSTIRRSENVI 682
           RA L  P +LILDEATSALD  SE  I  TL  R  + K  T ISIAHR+STI+ S  VI
Sbjct: 604 RAFLLDPDLLILDEATSALDSRSEEVIARTLHSRTTRGK--TTISIAHRVSTIQHSTRVI 661

Query: 683 VLGIDGSVVEMGKFKDLYANHDSALHKLL 711
           VLG +G VVE G F +L +N DS L+KLL
Sbjct: 662 VLGRNGGVVETGTFDELASNTDSQLNKLL 690

>YLR188W Chr12 (528300..530387) [2088 bp, 695 aa] {ON}
           MDL1Mitochondrial inner membrane half-type ATP-binding
           cassette (ABC) transporter, mediates export of peptides
           generated upon proteolysis of mitochondrial proteins,
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 695

 Score =  535 bits (1377), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 303/632 (47%), Positives = 410/632 (64%), Gaps = 35/632 (5%)

Query: 94  DKTPDKKTNKPS------STVSGGLADVKRLFYLARHDWKMLVLAVSLLTVSCTIGMAVP 147
           D    KK+ KP+      ++ S G  D+KRLF L++ + K + LA+ L+ +S ++ MAVP
Sbjct: 62  DIAQGKKSTKPTLKLSNANSKSSGFKDIKRLFVLSKPESKYIGLALLLILISSSVSMAVP 121

Query: 148 KVIGLVLDATKNALXXXXXXXXXXXLEDSKS-----LTLDDLPPIVGDIQLYDXXXXXXX 202
            VIG +LD    +             E SKS      T       +G + +         
Sbjct: 122 SVIGKLLDLASES--------DGEDEEGSKSNKLYGFTKKQFFTALGAVFIIG------- 166

Query: 203 XXXXXTMANFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAY 262
                 +AN  R+++LK+ GERLVARLR+  +K  +  D  F D N+VGDL+SRL +DA 
Sbjct: 167 -----AVANASRIIILKVTGERLVARLRTRTMKAALDQDATFLDTNRVGDLISRLSSDAS 221

Query: 263 IVSRSMTQNISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAIS 322
           IV++S+TQN+SDG +A+I G VG GMM  +S  L  V+ + APPL   A IYG KIR +S
Sbjct: 222 IVAKSVTQNVSDGTRAIIQGFVGFGMMSFLSWKLTCVMMILAPPLGAMALIYGRKIRNLS 281

Query: 323 RELQQASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFS 382
           R+LQ + G LTKVAEEQL+  +T+Q++  E  EV RY   VR VF++G KEA T+  FF 
Sbjct: 282 RQLQTSVGGLTKVAEEQLNATRTIQAYGGEKNEVRRYAKEVRNVFHIGLKEAVTSGLFFG 341

Query: 383 STNVLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAG 442
           ST ++G+ + L +L  G+ ++  G++T+G+L++FM+Y  YTGS++FGLS+FYSELMKGAG
Sbjct: 342 STGLVGNTAMLSLLLVGTSMIQSGSMTVGELSSFMMYAVYTGSSLFGLSSFYSELMKGAG 401

Query: 443 AATRLFELLDYKPTIKSTTGKAFKPLNGK-VEFQHVSFSYPTRKTNQIFKDLNFTIEPGS 501
           AA R+FEL D KP I+ T GK    L  K + F++VSF+YPTR  +QIFKDLN TI+PG 
Sbjct: 402 AAARVFELNDRKPLIRPTIGKDPVSLAQKPIVFKNVSFTYPTRPKHQIFKDLNITIKPGE 461

Query: 502 NVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMS 561
           +VC VGPSG GKSTIASLLLRYY+  SG I    +DI   + +  RR +G VQQEP+L +
Sbjct: 462 HVCAVGPSGSGKSTIASLLLRYYDVNSGSIEFGDEDIRNFNLRKYRRLIGYVQQEPLLFN 521

Query: 562 GTIRENITYGVSRQPSMEE--IRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQR 619
           GTI +NI Y +  + + ++  IR    K  C  F++ FP+G +T++G RGA LSGGQKQR
Sbjct: 522 GTILDNILYCIPPEIAEQDDRIRRAIGKANCTKFLANFPDGLQTMVGARGAQLSGGQKQR 581

Query: 620 IAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSE 679
           IA+ARA L  P +LILDEATSALD +SE  +   L R ++ +  T ISIAHRLSTI+ S 
Sbjct: 582 IALARAFLLDPAVLILDEATSALDSQSEEIVAKNLQRRVE-RGFTTISIAHRLSTIKHST 640

Query: 680 NVIVLGIDGSVVEMGKFKDLYANHDSALHKLL 711
            VIVLG  GSVVE G F+DL A  +S L+ LL
Sbjct: 641 RVIVLGKHGSVVETGSFRDLIAIPNSELNALL 672

>Smik_12.248 Chr12 (475233..477323) [2091 bp, 696 aa] {ON} YLR188W
           (REAL)
          Length = 696

 Score =  531 bits (1367), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 303/628 (48%), Positives = 405/628 (64%), Gaps = 28/628 (4%)

Query: 93  EDKTPDKKTNKPS--STVSGGLADVKRLFYLARHDWKMLVLAVSLLTVSCTIGMAVPKVI 150
           E KT  K T K S  ++ S G  D+KRLF L++ + K + LA+ L+ +S ++ MAVP VI
Sbjct: 65  EGKTFTKPTLKLSDANSKSSGFKDIKRLFVLSKPESKYIGLALLLILISSSVSMAVPSVI 124

Query: 151 GLVLDATKNALXXXXXXXXXXX----LEDSKSLTLDDLPPIVGDIQLYDXXXXXXXXXXX 206
           G +LD                     L   +  T   L  I+G +               
Sbjct: 125 GKLLDLASETEDEEKEEKAKSNKLYGLTKRQFFTALGLVFIIGAV--------------- 169

Query: 207 XTMANFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSR 266
              AN  R+++LK+ GERLVARLR+  +K  +  D  F D N+VGDL+SRL +DA IV++
Sbjct: 170 ---ANASRIIILKVTGERLVARLRTRTMKAALDQDATFLDTNRVGDLISRLSSDASIVAK 226

Query: 267 SMTQNISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQ 326
           S+TQN+SDG +A+I G VG GMM  +S  L  V+ + APPL   A IYG KIR +SR+LQ
Sbjct: 227 SVTQNVSDGTRAIIQGFVGFGMMSFLSWKLTCVMMVLAPPLGAMALIYGRKIRNLSRQLQ 286

Query: 327 QASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNV 386
            + G LTKVAEEQL+  +T+Q++  E  EV RY   VR VF++G KEA T+  FF ST +
Sbjct: 287 TSVGGLTKVAEEQLNATRTIQAYGGEKNEVRRYAKEVRNVFHIGLKEAVTSGLFFGSTGL 346

Query: 387 LGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATR 446
           +G+ + L +L  G+ ++  G++T+G+L++FM+Y  YTGS++FGLS+FYSELMKGAGAA R
Sbjct: 347 VGNTAMLSLLLVGTSMIQSGSMTVGELSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAAR 406

Query: 447 LFELLDYKPTIKSTTGKAFKPLNGK-VEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCI 505
           +FEL D KP I+ T GK    L  K + F++VSF+YPTR  +QIFKDLN TI PG +VC 
Sbjct: 407 VFELNDRKPLIRPTIGKDPVSLAQKPIVFKNVSFTYPTRPKHQIFKDLNITINPGEHVCA 466

Query: 506 VGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIR 565
           VGPSG GKSTIASLLLRYY+  SG I    +DI   + +  RR +G VQQEP+L +GTI 
Sbjct: 467 VGPSGSGKSTIASLLLRYYDVNSGSIEFGDEDIRSFNLRKYRRLIGYVQQEPLLFNGTIL 526

Query: 566 ENITYGVSRQPSMEEIR--SVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIA 623
           +NI Y +  + + +E R      +  C  F++ FP+G +T +G RGA LSGGQKQRIA+A
Sbjct: 527 DNILYCIPPEIAEQEDRIGRAIGQANCTKFLANFPDGLQTTVGARGAQLSGGQKQRIALA 586

Query: 624 RALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIV 683
           RA L  P +LILDEATSALD +SE  +   L R ++ + LT ISIAHRLSTI+ S  V+V
Sbjct: 587 RAFLLDPAVLILDEATSALDSQSEEIVAKNLQRRVE-RGLTTISIAHRLSTIKHSTRVVV 645

Query: 684 LGIDGSVVEMGKFKDLYANHDSALHKLL 711
           LG  GSVVE G F+DL A  +S L+ LL
Sbjct: 646 LGKHGSVVETGSFQDLIAIPNSELNALL 673

>AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR188W
           (MDL1)
          Length = 677

 Score =  528 bits (1359), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 290/616 (47%), Positives = 394/616 (63%), Gaps = 28/616 (4%)

Query: 106 STVSG---GLADVKRLFYLARHDWKMLVLAVSLLTVSCTIGMAVPKVIGLVLDATKNALX 162
           ST +G   G  DV+RLF LAR + K LV A+ L+ +S  + M +P VIG +LD  +  + 
Sbjct: 73  STATGNASGAKDVRRLFQLARPELKSLVCALVLIVISGAVSMTIPSVIGKLLDVAREDVE 132

Query: 163 XXXXXXXXXXLEDSKSLTLDDLPPIVGDIQLYDXXXXXXXXXXXXTMANFGRVVLLKILG 222
                       D +   L  LP    + Q Y              +AN GR+V+LK  G
Sbjct: 133 QESG--------DEEEAVLYGLP----EKQFY---LALSGIFAVGALANMGRIVVLKTTG 177

Query: 223 ERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICG 282
           ERLVARLR+  +K  +  +  F D N+VGDL+SRL +DA IVS+S+TQN SDG +A+I G
Sbjct: 178 ERLVARLRTRTMKAALEQEGAFLDSNRVGDLISRLSSDASIVSKSITQNTSDGARAVIQG 237

Query: 283 GVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEEQLSG 342
            VG GMM +IS  L +V+ L APPL++ A  YG ++R +SRELQ   G LTKVAEEQL+ 
Sbjct: 238 AVGFGMMSYISWQLTAVMTLLAPPLVLMAAFYGRRVRNLSRELQTKVGGLTKVAEEQLNA 297

Query: 343 IKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAYGSHL 402
            +TVQ++  E +E+ RY   VR VF+VG KEA  + +FF +T  +G+ + L +L  G+ +
Sbjct: 298 TRTVQAYCGERREIRRYATEVRNVFDVGLKEALISGSFFGATGFVGNATLLALLLTGTSM 357

Query: 403 VLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIKSTTG 462
           +  G +++G+L++FM+Y  YTGS++F LS+FYSELMKGAGAA R+FEL D KP I  T G
Sbjct: 358 IKGGGISVGELSSFMMYAVYTGSSLFNLSSFYSELMKGAGAAVRVFELNDRKPLIHPTIG 417

Query: 463 KAFKPLNGK-VEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLL 521
           K    L GK + F  V+F+YPTR  +Q+F  ++ +I PG +VCIVGPSG GKST+ASLLL
Sbjct: 418 KDPVSLTGKTIAFNSVNFAYPTRPHHQVFAGMDLSICPGEHVCIVGPSGGGKSTVASLLL 477

Query: 522 RYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYG----VSRQPS 577
           R+Y+P SG I + G+DI   +    RR +G+VQQEP+L + +I ENITY     +++ P+
Sbjct: 478 RFYDPISGSITIGGEDIRLFNLSKYRRMMGIVQQEPVLFNASILENITYALPLHLTKDPA 537

Query: 578 MEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDE 637
              I    +   C AF+  FP G +T +GPRG  LSGGQKQR+A+ARA L  P ILILDE
Sbjct: 538 --RIDRALRLSNCSAFVGSFPEGLQTAVGPRGTQLSGGQKQRVALARAFLQDPAILILDE 595

Query: 638 ATSALDVESEGAINYTLGRLMKSKELTI-ISIAHRLSTIRRSENVIVLGIDGSVVEMGKF 696
           ATSALD +SE  +  TL  L + +E  I ISIAHR STI+ S  VIVL   G V+E G +
Sbjct: 596 ATSALDSKSEDIVASTL--LQRCQEAKITISIAHRKSTIQHSTRVIVLDKLGHVLETGTY 653

Query: 697 KDLYANHDSALHKLLT 712
           + L  +  S+L  LL+
Sbjct: 654 QQLIGDPGSSLSGLLS 669

>Suva_10.284 Chr10 (500972..503053) [2082 bp, 693 aa] {ON} YLR188W
           (REAL)
          Length = 693

 Score =  528 bits (1361), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 306/628 (48%), Positives = 411/628 (65%), Gaps = 34/628 (5%)

Query: 96  TPDKKTNKPSS--TVSGGLADVKRLFYLARHDWKMLVLAVSLLTVSCTIGMAVPKVIGLV 153
           +PD  T K S   + S G  D+KRLF L+R +   + LA+ L+ +S ++ MAVP VIG +
Sbjct: 67  SPDSPTLKLSDADSKSSGFKDIKRLFVLSRPESGYIGLALLLILISSSVSMAVPSVIGKL 126

Query: 154 LDATKNALXXXXXXXXXXXLEDSK--SLTLDDLPPIVGDIQLYDXXXXXXXXXXXXTMAN 211
           LD   +              +D+K   L+       +G + L               +AN
Sbjct: 127 LDLASDDDDEEDAKET----KDNKLYGLSKRQFFTALGAVFLIG------------AIAN 170

Query: 212 FGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQN 271
             R+++LK+ GERLVARLR+  +K  +  D  F D N+VGDL+SRL +DA IV++S+TQN
Sbjct: 171 ASRIIILKVTGERLVARLRTRTMKAALDQDATFLDTNRVGDLISRLSSDASIVAKSVTQN 230

Query: 272 ISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGN 331
           +SDG +A+I G VG GMM  +S  L  V+ + APPL   A IYG KIR +SR+LQ + G 
Sbjct: 231 VSDGTRAIIQGFVGFGMMSFLSWKLTCVMMVLAPPLGAMALIYGRKIRNLSRQLQTSVGG 290

Query: 332 LTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFS 391
           LTKVAEEQL+  +T+Q++  E  EV RY   VR VF+VG KEA T+  FF ST ++G+ +
Sbjct: 291 LTKVAEEQLNATRTIQAYGGEKNEVRRYAKEVRNVFHVGLKEAVTSGLFFGSTGLVGNAA 350

Query: 392 FLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELL 451
            L +L  G++++  G +T+G+LT+FM+Y  YTGS++FGLS+FYSELMKGAGAA R+FEL 
Sbjct: 351 MLSLLLVGTNMIQSGAMTVGELTSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELN 410

Query: 452 DYKPTIKSTTGK-----AFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIV 506
           D KP I+ T GK     A KP    + F+ VSF+YPTR  +QIFKDLN TI+PG +VC V
Sbjct: 411 DRKPLIRPTIGKDPVSLAHKP----IVFKDVSFTYPTRPKHQIFKDLNITIKPGEHVCAV 466

Query: 507 GPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRE 566
           GPSG GKSTIASLLLRYY+ ++G I    +DI   + +  RR +G VQQEP+L +GTI +
Sbjct: 467 GPSGSGKSTIASLLLRYYDTSAGSIDFGDEDIKNFNLRKYRRLMGYVQQEPLLFNGTILD 526

Query: 567 NITYGVSRQPSMEEIRSVAK---KCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIA 623
           NI Y +  + + +E R VA+   +  C  F++ FP+G +T++G RGA LSGGQKQRIA+A
Sbjct: 527 NILYCIPPEIAEQEDR-VARAIGQANCTKFLANFPDGLQTMVGARGAQLSGGQKQRIALA 585

Query: 624 RALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIV 683
           RA L  P +LILDEATSALD +SE  +   L R +K + LT ISIAHRLSTI+ S  VIV
Sbjct: 586 RAFLLDPAVLILDEATSALDSQSEEVVAKNLQRRVK-RGLTTISIAHRLSTIKHSTRVIV 644

Query: 684 LGIDGSVVEMGKFKDLYANHDSALHKLL 711
           LG  GSVVE G F+DL +   S L+ LL
Sbjct: 645 LGKHGSVVETGSFQDLISIPGSELNALL 672

>Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar to
           Ashbya gossypii AFR683C
          Length = 683

 Score =  526 bits (1356), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 288/607 (47%), Positives = 389/607 (64%), Gaps = 22/607 (3%)

Query: 111 GLADVKRLFYLARHDWKMLVLAVSLLTVSCTIGMAVPKVIGLVLDATKNALXXXXXXXXX 170
           G  +V+RLF LAR + K L  A+ L+ +S  + M +P VIG +LD +K            
Sbjct: 79  GFKNVRRLFQLARPEAKSLAFALLLIVISGAVSMTIPSVIGKLLDISKEK---------- 128

Query: 171 XXLEDSKSLTLDDLPPIVG--DIQLYDXXXXXXXXXXXXTMANFGRVVLLKILGERLVAR 228
              E       +    I G  + Q Y               AN GR+V+LK+ GE+LVAR
Sbjct: 129 ---EAGGDGDEEQETRIYGLTEKQFY---TALGGVFVIGACANVGRIVILKVTGEKLVAR 182

Query: 229 LRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGM 288
           LR+  +K  +  D  F D N+VGDL+SRL +DA IVS+S+TQN SDG +A+I G VG GM
Sbjct: 183 LRTKTMKAALQQDAAFLDYNRVGDLISRLSSDASIVSKSITQNTSDGARAVIQGMVGFGM 242

Query: 289 MFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEEQLSGIKTVQS 348
           M +IS+ L  V+ L APPL++ A +YG +IR ++RELQ   G LTKVAEEQL+  +T+QS
Sbjct: 243 MGYISAQLTGVMLLLAPPLVLMAMVYGRRIRNLTRELQTRVGGLTKVAEEQLNATRTIQS 302

Query: 349 FVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAYGSHLVLQGNL 408
           +  E KE+ RY   VR VF VG +EA T+  FF +T ++G+ + L +L  G+ ++  G +
Sbjct: 303 YCGERKEIRRYAEEVRSVFRVGLREAVTSGAFFGTTGLMGNMALLALLLTGTSMIRSGAI 362

Query: 409 TIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIKSTTGKAFKPL 468
           T+G+L++FM+Y  YTGS++FGLS+FYSELMKGAGAA+R+FEL D  P I  T GK    L
Sbjct: 363 TVGELSSFMMYAVYTGSSLFGLSSFYSELMKGAGAASRVFELNDRVPLIHPTKGKDPISL 422

Query: 469 NGK-VEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPT 527
             K +EF++V FSYP+R  + +F +LN  I PG +VC+VGPSG GKSTI+SLLLR+Y+  
Sbjct: 423 AAKEIEFKNVKFSYPSRSNHTVFTELNLKIIPGEHVCVVGPSGGGKSTISSLLLRFYDVD 482

Query: 528 SGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQ--PSMEEIRSVA 585
           SG I + GQ+I   + +  RR LG+VQQEP+L +G+I++NI Y +          +    
Sbjct: 483 SGVITIGGQNIKDFNLRKYRRSLGIVQQEPLLFNGSIKDNICYALPPHIISDKHRVNRAL 542

Query: 586 KKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVE 645
           +   C  FIS FP+G +T++GPRG  LSGGQKQRIAIARA +  P ILILDEATSALD +
Sbjct: 543 EAANCTRFISNFPDGLDTMVGPRGTQLSGGQKQRIAIARAFILDPSILILDEATSALDSQ 602

Query: 646 SEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDS 705
           SE  I   L    +S ++T ISIAHR+STI  S  VIVL  +G V E G F DL    +S
Sbjct: 603 SEDIIAQALRARSESGKIT-ISIAHRISTIEHSNRVIVLSRNGGVSETGAFCDLINQPNS 661

Query: 706 ALHKLLT 712
            L+KLL+
Sbjct: 662 NLNKLLS 668

>Kwal_33.13308 s33 (166479..168599) [2121 bp, 706 aa] {ON} YLR188W
           (MDL1) - ATP-binding cassette (ABC) transporter family
           member [contig 118] FULL
          Length = 706

 Score =  525 bits (1353), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 300/638 (47%), Positives = 406/638 (63%), Gaps = 27/638 (4%)

Query: 89  HQEGEDKTPDKKTNKPSSTV------SGGLADVKRLFYLARHDWKMLVLAVSLLTVSCTI 142
           H   + +    ++ +PSST+      S    D+KRLF LAR + + +  A++L+ +S ++
Sbjct: 55  HVSRQIRWNHAESRQPSSTLTPEEHNSSSWKDIKRLFQLARPESRSMFFALALIIISSSV 114

Query: 143 GMAVPKVIGLVLDATKN----ALXXXXXXXXXXXLEDSKSLTLDDLPPIVGDIQLYDXXX 198
            M VP VIG ++DA K+    +              D + +    +P   G +       
Sbjct: 115 SMLVPGVIGKLMDAAKDDQQASKLVENDSDAAAPDADGRQIFGLTMPQFYGVL------- 167

Query: 199 XXXXXXXXXTMANFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLG 258
                      AN GR+V+LK+ GE+LVARLR+  +K ++  D  F D NKVGDL+SRL 
Sbjct: 168 --FSVFVVGAAANMGRIVILKVTGEKLVARLRTRTLKASLQQDASFLDNNKVGDLISRLS 225

Query: 259 ADAYIVSRSMTQNISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKI 318
           +DA IVS+S+TQN+SDG ++LI G VG GMM +IS  L  V+ L APPL   A IYG +I
Sbjct: 226 SDASIVSKSLTQNMSDGTRSLIQGFVGFGMMSYISWKLTCVMMLLAPPLAAMALIYGKRI 285

Query: 319 RAISRELQQASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNA 378
           R +SR LQ + G LTK AEEQLS  +T+Q++  E   +H+Y   VRQV+ VG KEA T+ 
Sbjct: 286 RNLSRTLQASVGGLTKAAEEQLSATRTIQAYGGEKHAIHQYAKEVRQVYQVGLKEALTSG 345

Query: 379 TFFSSTNVLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELM 438
            FF  T ++G+ + L +L  G+ ++  G +T+GDL++FM+Y  YTGS++FG+S+FYSELM
Sbjct: 346 AFFGLTGLVGNVAVLALLLTGTSMIRTGAMTLGDLSSFMIYAVYTGSSLFGMSSFYSELM 405

Query: 439 KGAGAATRLFELLDYKPTIKSTTGKAFKPLNGK-VEFQHVSFSYPTRKTNQIFKDLNFTI 497
           KGAGAA R+FEL D +P I  T G     L GK VEFQ+V F+YPTR  + IF++L F I
Sbjct: 406 KGAGAAARVFELNDRRPAIHPTRGIDPVSLAGKPVEFQNVKFAYPTRHQHTIFENLTFRI 465

Query: 498 EPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEP 557
             G +VCIVGPSG GKST+ASLLLR+Y+  +G I + GQ I   + +  RR LGVVQQEP
Sbjct: 466 NAGEHVCIVGPSGGGKSTVASLLLRFYDVDTGAITIGGQSIASFNLRKYRRMLGVVQQEP 525

Query: 558 ILMSGTIRENITYGVSRQPSMEEIRSVAK---KCFCHAFISKFPNGYETIIGPRGALLSG 614
           +L +GTI +NI Y V +    +E R VA+   +  C AF+S FP+G +T++GPRG  LSG
Sbjct: 526 MLFNGTILDNIVYSVPQSLLNDENR-VARAIGQANCSAFLSSFPDGLQTLVGPRGTQLSG 584

Query: 615 GQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTL-GRLMKSKELTIISIAHRLS 673
           GQKQRIA+ARA L  P +LILDEATSALD  SE  +   L  R  + K  T ISIAHR+S
Sbjct: 585 GQKQRIALARAFLLDPDLLILDEATSALDSRSEEVVARALYSRSTRGK--TTISIAHRVS 642

Query: 674 TIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLL 711
           TI+ S  VIVLG  G VVE G F +L ++ DS L+ LL
Sbjct: 643 TIQHSSRVIVLGRSGYVVETGTFDELISDPDSQLNLLL 680

>TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1.67
           YLR188W
          Length = 707

 Score =  507 bits (1305), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 271/613 (44%), Positives = 396/613 (64%), Gaps = 25/613 (4%)

Query: 114 DVKRLFYLARHDWKMLVLAVSLLTVSCTIGMAVPKVIGLVLDAT----------KNALXX 163
           D+  LF LA+ +   ++ ++ L+ ++  + M VP VIG +LD +          +N    
Sbjct: 98  DIYNLFKLAKPEKWYIIASMGLIFITSAVSMLVPSVIGKLLDISTGIEFASNKDENDESS 157

Query: 164 XXXXXXXXXLEDSKSLTLDDLPPIVGDIQLYDXXXXXXXXXXXXTMANFGRVVLLKILGE 223
                      ++K   +    P+V                    +AN GR+++LK+ GE
Sbjct: 158 KEDKNENENENENKQTLIYGYTPLV-------FFSGLGVIFVVGAIANTGRIIILKLTGE 210

Query: 224 RLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGG 283
           R+VARLR+  +K  +  D +F D NKVGDL+SRL +D+ IVS ++T+N+SDG +A+I G 
Sbjct: 211 RIVARLRTRTMKNILKQDGKFQDSNKVGDLISRLSSDSSIVSNAVTRNVSDGARAVIQGC 270

Query: 284 VGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEEQLSGI 343
           VG+GMM  IS  L+ V+    PP+ V A IYG KIR IS++LQ++ G+LTK++EEQL+G 
Sbjct: 271 VGVGMMSFISLKLSGVMLFMVPPIGVLAMIYGRKIRNISKKLQESVGSLTKISEEQLNGT 330

Query: 344 KTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAYGSHLV 403
           +T+QS+V E  E+H+Y   VR+V++VG  EA  +  FF  T ++G+ + L +L  G +++
Sbjct: 331 RTIQSYVGEKLEIHKYAKEVRKVYHVGLNEAVASGLFFGVTGLIGNGAMLSLLYVGCNMI 390

Query: 404 LQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIKSTTGK 463
             G L+IG L++FM+Y  YTGS++FGLS+FYSE+MKG+GAA+R+FE+  Y P I +T  K
Sbjct: 391 SNGTLSIGGLSSFMMYAVYTGSSLFGLSSFYSEIMKGSGAASRIFEINKYVPDINAT--K 448

Query: 464 AFKPLNGK---VEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLL 520
              P++ +   +EF+H+ F+YPTR  + IF+DLN  I PG +VCI+GPSG GKSTI+SLL
Sbjct: 449 GIDPISFQDKPIEFEHIKFAYPTRSGHMIFQDLNIKINPGEHVCIIGPSGSGKSTISSLL 508

Query: 521 LRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPS--M 578
           LRYY+P +G I + G+DI + S +  R+ +GVV QEP+L +GTI ENI Y V  + +   
Sbjct: 509 LRYYDPLAGTISIGGKDIKEYSLRKYRKLMGVVHQEPVLFNGTILENILYNVPEEIANDK 568

Query: 579 EEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEA 638
           E + +  +   C+ F++  P G ET +GPRG  LSGGQKQR+A+ARA L +P +L+LDEA
Sbjct: 569 ERLSNAIESSNCNKFLNTLPLGLETPVGPRGTQLSGGQKQRVALARAFLLEPTLLVLDEA 628

Query: 639 TSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKD 698
           TSALD  SE  +  TL +   +K  T ISIAHR+STI+ S  V+VL   G VVE G +++
Sbjct: 629 TSALDPRSESIVAQTLKQRC-AKGFTTISIAHRVSTIKHSSRVVVLDKVGHVVETGPYEE 687

Query: 699 LYANHDSALHKLL 711
           L    DSAL+KLL
Sbjct: 688 LLGIKDSALNKLL 700

>CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar to
           uniprot|P33310 Saccharomyces cerevisiae YLR188w MDL1 or
           uniprot|P33311 Saccharomyces cerevisiae YPL270w MDL2
          Length = 608

 Score =  491 bits (1265), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 285/629 (45%), Positives = 389/629 (61%), Gaps = 50/629 (7%)

Query: 89  HQEGEDKTPDKKTNKPSSTVSGGLADVKRLFYLARHDWKMLVLAVSLLTVSCTIGMAVPK 148
           H+    KT  KKT             VK+L  LA+ + K +  AV L+ VS  + M++P 
Sbjct: 16  HRNSSTKTDLKKTQT--------WTQVKQLLRLAKPERKYIAGAVGLIAVSSAVSMSLPS 67

Query: 149 VIGLVLD--ATKNALXXXXXXXXXXXLEDSKSLTLDDLPPIVGDIQLYDXXXXXXXXXXX 206
           VIG ++D  +T +A                  LT +     +G + +             
Sbjct: 68  VIGTLIDHASTPDA--------------PIYGLTRNQFLLALGSVFVVG----------- 102

Query: 207 XTMANFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSR 266
             +AN GR+++LKI GE+LVARLR+  +K  +  D  F D+++VGDL+SRL +DA IVS+
Sbjct: 103 -AIANSGRIIILKITGEKLVARLRTKTMKSMLSQDATFLDKHRVGDLISRLSSDASIVSK 161

Query: 267 SMTQNISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQ 326
           S+T N+SDG +A + G VGIGMM +IS  L +V+ +  PPL + A +YG KI+ ISR+LQ
Sbjct: 162 SVTSNLSDGCRATLQGVVGIGMMTYISLKLTTVMTMMVPPLGILAMLYGGKIKKISRQLQ 221

Query: 327 QASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNV 386
              G L+K +EEQL+ +KTVQ++  E KE+ RY+N VR VFN+G KEA  +A FF ST +
Sbjct: 222 DKVGQLSKTSEEQLNSLKTVQAYAGERKELQRYSNEVRSVFNIGVKEAVASALFFGSTGL 281

Query: 387 LGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATR 446
           +G+ + + +L  G+      ++T+G+L++FM+Y  YTGS+VFGL+ FYSELMKG GAA R
Sbjct: 282 IGNIAMIGLLLVGTA---DSSITLGELSSFMMYGVYTGSSVFGLTGFYSELMKGCGAAER 338

Query: 447 LFELLDYKPTIKSTTG----KAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSN 502
           + EL + K  I  T G    K  K L   + F +VSF+Y   K+  +  ++NF I PG +
Sbjct: 339 VLELQNMKTKISPTKGISPPKTLKGL--PITFNNVSFAYSNGKS--VLSEMNFQIHPGEH 394

Query: 503 VCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSG 562
           VC VG SG GKSTI+SLLLRYY   SG I +   DI+  + +  RR LGVVQQEP+L +G
Sbjct: 395 VCFVGGSGCGKSTISSLLLRYYRTGSGNISIGNYDISAFNLRKYRRMLGVVQQEPLLFNG 454

Query: 563 TIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAI 622
           TI +NITYG+    S+ ++    K   C  FI +   G +T++GPRGA LSGGQ+QRIA+
Sbjct: 455 TILDNITYGL-HDKSLTDLNMALKAANCDQFIKESHMGLDTLVGPRGAQLSGGQRQRIAL 513

Query: 623 ARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVI 682
           AR  L  P ILILDEATSALD +SE  IN  L R  ++  +T ISIAHRLSTIR S  VI
Sbjct: 514 ARVFLQNPDILILDEATSALDTKSEDIINKELQRRQEAG-MTTISIAHRLSTIRHSSRVI 572

Query: 683 VLGIDGSVVEMGKFKDLYANHDSALHKLL 711
           V+  DG VVE G F  L +  DS L+KLL
Sbjct: 573 VIE-DGRVVESGSFDQLRSTRDSELNKLL 600

>SAKL0H00968g Chr8 (107767..109869) [2103 bp, 700 aa] {ON} highly
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of
           iron-sulfur (Fe/S) clusters to the cytosol member of the
           ATP-binding cassette (ABC) transporter family
          Length = 700

 Score =  210 bits (534), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 163/519 (31%), Positives = 251/519 (48%), Gaps = 30/519 (5%)

Query: 210 ANFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGAD--------- 260
           A FG V+  +I    + A +  N I+K      +   R  +G  LSR             
Sbjct: 171 ARFGAVLFGEIRNA-VFASVAQNAIRKVSLQTFQHLMRLDLGWHLSRQTGGLTRAMDRGT 229

Query: 261 ---AYIVSRSMTQNISDGFKALICGGVGIGMMFHISSTLASVLF---LFAPPLLVGATIY 314
              +Y++S  +   I   F+  +  G+   + +   ++ A+V F   L         T +
Sbjct: 230 KGISYVLSAMVFHIIPIAFEISVVCGI---LTYQFGTSFAAVTFATMLLYSIFTFKTTAW 286

Query: 315 GNKIRAISRELQQASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEA 374
             + R   R   +A      VA + L   + V+ F  E     +Y+N++    N   K A
Sbjct: 287 RTEFR---RSANRADNKAASVALDSLINFEAVKYFNNERYLADKYHNSLTNYTNSQIKVA 343

Query: 375 FTNATFFSSTNVLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFY 434
            + A   S  N++   +   ++  G   V+ G+L++GDL             +  L + Y
Sbjct: 344 QSLAFLNSGQNLIFTSALTAMMYMGCTGVMSGDLSVGDLVLINQLVFQLSVPLNFLGSVY 403

Query: 435 SELMKGAGAATRLFELLDYKPTIKSTTGKAFKPLN--GKVEFQHVSFSY-PTRKTNQIFK 491
            EL +       LF+L   K  I+++      P +   +++F++V+F Y P RK   I +
Sbjct: 404 RELKQSLIDMESLFKLQKNKVNIQNSKTPLMLPKDKPCEIKFENVTFGYHPDRK---ILE 460

Query: 492 DLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLG 551
           + NFT+  G    IVGPSG GKSTI  L+ R+Y+P  G+IL+DG+DI +L  KSLRR +G
Sbjct: 461 NANFTLPAGWKTAIVGPSGSGKSTILKLVFRFYDPQEGRILIDGKDIRELDLKSLRRAIG 520

Query: 552 VVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGAL 611
           VV Q+  L + TI EN+ +G     + ++IR    K      I   P G ETI+G RG +
Sbjct: 521 VVPQDTPLFNDTIWENVKFG-KITATDDDIRKAIDKAQLAPLIHSLPQGSETIVGERGLM 579

Query: 612 LSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHR 671
           +SGG+KQR+AIAR LL    I+  DEATSALD  +E A+  T+         T I IAHR
Sbjct: 580 ISGGEKQRLAIARVLLKDTPIMFFDEATSALDTHTEQALLRTIKENFAGNSRTSIYIAHR 639

Query: 672 LSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
           L TI  ++ ++VL  +G V E GK  +L +   S   +L
Sbjct: 640 LRTIADADKIVVLE-NGRVKEEGKHAELLSKPTSLYSEL 677

>Smik_13.518 Chr13 complement(850174..852237) [2064 bp, 687 aa] {ON}
           YMR301C (REAL)
          Length = 687

 Score =  207 bits (528), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 169/530 (31%), Positives = 259/530 (48%), Gaps = 46/530 (8%)

Query: 209 MANFGRVVLLKILGERLVARLRSNVIK----KTMHHDMEFYDRNKVGDLLSRLGADAYIV 264
           +A FG V L   L   + AR+  N I+    +T  H M+        DL   L      +
Sbjct: 163 VARFGSV-LFGELRNAVFARVAQNAIRTVSLQTFQHLMKL-------DLGWHLSRQTGGL 214

Query: 265 SRSM---TQNISDGFKALICGGVGIG---------MMFHISSTLASVLF---LFAPPLLV 309
           +R+M   T+ IS    A++   + I          + +   ++ A++ F   L      +
Sbjct: 215 TRAMDRGTKGISQVLTAMVFHIIPISFEISVVCGILTYQFGASFAAITFSTMLLYSMFTI 274

Query: 310 GATIYGNKIRAISRELQQASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQV--- 366
             T +  K R   R+  +A      VA + L   + V+ F  E     +YN+++      
Sbjct: 275 KTTAWRTKFR---RDANKADNKAASVALDSLINFEAVKYFNNEKYLSDKYNSSLISYRDS 331

Query: 367 -FNVGKKEAFTNATFFSSTNVLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGS 425
              V +  AF N    S  N++   +   ++  G   V+ GNLT+GDL            
Sbjct: 332 QIKVSQSLAFLN----SGQNLIFTTALTAMMYMGCTGVIGGNLTVGDLVLINQLVFQLSV 387

Query: 426 AVFGLSTFYSELMKGAGAATRLFELLDYKPTIKSTTGKAFKP--LNGKVEFQHVSFSY-P 482
            +  L + Y +L +       LF+L   +  IK+       P  +   + F++V+F Y P
Sbjct: 388 PLNFLGSVYRDLKQSLIDMETLFKLRRNEVKIKNAERPLMLPEHVPYDITFENVTFGYHP 447

Query: 483 TRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLS 542
            RK   I K+ +FTI  G    IVG SG GKSTI  L+ R+Y+P SG+IL++G+DI +  
Sbjct: 448 DRK---ILKNASFTIPAGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIREYD 504

Query: 543 SKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYE 602
             +LR+ +GVV Q+  L + TI EN+ +G     + EE+ +V +K      I K P G++
Sbjct: 505 INALRKVIGVVPQDTPLFNDTIWENVKFG-RIDATDEEVMTVVEKAQLAPLIKKLPQGFD 563

Query: 603 TIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKE 662
           TI+G RG ++SGG+KQR+AIAR LL   KI+  DEATSALD  +E A+  T+     S  
Sbjct: 564 TIVGERGLMISGGEKQRLAIARVLLKNAKIMFFDEATSALDTHTEQALLRTIRSNFTSGS 623

Query: 663 LTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLLT 712
            T + IAHRL TI  ++ +IVL  +G V E GK  +L A  +S   +L T
Sbjct: 624 RTSVYIAHRLRTIADADKIIVLD-NGRVREEGKHLELLATPNSLYRELWT 672

>KNAG0E01320 Chr5 (261901..263988) [2088 bp, 695 aa] {ON} Anc_5.20
           YMR301C
          Length = 695

 Score =  207 bits (526), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 148/455 (32%), Positives = 229/455 (50%), Gaps = 17/455 (3%)

Query: 261 AYIVSRSMTQNISDGFKALICGGVGIGMMFHISSTLASVLFL---FAPPLLVGATIYGNK 317
           +Y++S  +   I   F+  +  G+   +     +  A + FL         +  T +  +
Sbjct: 216 SYVLSAMVFHIIPISFEISVVCGI---LTHQFGAQFAGITFLTMMLYSIFTIRTTAWRTE 272

Query: 318 IRAISRELQQASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTN 377
            R   R   +A      +A + L   + V+ F  E     +YNNA+    +   K + + 
Sbjct: 273 FR---RSANRADNKGASIALDSLINFEAVKYFNNESYLASKYNNALMTYRDAQIKVSQSL 329

Query: 378 ATFFSSTNVLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSEL 437
           A   S  N++   +   ++  G   +L GNLT+GDL             +  L + Y EL
Sbjct: 330 AFLNSGQNLIFTSALTAMMYMGCTGILGGNLTVGDLVLINQLVFQLSVPLNFLGSVYREL 389

Query: 438 MKGAGAATRLFELLDYKPTIKSTTGKAFKPLNGK---VEFQHVSFSYPTRKTNQIFKDLN 494
            +       LF+L   +  IK+       P +GK   + F++V+F Y   +T  I K+ +
Sbjct: 390 KQSLIDMESLFKLRRNEVVIKNVEQPKMLPADGKPFEIRFENVTFGYEPDRT--ILKNAS 447

Query: 495 FTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQ 554
           F I  G  + IVGPSG GKSTI  L+ R+Y+P  G+IL++G D+ ++   SLR+ +GVV 
Sbjct: 448 FVIAAGKKIAIVGPSGSGKSTILKLVFRFYDPQEGRILINGIDVKEIDLDSLRKVIGVVP 507

Query: 555 QEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSG 614
           Q+  L + TI EN+ +G     + EE+ +  +K      ISK   G +TI+G RG ++SG
Sbjct: 508 QDTPLFNDTIWENVRFG-RIDATDEEVWAAVEKAHLSPLISKLSRGTDTIVGERGLMISG 566

Query: 615 GQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLST 674
           G+KQR+AIAR LL    I+  DEATSALD  +E  +  T+    K+   T I IAHRL T
Sbjct: 567 GEKQRLAIARVLLKNADIMFFDEATSALDTHTEQNLLKTIRANFKTGSKTSIYIAHRLRT 626

Query: 675 IRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHK 709
           I  ++ +IVL  DGSV E G   +L A  D +L+K
Sbjct: 627 IADADKIIVLE-DGSVKEEGTHTELLA-RDHSLYK 659

>Skud_13.475 Chr13 complement(841033..843108) [2076 bp, 691 aa] {ON}
           YMR301C (REAL)
          Length = 691

 Score =  206 bits (525), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 175/568 (30%), Positives = 270/568 (47%), Gaps = 62/568 (10%)

Query: 175 DSKSLTLDD----LPPIVGDIQLYDXXXXXXXXXXXXTMANFGRVVLLKILGERLVARLR 230
           DS ++T DD    LP  +G                   +A FG V L   L   + A++ 
Sbjct: 138 DSMNITWDDPTVALPAAIG------------LTIISYGVARFGSV-LFGELRNAVFAKVA 184

Query: 231 SNVIK----KTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSM---TQNISDGFKALICGG 283
            N I+    +T  H M+        DL   L      ++R+M   T+ IS    A++   
Sbjct: 185 QNAIRTVSLQTFQHLMKL-------DLGWHLSRQTGGLTRAMDRGTKGISQVLTAMVFHI 237

Query: 284 VGIG---------MMFHISSTLASVLF---LFAPPLLVGATIYGNKIRAISRELQQASGN 331
           + I          + +   ++ A++ F   L      +  T +    R   R+  +A   
Sbjct: 238 IPISFEISVVCGILTYQFGASFAAITFSTMLLYSIFTIKTTAWRTHFR---RDANRADNK 294

Query: 332 LTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQV----FNVGKKEAFTNATFFSSTNVL 387
              VA + L   + V+ F  E     +YN+++         V +  AF N    S  N++
Sbjct: 295 AASVALDSLINFEAVKYFNNEKYLSSKYNSSLMNYRDSQIKVSQSLAFLN----SGQNLI 350

Query: 388 GDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRL 447
              +   ++  G   V+ G+LT+GDL             +  L + Y +L +       L
Sbjct: 351 FTTALTAMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRDLKQSLIDMETL 410

Query: 448 FELLDYKPTIKSTTGKAFKP--LNGKVEFQHVSFSY-PTRKTNQIFKDLNFTIEPGSNVC 504
           F+L   +  IKS       P  +  ++ F++V+F Y P RK   I K+ +FTI  G    
Sbjct: 411 FKLRKNEVKIKSVERPLMLPEHVPYEITFENVTFGYHPDRK---ILKNASFTIPAGWKTA 467

Query: 505 IVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTI 564
           IVG SG GKSTI  L+ R+Y+P SG+IL++G+DI +    +LRR +GVV Q+  L + TI
Sbjct: 468 IVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDALRRVIGVVPQDTPLFNDTI 527

Query: 565 RENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIAR 624
            EN+ +G     + EE+++  +K      I K P G+ETI+G RG ++SGG+KQR+AIAR
Sbjct: 528 WENVKFG-RIDATDEEVKTAVQKAQLAPLIKKLPQGFETIVGERGLMISGGEKQRLAIAR 586

Query: 625 ALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVL 684
            LL   +I+  DEATSALD  +E A+  T+     S   T + IAHRL TI  ++ +IVL
Sbjct: 587 VLLKNARIMFFDEATSALDTHTEQALLRTIRSNFPSGSRTSVYIAHRLRTIADADKIIVL 646

Query: 685 GIDGSVVEMGKFKDLYANHDSALHKLLT 712
             +G+V E GK  +L A   S   +L T
Sbjct: 647 D-NGTVKEDGKHIELLATPGSLYRELWT 673

>Suva_13.491 Chr13 complement(849300..851381) [2082 bp, 693 aa] {ON}
           YMR301C (REAL)
          Length = 693

 Score =  206 bits (523), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 174/565 (30%), Positives = 268/565 (47%), Gaps = 56/565 (9%)

Query: 175 DSKSLTLDD----LPPIVG-DIQLYDXXXXXXXXXXXXTMANFGRVVLLKILGERLVARL 229
           DS ++T DD    LP  +G  I  Y               A FG V L   L   + AR+
Sbjct: 140 DSMNITWDDPTIALPAAIGLTILCYGT-------------ARFGSV-LFGELRNAVFARV 185

Query: 230 RSNVIK----KTMHH----DMEFYDRNKVGDLLSRLG----ADAYIVSRSMTQNISDGFK 277
             N I+    +T  H    D+ ++   + G L   +       +Y+++  +   I   F+
Sbjct: 186 AQNAIRTVSLQTFRHLMKLDLGWHLSRQTGGLTRAMDRGTKGISYVLTAMVFHIIPISFE 245

Query: 278 ALICGGVGIGMMFHISSTLASVLF---LFAPPLLVGATIYGNKIRAISRELQQASGNLTK 334
             +  G+   + +   ++ A++ F   L      +  T +    R   R+  +A      
Sbjct: 246 ISVVCGI---LTYQFGASFAAITFSTMLLYSMFTIKTTAWRTNFR---RDANRADNKAAS 299

Query: 335 VAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQV----FNVGKKEAFTNATFFSSTNVLGDF 390
           VA + L   + V+ F  E     +YN ++         V +  AF N    S  N++   
Sbjct: 300 VALDSLINFEAVKYFNNEKYLADKYNGSLINYRDSQIKVSQSLAFLN----SGQNLIFTS 355

Query: 391 SFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFEL 450
           +   ++  G   V+ G+LT+GDL             +  L + Y EL +       LF+L
Sbjct: 356 ALTAMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMEALFKL 415

Query: 451 LDYKPTIKSTTGKAFKP--LNGKVEFQHVSFSY-PTRKTNQIFKDLNFTIEPGSNVCIVG 507
              +  IK+       P  +   + FQ+V+F Y P RK   I K+ +FTI  GS   IVG
Sbjct: 416 RKNEIKIKNAERPLMLPEHVPYDITFQNVTFGYHPDRK---ILKNASFTIPAGSKTAIVG 472

Query: 508 PSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIREN 567
            SG GKSTI  L+ R+Y+P SG+IL++G+DI +    +LR+ +GVV Q+  L + TI EN
Sbjct: 473 SSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDALRKVIGVVPQDTPLFNDTIWEN 532

Query: 568 ITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALL 627
           + +G     + EE+ +V +K      I K P G+ TI+G RG ++SGG+KQR+AIAR LL
Sbjct: 533 VKFG-RIDATDEEVNTVVEKAQLAPLIKKLPQGFNTIVGERGLMISGGEKQRLAIARVLL 591

Query: 628 NKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGID 687
              +I+  DEATSALD  +E A+  T+     S   T + IAHRL TI  ++ +IV   +
Sbjct: 592 KNARIMFFDEATSALDTHTEQALLRTIRSNFPSGSRTSVYIAHRLRTIADADKIIVFD-N 650

Query: 688 GSVVEMGKFKDLYANHDSALHKLLT 712
           G V E GK  +L A   S   +L T
Sbjct: 651 GKVREEGKHLELLATPGSLYRELWT 675

>KLLA0A10131g Chr1 complement(889688..891850) [2163 bp, 720 aa] {ON}
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of iron-
           sulfur (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 720

 Score =  206 bits (523), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 205/724 (28%), Positives = 326/724 (45%), Gaps = 89/724 (12%)

Query: 26  LSITRRFDDRLSLPI----SSIRTLNYAVNRFGEMKGNQRFPSAGIRSFSITLRNRNEAS 81
           LS++ R     S+PI    SS+R  NY         G++   SAG+ S     R  N +S
Sbjct: 17  LSLSHR-----SIPINSRLSSVR--NYISIGCANKTGSRLLRSAGVSSQYKDFRRFNSSS 69

Query: 82  DVGGNGKHQEGEDKTPDKKTNKPSSTVSGG-----LADVKRLFYLARHDW-------KML 129
           +  G  K+     KT  KK   P  + +G      +++++ +  L ++ W       K+ 
Sbjct: 70  NGNGTDKNASVAPKTEVKKIVPPKPSTNGKSKTPTISELRIMKDLFKYIWPSGDNKVKIR 129

Query: 130 VL-AVSLLTVSCTIGMAVPKVIGLVLDATKNALXXXXXXXXXXXLEDSKSLTLDDLPPIV 188
           VL A++LL  +  + + VP      +D                      S+ ++  P + 
Sbjct: 130 VLIALALLIGAKLLNVQVPFFFKQTID----------------------SMNIEWGPDVA 167

Query: 189 GDIQLYDXXXXXXXXXXXXTMANFGRVVLLKILGERLVARLRSNVIKK----TMHH---- 240
             + +                A FG  V+   L   + A++  N I+K    T  H    
Sbjct: 168 TVLPV-----AITMTILSYGAARFG-AVMFGELRNAVFAKVAQNAIRKVSLQTFQHLMKL 221

Query: 241 DMEFYDRNKVGDLLSRLGAD----AYIVSRSMTQNISDGFKALICGGVGIGMMFHISSTL 296
           D+ ++   + G L   +       +Y++S  +   I   F+  +  G+   + +   S+ 
Sbjct: 222 DLGWHLSRQTGGLTRAMDRGTKGISYVLSAMVFHMIPITFEISVVCGI---LTYQFGSSF 278

Query: 297 ASVLF---LFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEEQLSGIKTVQSFVAEG 353
           A++ F   L         T +  + R   R   +A      VA + L   + V+ F  E 
Sbjct: 279 AAMTFVTMLLYSFFTFKTTAWRTEFR---RSANRADNKAASVALDSLINFEAVKYFNNEE 335

Query: 354 KEVHRYNNAVRQV----FNVGKKEAFTNATFFSSTNVLGDFSFLLVLAYGSHLVLQGNLT 409
              ++Y+ ++ +       V +  AF NA      N +   +   ++  G+  V++G LT
Sbjct: 336 YLANKYHQSLSKYRDSQIKVAQSLAFLNA----GQNFIFTSALTAMMYMGASGVMEGALT 391

Query: 410 IGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIKSTTGKAFKP-- 467
           +GDL             +  L + Y EL +       LF+L      IK+T      P  
Sbjct: 392 VGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFKLQKNPILIKNTERPLMLPEH 451

Query: 468 LNGKVEFQHVSFSY-PTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNP 526
           L  +++F++V+F Y P R    I K+  FTI PG    IVGPSG GKSTI  L+ R+Y+P
Sbjct: 452 LPCEIKFENVTFGYQPDR---NILKNATFTIAPGKKTAIVGPSGSGKSTILRLVFRFYDP 508

Query: 527 TSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAK 586
             G+IL+DG+DI +L    LRR +GVV Q+  L + TI EN+ +G     +  EI +  +
Sbjct: 509 QQGRILLDGKDIRELDLDELRRIVGVVPQDTPLFNDTIWENVKFG-RINATDNEIVTAIE 567

Query: 587 KCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVES 646
           K      I K P G ETI+G RG ++SGG+KQR+AIAR LL    I+  DEATSALD  +
Sbjct: 568 KAQLSDLIHKLPKGTETIVGERGLMISGGEKQRLAIARVLLKDTPIMFFDEATSALDTHT 627

Query: 647 EGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSA 706
           E ++  T+         T + IAHRL TI  ++ +IVL  +G+V E G    L AN +S 
Sbjct: 628 EQSLLKTIKENFSDVAKTSVYIAHRLRTIADADKIIVLE-NGAVREEGTHNALLANPNSL 686

Query: 707 LHKL 710
             +L
Sbjct: 687 YSEL 690

>NDAI0I02440 Chr9 complement(556154..558346) [2193 bp, 730 aa] {ON}
           Anc_5.20 YMR301C
          Length = 730

 Score =  204 bits (518), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 162/523 (30%), Positives = 261/523 (49%), Gaps = 32/523 (6%)

Query: 209 MANFGRVVLLKILGERLVARLRSNVIK----KTMHH----DMEFYDRNKVGDLLSRLG-- 258
           +A FG  VL   L   + A++  N I+    +T  H    D+ ++ + + G L   +   
Sbjct: 194 VARFG-AVLFGELRNAVFAKVAQNAIRTVSLETFQHLMKLDLGWHLKRQTGGLTRAMDRG 252

Query: 259 --ADAYIVSRSMTQNISDGFKALICGGVGIGMMFHISSTLASVLF---LFAPPLLVGATI 313
               +Y++S  +   I  GF+  +  G+   + +   ++ A + F   L      +  T 
Sbjct: 253 TKGISYVLSAMLFHIIPIGFEISVVCGI---LTYQFGASFAGITFTTMLLYSIFTIRTTA 309

Query: 314 YGNKIRAISRELQQASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKE 373
           +  + R   R+  +A      VA + L   + V+ F  E    ++Y++++ Q  +   K 
Sbjct: 310 WRTQFR---RDANKADNKGASVALDSLINFEAVKYFNNETYLSNKYHDSLLQYRDSTIKV 366

Query: 374 AFTNATFFSSTNVLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTF 433
           A + A   S  N++   +  +++  G   V++GNLT+GDL             +  L + 
Sbjct: 367 AQSLAFLNSGQNLIFTSALTMMMYLGCTGVIEGNLTVGDLVLINQLVFQLSVPLNFLGSV 426

Query: 434 YSELMKGAGAATRLFELLDYKPTIKST-TGKA---FKPLNG--KVEFQHVSFSYPTRKTN 487
           Y EL +       LF+L      I++  TG A    K  +G  +++F++V+F Y T +  
Sbjct: 427 YRELKQSLIDMESLFQLRKNPIKIQNAKTGPAPIMLKSSDGPFEIKFENVTFGYDTNR-- 484

Query: 488 QIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLR 547
           +I K+ +F I  G    +VGPSG GKSTI  L+ R+Y+P  G++L++G ++ +    SLR
Sbjct: 485 KILKNASFIIPAGLKTAVVGPSGSGKSTILKLVFRFYDPEEGRVLINGINVQRYDIDSLR 544

Query: 548 RQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGP 607
           R +GVV Q+  L + TI EN+ +G     + EEI+ V +K      I K P   +TI+G 
Sbjct: 545 RVMGVVPQDTPLFNDTIWENVKFG-RINANDEEIKQVIEKAQLAPLIEKLPQREKTIVGE 603

Query: 608 RGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIIS 667
           RG ++SGG+KQR+AIAR LL    I+  DEATSALD  +E A+  T+     S   T I 
Sbjct: 604 RGLMISGGEKQRLAIARVLLKDANIMFFDEATSALDTHTEQALLNTIRANFPSGTRTSIY 663

Query: 668 IAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
           IAHRL TI  ++ +IVL  DG V E G   +L A   S    L
Sbjct: 664 IAHRLRTIADADKIIVLE-DGKVKEEGSHNELLATKGSLYSNL 705

>YMR301C Chr13 complement(867555..869627) [2073 bp, 690 aa] {ON}
           ATM1Mitochondrial inner membrane ATP-binding cassette
           (ABC) transporter, exports mitochondrially synthesized
           precursors of iron-sulfur (Fe/S) clusters to the cytosol
          Length = 690

 Score =  203 bits (516), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 167/530 (31%), Positives = 256/530 (48%), Gaps = 46/530 (8%)

Query: 209 MANFGRVVLLKILGERLVARLRSNVIK----KTMHHDMEFYDRNKVGDLLSRLGADAYIV 264
           +A FG V L   L   + A++  N I+    +T  H M+        DL   L      +
Sbjct: 163 VARFGSV-LFGELRNAVFAKVAQNAIRTVSLQTFQHLMKL-------DLGWHLSRQTGGL 214

Query: 265 SRSM---TQNISDGFKALICGGVGIG---------MMFHISSTLASVLF---LFAPPLLV 309
           +R+M   T+ IS    A++   + I          + +   ++ A++ F   L      +
Sbjct: 215 TRAMDRGTKGISQVLTAMVFHIIPISFEISVVCGILTYQFGASFAAITFSTMLLYSIFTI 274

Query: 310 GATIYGNKIRAISRELQQASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQV--- 366
             T +    R   R+  +A      VA + L   + V+ F  E     +YN ++      
Sbjct: 275 KTTAWRTHFR---RDANKADNKAASVALDSLINFEAVKYFNNEKYLADKYNGSLMNYRDS 331

Query: 367 -FNVGKKEAFTNATFFSSTNVLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGS 425
              V +  AF N    S  N++   +   ++  G   V+ GNLT+GDL            
Sbjct: 332 QIKVSQSLAFLN----SGQNLIFTTALTAMMYMGCTGVIGGNLTVGDLVLINQLVFQLSV 387

Query: 426 AVFGLSTFYSELMKGAGAATRLFELLDYKPTIKSTTGKAFKPLN--GKVEFQHVSFSY-P 482
            +  L + Y +L +       LF+L   +  IK+       P N    + F++V+F Y P
Sbjct: 388 PLNFLGSVYRDLKQSLIDMETLFKLRKNEVKIKNAERPLMLPENVPYDITFENVTFGYHP 447

Query: 483 TRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLS 542
            RK   I K+ +FTI  G    IVG SG GKSTI  L+ R+Y+P SG+IL++G+DI +  
Sbjct: 448 DRK---ILKNASFTIPAGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYD 504

Query: 543 SKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYE 602
             +LR+ +GVV Q+  L + TI EN+ +G     + EE+ +V +K      I K P G++
Sbjct: 505 IDALRKVIGVVPQDTPLFNDTIWENVKFG-RIDATDEEVITVVEKAQLAPLIKKLPQGFD 563

Query: 603 TIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKE 662
           TI+G RG ++SGG+KQR+AIAR LL   +I+  DEATSALD  +E A+  T+     S  
Sbjct: 564 TIVGERGLMISGGEKQRLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRDNFTSGS 623

Query: 663 LTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLLT 712
            T + IAHRL TI  ++ +IVL  +G V E GK  +L A   S   +L T
Sbjct: 624 RTSVYIAHRLRTIADADKIIVLD-NGRVREEGKHLELLAMPGSLYRELWT 672

>CAGL0M13739g Chr13 complement(1347781..1349964) [2184 bp, 727 aa]
           {ON} similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301c ATM1
          Length = 727

 Score =  202 bits (514), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 157/520 (30%), Positives = 262/520 (50%), Gaps = 29/520 (5%)

Query: 209 MANFGRVVLLKILGERLVARLRSNVIK----KTMHH----DMEFYDRNKVGDLLSRLGAD 260
           +A FG  VL   L   + AR+  N I+    +T  H    D+ ++   + G L   +   
Sbjct: 191 LARFG-AVLFGELRNAIFARVAQNAIRNVSLQTFEHLMKLDLGWHLSRQTGGLTRAMDRG 249

Query: 261 ----AYIVSRSMTQNISDGFKALICGGVGIGMMFHISSTLASVLF---LFAPPLLVGATI 313
               +Y++S  +   I   F+  +  G+   + +   ++ A + F   L      +  T 
Sbjct: 250 TKGISYVLSAMVFHIIPITFEISVVCGI---LTYQFGASFAGITFTTMLLYSIFTIRTTA 306

Query: 314 YGNKIRAISRELQQASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKE 373
           +  + R   +E  +A      VA + L   + V+ F  E    ++Y+N++ +  +   K 
Sbjct: 307 WRTRFR---KEANKADNKGASVALDSLINFEAVKYFNNESYLANKYHNSLIKYRDSQVKV 363

Query: 374 AFTNATFFSSTNVLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTF 433
           A + A   S  +++   +   ++  G   V+ G+LT+GDL             +  L + 
Sbjct: 364 AQSLAFLNSGQSLIFTTALTGMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSV 423

Query: 434 YSELMKGAGAATRLFELLDYKPTIKSTTG-KAFKPLNG--KVEFQHVSFSYPTRKTNQIF 490
           Y EL +       LF+L   +  I++ +  K+    +G  +++F++V+F Y  ++  +I 
Sbjct: 424 YRELKQSLIDMESLFKLRKNQVKIQNCSQPKSISKSDGPFEIKFENVTFGYDGQR--KIL 481

Query: 491 KDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQL 550
           K+ +FTI  G    I GPSG GKST+  L+ R+Y+P  G++LV+G D+ +     LR+ +
Sbjct: 482 KNASFTIPAGMKTAIAGPSGSGKSTVLKLVFRFYDPEEGRVLVNGVDVREYDIDQLRKAI 541

Query: 551 GVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGA 610
           GVV Q+  L + TI EN+ +G   + S EEI  V  K      I+K P G  TI+G RG 
Sbjct: 542 GVVPQDTPLFNDTIWENVKFG-RIEASDEEITRVIDKAQLSDLIAKLPQGSSTIVGERGL 600

Query: 611 LLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAH 670
           ++SGG+KQR+AIAR LL    I+  DEATSALD  +E ++  T+ R   S E T + IAH
Sbjct: 601 MISGGEKQRLAIARVLLKDADIMFFDEATSALDTHTEQSLLRTIRRNFNSGEKTSVYIAH 660

Query: 671 RLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
           RL TI  ++ +IVL  +G+V E G  ++L A  +S   +L
Sbjct: 661 RLRTIADADKIIVLE-EGTVREEGTHQELLARENSLYKEL 699

>NCAS0D02430 Chr4 (462683..464791) [2109 bp, 702 aa] {ON} Anc_5.20
          Length = 702

 Score =  199 bits (507), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 156/515 (30%), Positives = 256/515 (49%), Gaps = 29/515 (5%)

Query: 209 MANFGRVVLLKILGERLVARLRSNVIK----KTMHH----DMEFYDRNKVGDLLSRLG-- 258
            A FG  VL   +   + A++  N I+    +T  H    D+ ++   + G L   +   
Sbjct: 162 FARFG-AVLFGEVRNAVFAKVAQNAIRTVSLQTFQHLMKLDLGWHLSRQTGGLTRAMDRG 220

Query: 259 --ADAYIVSRSMTQNISDGFKALICGGVGIGMMFHISSTLASVLF---LFAPPLLVGATI 313
               +Y++S  +   +   F+  +  G+   + +   ++ A++ F   +      +  T 
Sbjct: 221 TKGISYVLSAMVFHILPITFEISVVCGI---LTYQFGASFAAITFTTMILYSIFTIRTTA 277

Query: 314 YGNKIRAISRELQQASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKE 373
           +  + R   R+  +A      VA + L   + V+ F  E     +Y+ ++ +  +   K 
Sbjct: 278 WRTQFR---RDANKADNKGASVALDSLINFEAVKYFNNEKYLADKYHTSLIKYRDSQIKV 334

Query: 374 AFTNATFFSSTNVLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTF 433
           + + A   S  N++   +   ++  G   V+ G+LT+GDL             +  L + 
Sbjct: 335 SQSLAYLNSGQNLIFTSALTAMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSV 394

Query: 434 YSELMKGAGAATRLFELLDYKPTIKSTTGK-AFKPLNGKVE--FQHVSFSYPTRKTNQIF 490
           Y EL +       LF+L   +  I++ T     K  +G  E  F++V+F Y +++  +I 
Sbjct: 395 YRELKQSLIDMESLFQLRKNEIKIENGTNPIVLKASDGPFEITFENVTFGYDSKR--KIL 452

Query: 491 KDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQL 550
            + +FTI  G    +VGPSG GKSTI  L+ R+Y+P  G+IL++G D+ +    SLRR +
Sbjct: 453 NNASFTIPGGLKTAVVGPSGSGKSTILKLVFRFYDPEQGRILINGVDVKEYDVDSLRRVM 512

Query: 551 GVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGA 610
           GVV Q+  L + TI EN+ +G     + EE+ +V +K      I K P GYETI+G RG 
Sbjct: 513 GVVPQDTPLFNDTIWENVKFG-RIDATDEEVHTVIEKAQLAPLIKKLPQGYETIVGERGM 571

Query: 611 LLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAH 670
           ++SGG+KQR+AIAR LL   KI+  DEATSALD  +E A+  T+    +S   T + IAH
Sbjct: 572 MISGGEKQRLAIARVLLKNAKIMFFDEATSALDTHTEQALLTTIRANFESGSRTSVYIAH 631

Query: 671 RLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDS 705
           RL TI  ++ +IVL  DG+V E G    L A   S
Sbjct: 632 RLRTIADADKIIVLE-DGAVKEEGTHSGLLATPGS 665

>TBLA0C07000 Chr3 complement(1688965..1691142) [2178 bp, 725 aa]
           {ON} Anc_5.20 YMR301C
          Length = 725

 Score =  200 bits (508), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 146/442 (33%), Positives = 219/442 (49%), Gaps = 22/442 (4%)

Query: 278 ALICGGVGIGMMFHISSTLASVLF---LFAPPLLVGATIYGNKIRAISRELQQASGNLTK 334
           +++CG     + +   ++ A++ F   L         T +  K R   R+  +A      
Sbjct: 264 SVVCGI----LTYQFGASFAAITFTTMLLYSIFTFKTTAWRTKFR---RQANKADNKGAS 316

Query: 335 VAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLL 394
           +A + L   + V+ F  E     +Y+  + Q  +   K A + A   S  N++   +  +
Sbjct: 317 IALDSLINFEAVKYFNNEEYLAQKYHKTLSQYRDSQIKVAQSLAFLNSGQNLIFTSALTV 376

Query: 395 VLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYK 454
           ++  G   ++ GNLT+GDL             +  L + Y EL +       LF+L    
Sbjct: 377 MMYMGCTGIIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMEYLFQLKKNP 436

Query: 455 PTIKST------TGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGP 508
             IK+         K   P+   + F++V+F Y   K  +I K+ +F IE G    IVGP
Sbjct: 437 IIIKNVEKPLMLAEKGHMPMT--IRFENVTFGYD--KQRKILKNASFQIESGQKTAIVGP 492

Query: 509 SGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENI 568
           SG GKSTI  LL R+Y+P  G+ILV+G D  +    SLR+ +GVV Q+  L + TI EN+
Sbjct: 493 SGSGKSTILKLLFRFYDPEEGRILVNGVDAREYDIDSLRKVIGVVPQDTPLFNDTIWENV 552

Query: 569 TYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLN 628
            +G     S +EI  V  K      + K P G ETI+G RG ++SGG+KQR+AIAR LL 
Sbjct: 553 RFG-RIGASDDEITQVINKAQLGPLLVKLPQGRETIVGERGLMISGGEKQRLAIARVLLK 611

Query: 629 KPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDG 688
              I+  DEATSALD  +E A+  T+    K    T + IAHRL TI  ++ +IVL  +G
Sbjct: 612 DADIMFFDEATSALDTHTEQALLKTINENFKKGSRTSVYIAHRLRTIADADKIIVLQ-EG 670

Query: 689 SVVEMGKFKDLYANHDSALHKL 710
           +V E GK  +L A   S   +L
Sbjct: 671 TVREEGKHSELLARSGSLYKEL 692

>KLTH0B09482g Chr2 complement(777282..779366) [2085 bp, 694 aa] {ON}
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of iron-
           sulfur (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 694

 Score =  199 bits (506), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 140/395 (35%), Positives = 205/395 (51%), Gaps = 24/395 (6%)

Query: 327 QASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQV----FNVGKKEAFTNATFFS 382
           +A      VA + L   + V+ F  E    ++Y+N++ Q       V +  AF NA    
Sbjct: 288 KADNKAATVAVDSLINFEAVKYFNNEQFLANKYHNSLAQYRDSQIKVAQSLAFLNA---- 343

Query: 383 STNVLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAG 442
             N +   +   ++  G   V+ G L++GDL             +  L + Y EL +   
Sbjct: 344 GQNFIFTSALTAMMYMGCTGVISGTLSVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLI 403

Query: 443 AATRLFELLDYKPTIKSTTGKAFKPL------NGKVEFQHVSFSY-PTRKTNQIFKDLNF 495
               LF+L   K  I++      KPL        K+ F++VSF Y P R    I K+ +F
Sbjct: 404 DMESLFQLQRNKVKIQNKE----KPLMLSSQRPSKIVFENVSFGYDPDR---MILKNSSF 456

Query: 496 TIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQ 555
           T+  G    IVGPSG GKSTI  L+ R+Y+P  G+ILVDG+D+ +L  +SLRR +GVV Q
Sbjct: 457 TMPAGWKTAIVGPSGSGKSTILKLVFRFYDPQEGRILVDGKDVRELDIESLRRAIGVVPQ 516

Query: 556 EPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGG 615
           +  L + +I EN+ +G     S EEIR   +K    + + + P G +TI+G RG ++SGG
Sbjct: 517 DTPLFNDSIWENVRFG-KISASDEEIRLAVEKAQLESLVDQLPKGRDTIVGERGLMISGG 575

Query: 616 QKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTI 675
           +KQR+AIAR LL    I+  DEATSALD  +E A+  T+     +   T + IAHRL TI
Sbjct: 576 EKQRLAIARVLLKDAPIMFFDEATSALDTHTEQALLRTIKDNFPTGSKTSVYIAHRLRTI 635

Query: 676 RRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
             ++ +IV+   G V E GK  +L A   S   +L
Sbjct: 636 ADADKIIVIQ-QGQVKEEGKHAELLAKPGSLYAEL 669

>YKL209C Chr11 complement(42423..46295) [3873 bp, 1290 aa] {ON}
            STE6Plasma membrane ATP-binding cassette (ABC)
            transporter required for the export of a-factor,
            catalyzes ATP hydrolysis coupled to a-factor transport;
            contains 12 transmembrane domains and two ATP binding
            domains; expressed only in MATa cells
          Length = 1290

 Score =  203 bits (516), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 153/508 (30%), Positives = 250/508 (49%), Gaps = 23/508 (4%)

Query: 211  NFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFY--DRNKVGDLLSRLGADAYIVSRSM 268
            NF +  LL    E  V  LR+ V++K    +M+++  + NK  ++ + +  D   + RS+
Sbjct: 777  NFAKGFLLDCCSEYWVMDLRNEVMEKLTRKNMDWFSGENNKASEISALVLNDLRDL-RSL 835

Query: 269  TQNISDGFKALICGGVGIGMMFHISS--TLASVLFLFAPPLLVGATIYGNKIRAISRELQ 326
                     + +     IG+++ + S   L+ V     P +++ + IYG  ++    + +
Sbjct: 836  VSEFLSAMTSFVTVST-IGLIWALVSGWKLSLVCISMFPLIIIFSAIYGGILQKCETDYK 894

Query: 327  QASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNV 386
             +   L     + ++ IKT++   AE      Y++   ++  +  K A       S TN+
Sbjct: 895  TSVAQLENCLYQIVTNIKTIKCLQAEFHFQLTYHDLKIKMQQIASKRAIATGFGISMTNM 954

Query: 387  LGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATR 446
            +      ++  YG  LV+    T  ++        +T  +   L +   ++ +G  AA+ 
Sbjct: 955  IVMCIQAIIYYYGLKLVMIHEYTSKEMFTTFTLLLFTIMSCTSLVSQIPDISRGQRAASW 1014

Query: 447  LFELLDYKPTI-------KSTTGKAFKPLNGK-----VEFQHVSFSYPTRKTNQIFKDLN 494
            ++ +LD K            T G A    +GK     V  Q+++F+YP+  T  ++K++N
Sbjct: 1015 IYRILDEKHNTLEVENNNARTVGIAGHTYHGKEKKPIVSIQNLTFAYPSAPTAFVYKNMN 1074

Query: 495  FTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQ 554
            F +  G  + I+G SG GKST+  LL + YN   GKI +DG D+   +  SLR+++ VV+
Sbjct: 1075 FDMFCGQTLGIIGESGTGKSTLVLLLTKLYNCEVGKIKIDGTDVNDWNLTSLRKEISVVE 1134

Query: 555  QEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSG 614
            Q+P+L +GTIR+N+TYG+  +    E+    K    H F+   P G +T I     LLSG
Sbjct: 1135 QKPLLFNGTIRDNLTYGLQDEILEIEMYDALKYVGIHDFVISSPQGLDTRIDT--TLLSG 1192

Query: 615  GQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLST 674
            GQ QR+ IARALL K KILILDE TSALD  S   IN  + +      L  + I H    
Sbjct: 1193 GQAQRLCIARALLRKSKILILDECTSALDSVSSSIINEIVKK--GPPALLTMVITHSEQM 1250

Query: 675  IRRSENVIVLGIDGSVVEMGKFKDLYAN 702
            +R   ++ VL  DG VVE G F  LY N
Sbjct: 1251 MRSCNSIAVLK-DGKVVERGNFDTLYNN 1277

 Score =  174 bits (442), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 140/506 (27%), Positives = 235/506 (46%), Gaps = 35/506 (6%)

Query: 221 LGERLVARLRSNVIKKTMHHD-MEFYDRNK--VGDLLSRLGADAYIVSRSMTQNISDGFK 277
           +GER   R+RS +++  +    ME+YD N+  +GD  +++      +  S  +  +  F+
Sbjct: 99  IGERQGFRIRSQILEAYLEEKPMEWYDNNEKLLGDF-TQINRCVEELRSSSAEASAITFQ 157

Query: 278 ALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAE 337
            L+     +G  F+ S +L  ++   +P +   A ++   I   S +    +    ++  
Sbjct: 158 NLVAICALLGTSFYYSWSLTLIILCSSPIITFFAVVFSRMIHVYSEKENSETSKAAQLLT 217

Query: 338 EQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLV-- 395
             ++  + V+ +  +  E  ++   +     +     F  + FF + N  G   FL +  
Sbjct: 218 WSMNAAQLVRLYCTQRLERKKFKEII-----LNCNTFFIKSCFFVAANA-GILRFLTLTM 271

Query: 396 ----LAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELL 451
                 +GS ++ +G L I D+          GS +         L KG  A  ++  LL
Sbjct: 272 FVQGFWFGSAMIKKGKLNINDVITCFHSCIMLGSTLNNTLHQIVVLQKGGVAMEKIMTLL 331

Query: 452 ---DYKPTIKSTTGKAFKPLN---GKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCI 505
                +  +  T    F PL+     + F +VSFSYP+R +  + K+++     G    I
Sbjct: 332 KDGSKRNPLNKTVAHQF-PLDYATSDLTFANVSFSYPSRPSEAVLKNVSLNFSAGQFTFI 390

Query: 506 VGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIR 565
           VG SG GKST+++LLLR+Y+  +G I ++G +I  +  K L   + VV+Q   L + T+R
Sbjct: 391 VGKSGSGKSTLSNLLLRFYDGYNGSISINGHNIQTIDQKLLIENITVVEQRCTLFNDTLR 450

Query: 566 ENITYG---------VSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQ 616
           +NI  G          S   +   I+   +      FI   P+G ET+IG  G  LSGGQ
Sbjct: 451 KNILLGSTDSVRNADCSTNENRHLIKDACQMALLDRFILDLPDGLETLIGTGGVTLSGGQ 510

Query: 617 KQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIR 676
           +QR+AIARA +    IL LDEA SALD+     +   +    K K  T I + H LS I 
Sbjct: 511 QQRVAIARAFIRDTPILFLDEAVSALDIVHRNLLMKAIRHWRKGK--TTIILTHELSQI- 567

Query: 677 RSENVIVLGIDGSVVEMGKFKDLYAN 702
            S++ + L  +G VVE G   +L A+
Sbjct: 568 ESDDYLYLMKEGEVVESGTQSELLAD 593

>Kwal_26.9480 s26 complement(1236178..1238337) [2160 bp, 719 aa]
           {ON} YMR301C (ATM1) - mitochondrial ABC transporter
           protein [contig 73] FULL
          Length = 719

 Score =  198 bits (504), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 135/387 (34%), Positives = 205/387 (52%), Gaps = 8/387 (2%)

Query: 327 QASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNV 386
           +A      VA + L   + V+ F  E    ++Y+ ++ Q  +   K A + A   S  N+
Sbjct: 316 KADNKAASVAVDSLINFEAVKYFNNEQYLANKYHKSLAQYRDSQIKVAQSLAFLNSGQNL 375

Query: 387 LGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATR 446
           +   +   ++  G   V+ G L++GDL             +  L + Y EL +       
Sbjct: 376 IFTSALTAMMYMGCTGVMSGELSVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMES 435

Query: 447 LFELLDYKPTIKSTTGKAFKPLN--GKVEFQHVSFSY-PTRKTNQIFKDLNFTIEPGSNV 503
           LF+L   K +I+++      P N   ++ F++VSF Y P R    I K+ +FTI  GS  
Sbjct: 436 LFQLQRNKVSIQNSKKPLMLPPNVPSEIVFKNVSFGYDPDR---LILKNASFTIPTGSKT 492

Query: 504 CIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGT 563
            IVGPSG GKSTI  L+ R+Y+P  G+IL+DG+D+ +L  +SLRR +GVV Q+  L + +
Sbjct: 493 AIVGPSGSGKSTILKLVFRFYDPIEGRILLDGKDVRELDIESLRRSIGVVPQDTPLFNES 552

Query: 564 IRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIA 623
           I +N+ +G     + +EI     +    A I + P G +TI+G RG ++SGG+KQR+AIA
Sbjct: 553 IWDNVKFG-RIDATDQEIERAIDRAQLRALIRQLPKGRDTIVGERGLMISGGEKQRLAIA 611

Query: 624 RALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIV 683
           R LL    I+  DEATSALD  +E A+  T+     +   T + IAHRL TI  ++ +IV
Sbjct: 612 RVLLKDAPIMFFDEATSALDTHTEQALLRTIKENFTTGSKTSVYIAHRLRTIADADKIIV 671

Query: 684 LGIDGSVVEMGKFKDLYANHDSALHKL 710
           L   G V E GK  +L A   S   +L
Sbjct: 672 LE-HGRVKEEGKHAELLATPKSLYAEL 697

>KAFR0I02580 Chr9 complement(520294..522423) [2130 bp, 709 aa] {ON}
           Anc_5.20 YMR301C
          Length = 709

 Score =  197 bits (500), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 149/461 (32%), Positives = 232/461 (50%), Gaps = 26/461 (5%)

Query: 261 AYIVSRSMTQNISDGFKALICGGVGIGMMFHISSTLASVLF---LFAPPLLVGATIYGNK 317
           +Y++S  +   I   F+  +  G+   +     ++ A + F   L      +  T +  +
Sbjct: 243 SYVLSAMVFHIIPITFEISVVCGI---LTHQFGASFAEITFMTMLLYSIFTIKTTAWRTQ 299

Query: 318 IRAISRELQQASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFN----VGKKE 373
            R   R+  +A      +A + L   + V+ F  E     +YN+A+    N    + K  
Sbjct: 300 FR---RDANKADNKGASIALDSLINFEAVKYFNNENYLSSKYNSALIDYRNSQIKISKSL 356

Query: 374 AFTNATFFSSTNVLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTF 433
           AF N    S  N++   +   ++  G   V+ GNLT+GDL             +  L + 
Sbjct: 357 AFLN----SGQNLIFTTALTGMMYLGCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSV 412

Query: 434 YSELMKGAGAATRLFELLDYKPTIKSTTG-KAFKPLNGKVE--FQHVSFSYPTRKTNQIF 490
           Y EL +       LF+L   +  I +    K     +G  E  F++V+F Y   +  +I 
Sbjct: 413 YRELKQSLIDMESLFKLRKNEVKIHNIENPKIILKEDGPFEITFENVTFGYHADR--KIL 470

Query: 491 KDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQL 550
           K+ +FTI  G    IVGPSG GKSTI  L+ R+Y+P  G+IL++G D+ ++   SLR+ +
Sbjct: 471 KNASFTIPAGWKTAIVGPSGSGKSTILKLVFRFYDPEEGRILINGIDVREIELDSLRKLI 530

Query: 551 GVVQQEPILMSGTIRENITYGVSRQPSME-EIRSVAKKCFCHAFISKFPNGYETIIGPRG 609
           GVV Q+  L + +I EN+ +G  R  +++ EI  V +K    + I K P  YETI+G RG
Sbjct: 531 GVVPQDTPLFNDSIWENVKFG--RIDALDSEIYEVIEKAQLDSLIRKLPQSYETIVGERG 588

Query: 610 ALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIA 669
            ++SGG+KQR+AIAR LL    ++  DEATSALD  +E A+  T+    K+   T I IA
Sbjct: 589 LMISGGEKQRLAIARVLLKDASVMFFDEATSALDTHTEQALLKTIRANFKTGSRTSIYIA 648

Query: 670 HRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
           HRL TI  ++ +IVL  DG+V E G   +L A   S   +L
Sbjct: 649 HRLRTIADADKIIVLE-DGTVREEGTHNELLAKSTSLYKEL 688

>Ecym_5649 Chr5 complement(1310682..1312772) [2091 bp, 696 aa] {ON}
           similar to Ashbya gossypii AGL335W
          Length = 696

 Score =  196 bits (498), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 152/511 (29%), Positives = 244/511 (47%), Gaps = 36/511 (7%)

Query: 210 ANFGRVVLLKI-------LGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLG---- 258
           A FG V+ +++       + +  + ++     +  M  D+ ++ R + G L   +     
Sbjct: 172 ARFGSVLFVELRNAIFSNVAQNAITKVSLQTFQHLMKLDLGWHLRRQTGGLTRAMDRGCK 231

Query: 259 ADAYIVSRSMTQNISDGFKALICGGVGIGMMFHISSTLASVLF---LFAPPLLVGATIYG 315
             +Y++S  +   I   F+     G+   + +   S+ A+V F   L      +  T + 
Sbjct: 232 GISYVLSAMVFHIIPITFEITFVCGI---LTYQFGSSFAAVTFATMLLYSIFTIRTTAWR 288

Query: 316 NKIRAISRELQQASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQV----FNVGK 371
            + R   R+   A      VA + L   + V+ F  E    ++Y+ ++         V +
Sbjct: 289 TQFR---RDANSADNKAASVALDSLINFEAVKYFNNEEYLANKYHKSLLTYRDSQIKVQQ 345

Query: 372 KEAFTNATFFSSTNVLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLS 431
             AF N    S  N++   +   V+      V++G+LT+GDL             +  L 
Sbjct: 346 SLAFLN----SGQNLIFTSALTAVMYMACSGVMEGSLTVGDLVLINQLIFQLSLPLNFLG 401

Query: 432 TFYSELMKGAGAATRLFELLDYKPTIKSTTGKAFKP--LNGKVEFQHVSFSY-PTRKTNQ 488
           + Y EL +       LF L   K TIK+       P  L   + F++V+F Y P RK   
Sbjct: 402 SVYRELKQSLIDMESLFRLQKNKITIKNVLNPQMLPEKLPSDIRFENVTFGYDPERK--- 458

Query: 489 IFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRR 548
           I K+  FTI  G    IVGPSG GKSTI  L+ R+Y P  G+IL+DG+DI ++   SLR+
Sbjct: 459 ILKNATFTIPAGKKTAIVGPSGSGKSTILRLVFRFYEPEQGRILIDGKDIREVDLDSLRK 518

Query: 549 QLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPR 608
            +GVV Q+  L + TI EN+ +G     S ++I +  ++      I   P G  TI+G R
Sbjct: 519 SIGVVPQDTPLFNDTIWENVKFG-RIDASDKDITNAIERAQLTKLIQNLPKGINTIVGER 577

Query: 609 GALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISI 668
           G ++SGG+KQR+AI+R LL    ++  DEATSALD  +E ++  T+    + +  T + I
Sbjct: 578 GLMISGGEKQRLAISRVLLKDCPLMFFDEATSALDTHTEQSLLKTINENFEGQSKTSVYI 637

Query: 669 AHRLSTIRRSENVIVLGIDGSVVEMGKFKDL 699
           AHRL TI  ++ +IVL  +  V E G  K L
Sbjct: 638 AHRLRTIADADKIIVLN-NSRVHEEGDHKTL 667

>TDEL0F00340 Chr6 complement(53876..57649) [3774 bp, 1257 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1257

 Score =  199 bits (505), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 147/498 (29%), Positives = 242/498 (48%), Gaps = 14/498 (2%)

Query: 211  NFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFY--DRNKVGDLLSRLGADAYIVSRSM 268
            NF +  L     E  + +LR+ V+++    +++++  +R+K  ++ + L  D   +    
Sbjct: 750  NFLQYFLFGYCSEYWILQLRNQVMQRISFEELDWFQRERHKASEVSALLLNDLRDLRALA 809

Query: 269  TQNISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQA 328
            +  +       +   VGI     I   L+ V     P +++ + +YG  ++    + + A
Sbjct: 810  SDFLIAVSSFAVVSSVGIIWALIIGWKLSLVCISMFPLIVIFSAVYGMALQRQETQYKSA 869

Query: 329  SGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLG 388
              +L  +  E  +GIKT++    E   + +Y      +  +  + A T     +    L 
Sbjct: 870  VVDLENLLYEVATGIKTIRRLQLETNFLRQYKRLESHMRVIASRRAITTGLGVAVIEALA 929

Query: 389  DFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLF 448
                 ++  Y   LV+ G  T   +   +    +T      L +   ++ +G  AA R+ 
Sbjct: 930  MSIQAILFYYALKLVIDGQYTTKKMFETLTLLLFTIMTCNILISQVPDISRGQRAANRIL 989

Query: 449  ELLDYK-------PTIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGS 501
            ++LD K          K TT  +    +  +  Q+V+F+YP+  +  IF  L   +  G 
Sbjct: 990  QMLDEKLEREKPHQEKKQTTSGSVSESSAVISLQNVTFAYPSAPSIHIFDSLYLELPIGR 1049

Query: 502  NVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMS 561
               +VG SG GKST+ +LL + Y PTSG +LV+ +D+ + + + LRRQ+ VV+Q P + S
Sbjct: 1050 TFALVGQSGSGKSTLVTLLTQLYRPTSGTVLVENKDVNEWNIRDLRRQMSVVEQTPTIFS 1109

Query: 562  GTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIA 621
            GT+REN+ YG+   P   E+  V +    H FISK P G +T I     LLSGGQ QR+ 
Sbjct: 1110 GTVRENLLYGLHHDPLEVEMYDVLRYVGIHDFISKLPLGLDTTIDID--LLSGGQLQRLC 1167

Query: 622  IARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENV 681
            IARA+L +PKILILDE TSALD  S   IN  + R   +  LT ISI H +  ++  + +
Sbjct: 1168 IARAILKRPKILILDECTSALDPFSSHVINNIVRRGCPAP-LT-ISITHNVDMMKACDEI 1225

Query: 682  IVLGIDGSVVEMGKFKDL 699
            I L  +G V   G F  L
Sbjct: 1226 IFLK-NGRVAGTGSFDAL 1242

 Score =  141 bits (356), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 131/508 (25%), Positives = 239/508 (47%), Gaps = 33/508 (6%)

Query: 220 ILGERLVARLRSNVIKKTMHHDMEFYDRNK------------VGDLLSRLGADAYIVSRS 267
           +LGER    +R  ++ K + +  E+YD+ +            V +  +     + +++RS
Sbjct: 84  LLGERCGFGIRRRLLYKYLENPFEWYDKTEDICGNFTQQNRCVEEARASCAEASAVITRS 143

Query: 268 MTQNISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQ 327
           +   I+            IG  F+ S +L  V    AP +++    +  K++  +    +
Sbjct: 144 LVTIIA-----------LIGTSFYASWSLTLVTLCSAPLIIMCGWFFSRKVQRYADLENE 192

Query: 328 ASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVL 387
            +   +++ +  ++  + ++    E +E+  + N V+   N   K    ++   ++   L
Sbjct: 193 QTSKASQLLDWSMTAAQFIRLSGTELREIKSFKNCVQNCTNNFVKMCQYSSINLATLKFL 252

Query: 388 GDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRL 447
               F+    +GS ++ +G + IGD+          GS + G       + KG+ A   +
Sbjct: 253 SLAMFVQAFWFGSTMIRKGKMNIGDVITCFHSCILLGSTISGTLQQLVIIQKGSVAVNIV 312

Query: 448 FELLDYKPT----IKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNV 503
            + L    T    I+      F  L G + FQ+V FSYP+R  + + + ++     G   
Sbjct: 313 SKFLADDKTATTDIRRWQDVPFPELKGDIRFQNVEFSYPSRPDHNVLRSISLNFRAGKTT 372

Query: 504 CIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGT 563
            ++G SG GKS++++LLL++Y   +G I VDG++I  +    L + + VV+Q   + +GT
Sbjct: 373 FLLGKSGSGKSSLSNLLLKFYENYTGVISVDGRNIKHIDQSQLIKNITVVEQRCNVFNGT 432

Query: 564 IRENITYGV---SRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRI 620
           ++ENI  G+     +  + +++ V +      FI    +G  T+IG  G  LSGGQ+Q++
Sbjct: 433 LKENIIIGIDGADEEEILTKLKLVCRISLLENFIHDLSDGLNTLIGSGGISLSGGQQQKV 492

Query: 621 AIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSEN 680
           AIARAL+  P+ILILDE+ SALDV   G I   +      KE T I + H L+ I  S +
Sbjct: 493 AIARALMKDPQILILDESLSALDVLQRGLILRAIR--THRKEKTTIILTHELNQI-GSND 549

Query: 681 VIVLGIDGSVVEMGKFKDLYANHDSALH 708
              L   G  +E G  + L  +  +  H
Sbjct: 550 FCYLIESGQCIEHGLEETLVNDPSTRFH 577

>TDEL0G00430 Chr7 (89431..91521) [2091 bp, 696 aa] {ON} Anc_5.20
           YMR301C
          Length = 696

 Score =  194 bits (493), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 151/519 (29%), Positives = 251/519 (48%), Gaps = 29/519 (5%)

Query: 210 ANFGRVVLLKILGERLVARLRSNVI--------KKTMHHDMEFYDRNKVGDLLSRLGAD- 260
           A FG V L   L   + AR+  N I        K  M  D+ ++   + G L   +    
Sbjct: 160 ARFGSV-LFGELRNAVFARVAQNAIRTVSLETFKHLMKLDLGWHLSRQTGGLTRAMDRGT 218

Query: 261 ---AYIVSRSMTQNISDGFKALICGGVGIGMMFHISSTLASVLF---LFAPPLLVGATIY 314
              +Y++S  +   +   F+  +  G+   + +   ++ A + F   L      +  T +
Sbjct: 219 KGISYVLSAMVFHILPITFEISVVCGI---LTYQFGASFAGITFATMLLYSIFTIKVTAW 275

Query: 315 GNKIRAISRELQQASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEA 374
               R   R+  +A      VA + L   + V+ F  E     +Y+N++ +  +   K A
Sbjct: 276 RTAFR---RDANKADNKAASVALDSLINFEAVKHFNNENYLAGKYHNSLMKYRDSQVKIA 332

Query: 375 FTNATFFSSTNVLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFY 434
            + A   +  N +   +   ++  G   V+ G+LT+GDL             +  L + Y
Sbjct: 333 QSLAFLNAGQNFIFTSALSAMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVY 392

Query: 435 SELMKGAGAATRLFELLDYKPTIKSTTGKAFKPLNG---KVEFQHVSFSYPTRKTNQIFK 491
            EL +       LF L + K  I +       P N    +++F++V+F Y TR+  +I +
Sbjct: 393 RELKQSLIDMEALFNLRNNKIKIHNNDKPLMLPENAGPFEIKFENVTFGYDTRR--KILR 450

Query: 492 DLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLG 551
           + +FTI  G    IVGPSG GKSTI  L+ R+Y+P SG++LV+G+D+ +    S R+ +G
Sbjct: 451 NASFTIPAGVKTAIVGPSGSGKSTILKLVFRFYDPESGRVLVNGKDVREYDLDSFRKVIG 510

Query: 552 VVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGAL 611
           VV Q+  L + TI EN+ +G     + +E+ +  +K      I K P G  TI+G RG +
Sbjct: 511 VVPQDTPLFNDTIWENVKFG-RIDATDDEVTNAIEKAQLAPLIHKLPVGSATIVGERGLM 569

Query: 612 LSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHR 671
           +SGG+KQR+AIAR LL   +I+  DEATSALD  +E ++  T+         T + +AHR
Sbjct: 570 ISGGEKQRLAIARVLLKNSQIMFFDEATSALDTHTEQSLLKTIRENFDRGSRTSVYVAHR 629

Query: 672 LSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
           L TI  ++ ++VL  +G V E G   +L +  +S   +L
Sbjct: 630 LRTIADADKILVLE-EGCVREEGSHTELLSRPNSLYKQL 667

>AGL335W Chr7 (82640..84715) [2076 bp, 691 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YMR301C (ATM1)
          Length = 691

 Score =  193 bits (491), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 152/520 (29%), Positives = 253/520 (48%), Gaps = 42/520 (8%)

Query: 210 ANFGRVVLLKI-------LGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGAD-- 260
           A FG V+ +++       + +  + ++     +  M  D+ ++   + G L   +     
Sbjct: 163 ARFGAVLFVELRNAVFSNVAQSAITKVSLQTFQHLMKLDLGWHLSRQTGGLTRAMDRGCK 222

Query: 261 --AYIVSRSMTQNISDGFK-ALICGGVGIGMMFHISSTLASVLF---LFAPPLLVGATIY 314
             +Y++S  +   I   F+ +++CG     + +   ++ A++ F   L         T +
Sbjct: 223 GISYVLSAMVFHIIPITFEISMVCGI----LTYQFGASFAAITFSTMLLYSIFTFRTTAW 278

Query: 315 GNKIRAISRELQQASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQV----FNVG 370
             + R   R+  +A      VA + L   + V+ F  E     +Y+ ++ +       V 
Sbjct: 279 RTRFR---RDANKADNKAASVALDSLINFEAVKYFNNEKYLADKYHTSLMKYRDSQIKVS 335

Query: 371 KKEAFTNATFFSSTNVLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGL 430
           +  AF N    +  N++   +   ++    + V+QG+LT+GDL             +  L
Sbjct: 336 QSLAFLN----TGQNLIFTTALTAMMYMACNGVMQGSLTVGDLVLINQLVFQLSVPLNFL 391

Query: 431 STFYSELMKGAGAATRLFELLDYKPTIKSTTGKA----FKPLNGKVEFQHVSFSY-PTRK 485
            + Y +L +       LF+L   + TIK++         KPL+  + F++V+F Y P R+
Sbjct: 392 GSVYRDLKQSLIDMESLFKLQKNQVTIKNSPNAQNLPIHKPLD--IRFENVTFGYDPERR 449

Query: 486 TNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKS 545
              I  +++FTI  G    IVGPSG GKSTI  L+ R+Y P  G+ILV G DI  L   S
Sbjct: 450 ---ILNNVSFTIPAGMKTAIVGPSGSGKSTILKLVFRFYEPEQGRILVGGTDIRDLDLLS 506

Query: 546 LRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETII 605
           LR+ +GVV Q+  L + TI EN+ +G +   S +EI    +K      +   P G  T++
Sbjct: 507 LRKAIGVVPQDTPLFNDTIWENVKFG-NISSSDDEILRAIEKAQLTKLLQNLPKGASTVV 565

Query: 606 GPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTI 665
           G RG ++SGG+KQR+AIAR LL    ++  DEATSALD  +E A+ +T+ +   S   T 
Sbjct: 566 GERGLMISGGEKQRLAIARVLLKDAPLMFFDEATSALDTHTEQALLHTIQQNFSSNSKTS 625

Query: 666 ISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDS 705
           + +AHRL TI  ++ +IVL   GSV E G    L A+  S
Sbjct: 626 VYVAHRLRTIADADKIIVLE-QGSVREEGTHSSLLASQGS 664

>Kpol_513.23 s513 complement(65118..67244) [2127 bp, 708 aa] {ON}
           complement(65118..67244) [2127 nt, 709 aa]
          Length = 708

 Score =  193 bits (491), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 139/439 (31%), Positives = 219/439 (49%), Gaps = 17/439 (3%)

Query: 278 ALICGGVGIGMMFHISSTLASVLF---LFAPPLLVGATIYGNKIRAISRELQQASGNLTK 334
           +++CG     + +   ++ A + F   L      +  T +  + R   R   +A      
Sbjct: 257 SMVCGI----LTYQFGASFAGITFTTMLLYAIFTIRTTAWRTEFR---RAANRADNKGAS 309

Query: 335 VAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLL 394
           +A + L   + V+ F  E    ++Y +++    N   K A + A   S  N++   +   
Sbjct: 310 IALDSLINFEAVKYFNNEQYLANKYYSSLVDYRNSQVKVAQSLAFLNSGQNLIFTSALTA 369

Query: 395 VLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYK 454
           ++  G   V+ GNLT+GDL             +  L + Y EL +       LF+L   +
Sbjct: 370 IMYLGCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFKLRKNE 429

Query: 455 PTIKSTTGKAFKP---LNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGR 511
             I++       P      +++F++V+F Y   K  +I K+ +FTI  G    +VGPSG 
Sbjct: 430 IKIQNVHRPLMLPNELTPFEIKFENVTFGYD--KERKILKNASFTIPAGWKTAVVGPSGS 487

Query: 512 GKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYG 571
           GKSTI  L+ R+Y+P  G+IL++G DI ++   SLR+ +GVV Q+  L + TI EN+ +G
Sbjct: 488 GKSTILKLVFRFYDPEEGRILLNGTDIKEIDLASLRKVIGVVPQDTPLFNDTIWENVKFG 547

Query: 572 VSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPK 631
              + +  EI    +K      I K P G ETI+G RG ++SGG+KQR+AIAR LL    
Sbjct: 548 -RIEATDNEILQAIEKAQLAPLIKKLPKGRETIVGERGLMISGGEKQRLAIARVLLKNSG 606

Query: 632 ILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVV 691
           I+  DEATSALD  +E ++  T+         T + IAHRL TI  ++ +IVL  DG V 
Sbjct: 607 IMFFDEATSALDTHTEQSLLRTIKENFDGSSRTSVYIAHRLRTIADADKIIVLK-DGQVE 665

Query: 692 EMGKFKDLYANHDSALHKL 710
           E G  + L A  +S   +L
Sbjct: 666 EEGTHRQLIAKKESLYSEL 684

>TPHA0L02270 Chr12 complement(473597..475732) [2136 bp, 711 aa] {ON}
           Anc_5.20 YMR301C
          Length = 711

 Score =  193 bits (490), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 155/520 (29%), Positives = 246/520 (47%), Gaps = 31/520 (5%)

Query: 210 ANFGRVVLLKILGERLVARLRSNVIK----KTMHH----DMEFYDRNKVGDLLSRLG--- 258
           A FG  VL   L   + A++  N IK    +T  H    D+ ++   + G L   +    
Sbjct: 181 ARFG-AVLFGELRNAIFAKVAQNTIKTISLQTFDHLMKLDLGWHLSRQTGGLTRAMDRGT 239

Query: 259 -ADAYIVSRSMTQNISDGFKALICGGVGIGMMFHISSTLASVLF---LFAPPLLVGATIY 314
              +Y+++  +   I   F+  +  G+   + +   ++ A + F   L      +  T +
Sbjct: 240 KGISYVLTAMIFHIIPITFEISVVCGI---LTYQFGASFAGITFTTMLLYGIFTLRTTAW 296

Query: 315 GNKIRAISRELQQASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEA 374
             K R   R+  +A      +A + L   + V+ F  E     +YN +++       K A
Sbjct: 297 RTKFR---RQANKADNKGASIALDSLINFEAVKYFNNEQYLASKYNTSLKSYTEAQVKVA 353

Query: 375 FTNATFFSSTNVLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFY 434
            + A   S  N++   +   ++  G   +L GNL++GDL             +  L + Y
Sbjct: 354 QSLAFLNSGQNLIFTSALTAMMYMGCTGILGGNLSVGDLVLINQLVFQLSVPLNFLGSVY 413

Query: 435 SELMKGAGAATRLFELLDYKPTIKSTTGKAFKPLNG---KVEFQHVSFSY-PTRKTNQIF 490
            +L +       LF+L   +  I +    A   L      +EF++V+F Y P RK   I 
Sbjct: 414 RDLKQSLIDMESLFKLRKNEVKILNNKNPAILSLKDGPFNIEFKNVTFGYDPNRK---IL 470

Query: 491 KDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQL 550
           ++ +F I  G    +VGPSG GKSTI  L+ R+Y+P  G++LV+G D+      SLRR +
Sbjct: 471 RNASFIIPAGVKTAVVGPSGSGKSTILKLVFRFYDPEEGRVLVNGIDVRDYDLDSLRRAI 530

Query: 551 GVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGA 610
           GVV Q+  L + TI EN+ +G     + E+I +  +K      I K P  YETI+G RG 
Sbjct: 531 GVVPQDTPLFNDTIWENVKFG-DVTATDEQILNAVEKAQLGTLIEKLPKKYETIVGERGL 589

Query: 611 LLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAH 670
           ++SGG+KQR+AIAR LL    I+  DEATSALD  +E  +  T+         T + IAH
Sbjct: 590 MISGGEKQRLAIARVLLKNAPIMFFDEATSALDTHTEQELLKTIKNNFDKGSRTSVYIAH 649

Query: 671 RLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
           RL T+  S+ +IVL  +GS+ E G    L +  +S    L
Sbjct: 650 RLRTVADSDKIIVLK-EGSIFEEGTHLGLLSKPNSLYKDL 688

>Kpol_1018.185 s1018 (464370..468200) [3831 bp, 1276 aa] {ON}
            (464370..468200) [3831 nt, 1277 aa]
          Length = 1276

 Score =  196 bits (498), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 144/508 (28%), Positives = 239/508 (47%), Gaps = 24/508 (4%)

Query: 209  MANFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDR--NKVGDLLSRLGADAYIVSR 266
            ++NF +  +L    E  +  LR+  +++     +E++ R  NK  ++ + L  D   +  
Sbjct: 763  VSNFLKTFILGYCSEYWIMDLRNRAMEEIAQKKLEWFSREENKSPEIAALLMNDLRDLRS 822

Query: 267  SMTQNISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQ 326
             ++Q +S     L    VG+         L+ V     P +++ + IYG  ++      +
Sbjct: 823  LVSQFLSVISTFLTVSLVGLIWAIATGWKLSLVCISMFPLIVIFSIIYGTVLKNYETTYK 882

Query: 327  QASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNV 386
                NL  +  E ++G+KT++    +      Y+    ++  + +K A       + T  
Sbjct: 883  TKVANLENLEYEIITGVKTIKCLQLQNHFKKCYHKLKDEMGQIARKRAIVTGLGIAITTA 942

Query: 387  LGDFSFLLVLAYGSHLVLQGNL---TIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGA 443
            +      ++  YG  LV+ G     T+      +L+T  T ++   L +   ++ +G  A
Sbjct: 943  IATTIQSILYYYGLKLVMDGEYSTRTMFQTFTLLLFTVMTCNS---LISQIPDISRGQRA 999

Query: 444  ATRLFELLDYKPTIKSTT-----------GKAFKPLNGKVEFQHVSFSYPTRKTNQIFKD 492
            A+ ++ +++     K  T           G+        V   ++ F+YPT     I+ +
Sbjct: 1000 ASWIYRIIEESEDTKEQTITDGRFDEIHCGEKVDKTQPLVSIHNLEFAYPTALDVNIYDN 1059

Query: 493  LNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGV 552
            L+  +  G  V IVG SG GKST+  LL + Y      I +DG D+ +  +++LRRQ+ V
Sbjct: 1060 LSLDLNVGQTVAIVGESGSGKSTLVYLLTKLYQVADNCIDIDGTDVNEWDNETLRRQISV 1119

Query: 553  VQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALL 612
            V+Q+P+L  GT+REN+ YG+   P   +I  + K    + FI   P G ET +    +L+
Sbjct: 1120 VEQKPVLFPGTVRENLIYGLYFSPLEIDIIDILKYVGVYDFIESLPEGLETSVDT--SLI 1177

Query: 613  SGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRL 672
            SGGQ QR+ IARALL KPKILILDE TSALD  S   IN  + +      L  ISI H  
Sbjct: 1178 SGGQAQRLCIARALLRKPKILILDECTSALDANSSKIINDIVAK--GPPSLLTISITHNE 1235

Query: 673  STIRRSENVIVLGIDGSVVEMGKFKDLY 700
              +R    V VL  DG + E G F  L+
Sbjct: 1236 QMMRSCNTVAVLK-DGKICETGPFNKLF 1262

 Score =  157 bits (398), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 133/496 (26%), Positives = 225/496 (45%), Gaps = 24/496 (4%)

Query: 229 LRSNVIKKTMHHDMEFYDR--NKVGDL------LSRLGADAYIVSRSMTQNISDGFKALI 280
           +R  ++   +   ME+YD+  N  GD       +  L A +   S    QNIS       
Sbjct: 108 VRYRMLNSYLDKSMEWYDKKENLSGDFTQLNRCVEELRASSAEASAITLQNISSMLSL-- 165

Query: 281 CGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEEQL 340
                IG+ F+ S +L  ++    P L++ A I+   I+  +      SG    +    +
Sbjct: 166 -----IGVSFYYSWSLTLIILCGTPLLIILAFIFSRSIQKYAALENTESGLAADLLAWSM 220

Query: 341 SGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAYGS 400
           +  + ++    + KE+  +     +  +   K +   A   S+   L    F+    +G+
Sbjct: 221 NSAQMIKLSCTQLKEIESFEELTLKCNDYFIKLSLYVAANISTLRFLSLAMFVQGFWFGN 280

Query: 401 HLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELL-DYKPTIKS 459
             + +GNL I D+          GS +     +   L KG  A  ++   L D K  I  
Sbjct: 281 TEIRKGNLNISDVITCFSSCLMLGSTLNTTLGYLIFLQKGQVALRKIQSFLNDNKVEIDE 340

Query: 460 TTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASL 519
           +  K        + F+HVSFSYP+R  + +  D++     G    IVG SG GKST+++L
Sbjct: 341 SALKQIDISKADISFRHVSFSYPSRPADDVLNDISIDFLSGKTTFIVGRSGSGKSTLSNL 400

Query: 520 LLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQ---- 575
           LL+ Y+   G I +    I ++  + L + + VV+Q   L + T+  NI  G   +    
Sbjct: 401 LLKLYDEYDGYISIGSTHIREIDQQVLIKNITVVEQRCTLFNDTLVNNILLGSQDEDKSS 460

Query: 576 PSMEEIRSVAKKCFC-HAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILI 634
           P +++    A K  C  + I    NG +TI+G  G  LSGGQ+QR+A+ARA +   ++LI
Sbjct: 461 PVVQKKLKEAIKMACLESVIDSLSNGLDTILGTGGISLSGGQQQRVALARAYMRDTEVLI 520

Query: 635 LDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMG 694
           LDEA SALD+     +   + +  + +  T I + H LS I   + + V+  +G ++E G
Sbjct: 521 LDEAVSALDIVHREQLMSNITKWRQGR--TTIILTHELSQISIQDYLYVVE-EGRIIESG 577

Query: 695 KFKDLYANHDSALHKL 710
               L  + DSA  ++
Sbjct: 578 FQGQLMYDPDSAFCRM 593

>TBLA0B10070 Chr2 (2422767..2426657) [3891 bp, 1296 aa] {ON} Anc_1.527
            YKL209C
          Length = 1296

 Score =  196 bits (497), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 154/521 (29%), Positives = 254/521 (48%), Gaps = 30/521 (5%)

Query: 209  MANFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFY--DRNKVGDLLSRLGADAYIVSR 266
            ++NF +  LL I  E  +  LR   +K+ +   ++++  ++ +  ++ + +  D   +  
Sbjct: 784  ISNFFKGFLLGICSEYWIMDLRDKFMKEILRKKIQWFSDEKYQTAEMSALILNDLRDLRS 843

Query: 267  SMTQNISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQ 326
             +++ +S     ++    G+         LA V     P +++ + IYG  ++    + +
Sbjct: 844  LVSEFMSAMATFIVVSLFGLIWALVTGWKLALVCIAMFPLIIIFSAIYGAVLQKSETDYK 903

Query: 327  QASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNV 386
             +  NL  +  + +S IKT++S   EG   H Y  A  ++ NV  K +       S TN 
Sbjct: 904  SSVANLENIEFDIVSNIKTIKSLQLEGHFYHNYKVAETKLKNVATKRSIYTGLGISITNT 963

Query: 387  LGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATR 446
            +      ++  YG  L++ G  T+  +        +T      L     ++ +G  AA+ 
Sbjct: 964  ITMCIQAILYYYGFKLIMDGEYTVKQMFTTFTLLLFTVMTCNSLVNQIPDMSRGQRAASW 1023

Query: 447  LFELLDYKPTIK------------STTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLN 494
            ++ +L      K            +T    F  L+ K    +++F+Y +  + ++   L 
Sbjct: 1024 VYSILQQSDDTKEVNDPNSIIVDNNTISNDFPILDIK----NLTFAYESTPSIKVLDGLT 1079

Query: 495  FTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQ 554
              + PG  + I G SG GK+T+ SLL+++Y+    +I  +G+DI     +SLR  + +V+
Sbjct: 1080 LKLFPGDKLAIAGESGCGKTTLLSLLVKFYDVDPNQIYFNGKDILNYEFESLRDAIVIVE 1139

Query: 555  QEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSG 614
            Q+P ++SG+IR+N+     R  S  E+  V K      FI   P+G +TII     LLSG
Sbjct: 1140 QKPSVLSGSIRDNLLGNNKRLISDYELYDVLKLTGIFDFIETLPSGIDTIIDT--TLLSG 1197

Query: 615  GQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKEL---TIISIAHR 671
            GQ QRI IARALL KPKILILDE TSALD  S   IN      + SKEL   TIISI H 
Sbjct: 1198 GQAQRICIARALLRKPKILILDECTSALDAMSADIINN-----LVSKELNGVTIISITHS 1252

Query: 672  LSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLLT 712
             S +   +NV VL  +G +VE+G +  L A   S L KLL+
Sbjct: 1253 ESMMTSCQNVAVLK-NGKIVEVGTYDSL-ATSSSHLGKLLS 1291

 Score =  186 bits (471), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 135/507 (26%), Positives = 247/507 (48%), Gaps = 25/507 (4%)

Query: 221 LGERLVARLRSNVIKKTMHHDMEFYDRNKV--GDLLSRLGADAYIVSRSMTQNISDGFKA 278
           +GER   ++R+ ++   +   M +YD N+   GD  ++L      +  S  +  +  F+ 
Sbjct: 106 IGERQGIKVRTKILNNYLTQSMTWYDLNEQLQGDF-TQLHRCVEELRSSSAEASAVTFQN 164

Query: 279 LICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEE 338
            I     I   F+ S +L  ++    P + + +  +   I+  +      +    ++  E
Sbjct: 165 CIAIIALIATSFYYSWSLTLIILCSTPIICIFSICFSIMIQKFANLENNETTVSAQIFTE 224

Query: 339 QLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSS--TNVLGDFSFLLVL 396
            +  I+ ++    + K++ ++  ++ +       + F     + S  T++L   + L+ +
Sbjct: 225 TIQNIQLIKLNNLQLKKLMKFQTSISKC-----NKFFIQMCLYVSLNTSILRTLTLLMFV 279

Query: 397 ---AYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDY 453
               +GS ++ +G+L I ++          GS +         L KG  A  ++ + LD 
Sbjct: 280 QGFWFGSTMIRKGHLKIDEVITCFSSCLLLGSIISNTLHQIVVLQKGEVALQKIVDFLDE 339

Query: 454 KPTIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGK 513
                         +N  + FQ++SF+YP+R    I   +N   +  +   IVG SG GK
Sbjct: 340 ADDPLEINSAPITLINSNISFQNISFAYPSRPNENILNQINLYFQNSATTFIVGKSGSGK 399

Query: 514 STIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGV- 572
           ST+++LLL++Y    G IL+D  +I  L+ K+L   + +V+Q+  L + TIR NI +GV 
Sbjct: 400 STLSNLLLKFYETYKGDILIDNINIKNLNQKNLLDNIMIVEQKCTLFNDTIRNNILFGVS 459

Query: 573 -------SRQPSMEE-IRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIAR 624
                  S +P++ E +++         F+   PNG +T+IG  G  LSGGQ+QR+A+AR
Sbjct: 460 NFTNQYASNRPNLNERLKNACTFALLDHFLIDLPNGIDTVIGTGGITLSGGQQQRVALAR 519

Query: 625 ALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVL 684
           A +  P ILILDEA SALDV     +   + +L +S + TII + H L+ I   + + V+
Sbjct: 520 AYMRDPPILILDEAVSALDVNIRELLMKAI-KLWRSNKTTII-LTHDLTQIDNDDFLYVI 577

Query: 685 GIDGSVVEMGKFKDLYANHDSALHKLL 711
              G ++E GK K+L  + ++  HKL+
Sbjct: 578 K-HGRIIEHGKRKELITDPNTEFHKLV 603

>ZYRO0D07106g Chr4 (616125..618254) [2130 bp, 709 aa] {ON} similar
           to uniprot|P40416 Saccharomyces cerevisiae YMR301C ATM1
           Mitochondrial inner membrane transporter exports
           mitochondrially synthesized precursors of iron- sulfur
           (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 709

 Score =  191 bits (484), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 153/519 (29%), Positives = 244/519 (47%), Gaps = 29/519 (5%)

Query: 210 ANFGRVVLLKILGERLVARLRSNVIK----KTMHH----DMEFYDRNKVGDLLSRLGAD- 260
           A FG  VL   L   + AR+  N I+    +T  H    D+ ++   + G L   +    
Sbjct: 159 ARFG-AVLFGELRNAVFARVGQNAIRNVSMETFRHLMKLDLGWHLSRQTGGLTRAMDRGT 217

Query: 261 ---AYIVSRSMTQNISDGFKALICGGVGIGMMFHISSTLASVLF---LFAPPLLVGATIY 314
              +Y++S  +   I   F+  +  G+   + +   ++ A + F   L         T +
Sbjct: 218 KGISYVLSAMVFHIIPITFEISVVCGI---LTYQFGASFAGITFTTMLLYSIFTFRTTAW 274

Query: 315 GNKIRAISRELQQASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEA 374
             K R   RE  +A      VA + L   + V++F  E     +Y  ++ +  +   + A
Sbjct: 275 RTKFR---REANKADNKAASVALDSLINFEAVKNFNNEKYLAEKYETSLLKYRDSQVRVA 331

Query: 375 FTNATFFSSTNVLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFY 434
            + A   S  N++   +   ++  G   ++ G+LT+GDL             +  L + Y
Sbjct: 332 QSLAFLNSGQNLIFTTALTAMMYMGCTGIIGGSLTVGDLVLINQLVFQLSVPLNFLGSVY 391

Query: 435 SELMKGAGAATRLFELLDYKPTIKSTTGKAFKPLNG---KVEFQHVSFSYPTRKTNQIFK 491
            EL +       LF L +    I + +     P N     + F++V+F Y  R+  +I +
Sbjct: 392 RELKQSLIDMESLFNLRNNPILIDNPSKPKMLPANAGPFDIVFENVTFGYDPRR--KILQ 449

Query: 492 DLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLG 551
           + +F I  G    +VGPSG GKST+  L+ R+Y+P  G+ILV+G DI +    SLRR +G
Sbjct: 450 NASFVIPAGWKTAVVGPSGSGKSTLLKLVFRFYDPQEGRILVNGIDIREYDLDSLRRAIG 509

Query: 552 VVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGAL 611
           VV Q+  L + TI EN+ +G       E  RS+ +K      + + P G  TI+G RG +
Sbjct: 510 VVPQDTPLFNDTIWENVKFGRIDADDQEVTRSI-EKAHLAPLVYRLPGGLNTIVGERGLM 568

Query: 612 LSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHR 671
           +SGG+KQR+AIAR LL    I+  DEATSALD  +E A+  T+         T + IAHR
Sbjct: 569 ISGGEKQRLAIARVLLKNSSIMFFDEATSALDTHTEQALLRTIRANFDRGSKTSVYIAHR 628

Query: 672 LSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
           L TI  ++ +IVL  +G   E G   +L    DS   +L
Sbjct: 629 LRTIADADKIIVLE-EGRPREEGTHHELLQKEDSLYREL 666

>TPHA0O00160 Chr15 complement(16002..19763) [3762 bp, 1253 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1253

 Score =  189 bits (479), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 143/520 (27%), Positives = 246/520 (47%), Gaps = 26/520 (5%)

Query: 211  NFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDR--NKVGDLLSRLGADAYIVSRSM 268
            NF ++ +L    E  +  LR+ +++       E+Y R  NK  ++ +    D   +   +
Sbjct: 739  NFIKIFILGYCSEYWIMDLRNELMQCVSQKRFEWYGRSSNKSSEISALALNDLRDLRTLV 798

Query: 269  TQNISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQA 328
            T+ +S     +    +G+         L+ V     P +++ + IYG  ++      + A
Sbjct: 799  TEFLSTMSTFVTVSMMGLIWAIATGWKLSLVCISMFPLIIIFSMIYGTVLQNYETSYKSA 858

Query: 329  SGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLG 388
              +L  +  E ++ IKT++        +  Y+   +++  + KK         S    + 
Sbjct: 859  VADLENLQYEMITSIKTIKCLRLNDHFLGLYSELEKKMKRIAKKRTIVTGLGLSMLTTIT 918

Query: 389  DFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLF 448
                 ++  YG  LVL G  T   +        +T +    L +   ++ +G  AA+ + 
Sbjct: 919  TCIQSILYYYGLKLVLTGEYTSKTMFQTFTLVLFTVTTCNSLVSQIPDVSRGQRAASWVL 978

Query: 449  ELLDYKPTIKSTTGKAFK-----------PLNGKVEFQHVSFSYPTRKTNQIFKDLNFTI 497
             ++D     K   G+  +           PL   +E ++++F YP      +++DLN  I
Sbjct: 979  RIIDENEYTKEVNGEDCRVETIEHENDSDPL---IEIENLNFHYPNTPGVNVYQDLNLKI 1035

Query: 498  EPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEP 557
              G  + +VG SG GKST+  LL + Y+    +IL++G DI   S   LR ++ VV+Q+P
Sbjct: 1036 NSGETIGLVGQSGSGKSTLMYLLTKLYDVQDNRILINGTDINDWSYDILRAEICVVEQKP 1095

Query: 558  ILMSGTIRENITYGVS-RQPSME-EIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGG 615
             L  GTIRENITYGVS + P  E E++ + +    H F+   P   +T++     LLSGG
Sbjct: 1096 NLFHGTIRENITYGVSEKNPVSETEVQELLQLVDMHEFVEALPKALDTVVDI--GLLSGG 1153

Query: 616  QKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSK---ELTIISIAHRL 672
            Q QR+ I R LL KPK+LILDE TS+LD ++   I   L + + +K   ++  I I H  
Sbjct: 1154 QAQRLCIVRTLLRKPKVLILDECTSSLDAQTT-QIVIALIKDLNTKLGWDILTIVITHNR 1212

Query: 673  STIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLLT 712
              ++    ++VL + G VVE G+F DL+      LH +L+
Sbjct: 1213 QMMQCCSRLVVLDV-GRVVEDGQFDDLH-QPGRILHSILS 1250

 Score =  162 bits (410), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 145/573 (25%), Positives = 256/573 (44%), Gaps = 47/573 (8%)

Query: 221 LGERLVARLRSNVIKKTMHHDMEFYD--RNKVGDL------LSRLGADAYIVSRSMTQNI 272
           LGER   R+RS ++++ +   ME+YD   N  GD       +  L + +   S    QN 
Sbjct: 93  LGERQGFRVRSKLLEEYLEKPMEWYDLKENLAGDFTQLNRCMEELRSGSAEASAVTYQNC 152

Query: 273 SDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNL 332
                ALIC      + F+ S  L  ++   +P ++V A  +   I+  +    + +   
Sbjct: 153 V-AIIALIC------VSFYYSWQLTLIILCTSPFIIVCAACFSRFIQKYASFENKETAAA 205

Query: 333 TKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSF 392
             +    +   +TV+    + KE+ ++   V +       + F   + F++ N+ G   F
Sbjct: 206 ADLLMWTMDSSQTVKLSCTQSKEIKKFETLVSKC-----NDYFIRTSLFTAANI-GILRF 259

Query: 393 LLV------LAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATR 446
           L +        +GS ++ +G L I D+          GS +         + KG  A  +
Sbjct: 260 LTLSMFVQGFWFGSTMIRKGKLNISDVITCFYSCLMLGSILNTTLHHVIFIQKGQVALAK 319

Query: 447 LFELLDYKPTI--KSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVC 504
           + + ++  P +  K+ T       +  +   +++F+YP+R T  + K+++  I+      
Sbjct: 320 IQKFINESPELPSKTLTSSGLVYSHVDISIDNLTFAYPSRPTENVLKNVSLKIKSARTTF 379

Query: 505 IVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTI 564
           IVG SG GKSTI +L++++Y    G I+V  +DI  +    L + + +V+Q   L + T+
Sbjct: 380 IVGKSGSGKSTITNLIMKFYEDYKGNIIVGDKDIRSVPIDELLQNITLVEQRCTLFNDTL 439

Query: 565 RENITYG---VSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIA 621
           + NI  G    S+  +   + S+       + IS  P+G ET +G  G  LSGGQ+QR+A
Sbjct: 440 KNNILLGSKYTSQTINDGLLSSICSLACLDSVISSLPDGIETRLGTDGITLSGGQQQRVA 499

Query: 622 IARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENV 681
           +ARA L    ILILDEA SALD+     +   + ++ ++K  T I + H L+ I  ++N 
Sbjct: 500 LARAFLRDTDILILDEAVSALDIMQREILMRNISKVRQNK--TTIILTHDLNQI--NDND 555

Query: 682 IVLGIDGSVVEMGKFKDLYANHDSALHKLLTXXXXXXXXXXXXYAPPAITQESEPQTEEN 741
            +   + + ++   FK    N ++ L   +              + P I  + E   +  
Sbjct: 556 YIYLFENNEIKENGFKKTLMNDENTLFYNMYNLQRNAAITDSRASSPTIYDKDEVYEK-- 613

Query: 742 GKDD------SGE--DQNSDHEENSQDQNEKRL 766
            KDD      SGE  D    + E S D  E  L
Sbjct: 614 -KDDFVISPISGETFDVMKYYSEESSDDTESIL 645

>KNAG0G00190 Chr7 complement(20457..24284) [3828 bp, 1275 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1275

 Score =  188 bits (478), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 138/514 (26%), Positives = 248/514 (48%), Gaps = 17/514 (3%)

Query: 209  MANFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYD--RNKVGDLLSRLGADAYIVSR 266
               F +  ++    E  +  LR  V++   ++  E++    NK  ++ +    D   +  
Sbjct: 765  FCTFSKTFIMGYCSEYWIMDLRKKVMRTITYNKFEWFQLAENKPSEVSALALNDLRDLRT 824

Query: 267  SMTQNISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQ 326
             +T+ ++     L+    G+         L+ V     P ++V + +YG  ++    + +
Sbjct: 825  LVTEFLATASTFLVVSTCGLIWALVAGWKLSLVSISMFPLIIVFSGVYGAALQKCETDYK 884

Query: 327  QASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNV 386
             A   L     E +  +KT++    +    +RY+   +++ ++G++ +       + T+ 
Sbjct: 885  SAVAQLENCLYEVVVSMKTIRCLQLQTHFQNRYDRRKQRMLSLGRRRSVITGCGIAITHT 944

Query: 387  LGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATR 446
            L      ++  YG  LV+ G  T   +        +T      L     E+ +G  AAT 
Sbjct: 945  LTLCIQAILYYYGIKLVIDGKYTSKKMFEVFTLILFTIMTCTNLINQIPEVTRGQRAATY 1004

Query: 447  LFELLDYKPTIKSTTGKAFKPL--------NGKVEFQHVSFSYPTRKTNQIFKDLNFTIE 498
            ++ +L      +       + L        +  V  + ++F+YP   +  +++ LN  ++
Sbjct: 1005 IYRILKEAAATREHQDMHNRTLPISNTSEKDTMVLVKDLTFAYPATPSKHVYEHLNLNLK 1064

Query: 499  PGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPI 558
              ++V +VG SG GKSTI SLL + Y+     I VDG D+++  + SLR Q+ VV+Q   
Sbjct: 1065 SDTSVALVGESGSGKSTIISLLTKLYDVPEKHIYVDGTDLSEWDTNSLRNQISVVEQSAN 1124

Query: 559  LMSGTIRENITYGVSRQPSME-EIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQK 617
            L++GTIREN+TYG+  + + E ++  + K    + F+S+ PNG +TI+     LLSGGQ 
Sbjct: 1125 LLNGTIRENLTYGLPEEDTTEVDLIGILKLVSIYDFVSRLPNGIDTIVDRD--LLSGGQA 1182

Query: 618  QRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRR 677
            QR+ IARAL+   +ILILDE TSALD  S   I   + + + +    II+I H    +R 
Sbjct: 1183 QRLCIARALVKPHRILILDECTSALDALSTNIIIDIVRKGIPNT--LIIAITHDEHMMRS 1240

Query: 678  SENVIVLGIDGSVVEMGKFKDLYANHDSALHKLL 711
             E+V++L  +G++VE G F +L    DS   K L
Sbjct: 1241 CESVLLLK-NGAIVEQGSFVEL-MQQDSEFKKCL 1272

 Score =  159 bits (401), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 142/513 (27%), Positives = 240/513 (46%), Gaps = 35/513 (6%)

Query: 221 LGERLVARLRSNVIKKTMHHDMEFYDRNK---VGDL--LSRLGADAYIVSRSMTQNISDG 275
           LGE    R+R N++   +     +YD N    +G+   LSR   +   V +S +++ +  
Sbjct: 88  LGEVQGDRIRINMLGSYLSKSWTWYDGNGKRLLGEFTQLSRCIEE---VRQSSSESAAIT 144

Query: 276 FKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKV 335
            ++ +     IG  F+ S +L +++ L + P++    IY  K+     +L+      T  
Sbjct: 145 LQSFVSVLSLIGTSFYYSWSL-TLIILCSTPIITAIAIYFAKLTNKYTDLENKE---TSY 200

Query: 336 AEEQLSGI----KTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFS 391
           A E L+        V+ + A+ +E+ +++ +V +  ++  K    +A   S    L    
Sbjct: 201 AAELLTWSMRFNDMVKFYTAQNEEISKFDTSVTRCNSLFIKACLYSALNSSIIRFLTLCM 260

Query: 392 FLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELL 451
           F+    +G+ ++ +  L I D+          G+ V    +  + + KG  A  +L   L
Sbjct: 261 FVQGFWFGATMIRRNKLDINDVITCFHSCLMLGATVSEAMSQVTVIQKGHVANKKLEGFL 320

Query: 452 DYKPTIKSTTGKAFK-PLNGK---VEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVG 507
           + +   K+    A K P  G    + F ++SF YP R +N   ++++  +E G    I+G
Sbjct: 321 ELEG--KTIMQAALKCPPKGNSLSITFNNISFKYPCRTSNSAVENVSLRLESGKMTFIIG 378

Query: 508 PSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIREN 567
            SG GKST+A LLLR+Y   SG I VD   I  L+ + L   + VV+Q   L + T+R N
Sbjct: 379 KSGSGKSTLAKLLLRFYEEYSGSITVDNISICDLNQEWLLSNITVVEQNCTLFNDTLRNN 438

Query: 568 ITYGVSRQPS---MEEI----RSVAKKC---FCHAFISKFPNGYETIIGPRGALLSGGQK 617
           I  G   Q     ME I    R + K C     +  ++   +G +T+IG  G  LSGGQ+
Sbjct: 439 ILLGSENQSEPARMESIEERERKLRKACNFALLNEMLADLTDGLDTVIGSGGVELSGGQR 498

Query: 618 QRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRR 677
           QR+A+ARA L    I+I DE+ SALDV     +   +    + K  T I + H LS I  
Sbjct: 499 QRVALARAFLRNTPIMIFDESVSALDVAHRKLLMKAIRSWRQGK--TTIVLTHELSQINP 556

Query: 678 SENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
           ++ + ++   G V E G  +DL  +  S   + 
Sbjct: 557 TDFIYIME-HGRVCEYGYQEDLLKSETSYFSRF 588

>NDAI0D01540 Chr4 (369687..373568) [3882 bp, 1293 aa] {ON} Anc_1.527
           YKL209C
          Length = 1293

 Score =  187 bits (474), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 136/504 (26%), Positives = 240/504 (47%), Gaps = 18/504 (3%)

Query: 221 LGERLVARLRSNVIKKTMHHDMEFYDRNK--VGDLLSRLGADAYIVSRSMTQNISDGFKA 278
           LGER    +R  ++ + +   ME+YD +   +GD  +++      +  S  +  +  F+ 
Sbjct: 100 LGERQGFAIRKRLLNEYLVKPMEWYDCHDKLLGDF-TQVNRCVEELRSSSAEASAITFQN 158

Query: 279 LICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEE 338
            +     IG  F+ S +L  ++   AP +++ A ++ + I   +      +G   ++   
Sbjct: 159 FVAMLALIGTSFYYSWSLTLIILCSAPLIILFAILFSHMIHKYTELENSETGKAAQLLNW 218

Query: 339 QLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAY 398
            ++  + V+ +  +  E+H +   V Q  ++  K  F  +   S    L    F+    +
Sbjct: 219 SMNSAQLVKLYCTQAYEIHSFKELVGQCNDLFIKSCFYVSANTSILRFLSLSMFVQGFWF 278

Query: 399 GSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYK---P 455
           G+ +V +G L+I D+          GS +         L KG  A  ++ + + +    P
Sbjct: 279 GAIMVKKGKLSIKDVITCFHSCLMLGSTLNNTLQQIVVLQKGDVALKKILDFISFSQRSP 338

Query: 456 TIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKST 515
           +++     +    NG++ FQ++SF+YPTR    + KD++ T +PG +  I+G SG GKST
Sbjct: 339 SLEPPYEPSVPISNGEISFQNISFAYPTRPHQTVLKDVSITFQPGRSTFIIGKSGSGKST 398

Query: 516 IASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVS-- 573
           +A+LLL++YN   G I +   ++ K++   L   + VV+Q   L + T+R N+  G+S  
Sbjct: 399 LANLLLKFYNDYQGSIKIGNTNVKKINKNWLFENITVVEQRCTLFNDTLRNNLLLGISNS 458

Query: 574 ----RQPSME---EIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARAL 626
                Q  +E    ++   +       I + P+G +TIIG  G  LSGGQ+QR+AIARA 
Sbjct: 459 NQKVEQDDIEISQRLKDACRIAMLEELIRELPDGLDTIIGAGGVSLSGGQQQRVAIARAY 518

Query: 627 LNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGI 686
           +    +LILDEA SALD+     I   +      K  T I + H LS +   + + V   
Sbjct: 519 IKDSSVLILDEAVSALDIIHRELIMKAIKNWRSGK--TTIILTHDLSQLDYDDFLYVFE- 575

Query: 687 DGSVVEMGKFKDLYANHDSALHKL 710
           DG V E G  + L  +  +   KL
Sbjct: 576 DGEVKESGYQQALLQDEKTIFSKL 599

 Score =  174 bits (441), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 141/518 (27%), Positives = 247/518 (47%), Gaps = 23/518 (4%)

Query: 209  MANFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDR--NKVGDLLSRLGADAYIVSR 266
            ++NF +  +L    E  +  LR+  +   M+  ++++ +  NK  +L + L  D   +  
Sbjct: 780  ISNFLKSYILGYCSELWIMDLRNEAMAAIMNKRLDWFSKEENKSSELSALLLNDLRDLRS 839

Query: 267  SMTQNISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQ 326
             +++ +S     ++   VG+         L+ V     P +++ + IYG+ ++      +
Sbjct: 840  LVSEFLSAMTTFIVVSLVGLIWALVSGWKLSLVCISMFPLIILVSGIYGSTLQRYETMYK 899

Query: 327  QASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNV 386
             A   L     E ++ IKT++   A    +  Y      +  +  K +       S TN 
Sbjct: 900  TAVAELENHEYEIMTKIKTIRYLQASKYFIKNYKVLENNLKKIAHKRSIATGFGISITNT 959

Query: 387  LGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATR 446
            +      ++  YG  LV +G  +   +        +T  +   L +   ++ +G  AA+ 
Sbjct: 960  IAVCIQSILYYYGLRLVFKGEYSSKKMFETFTLLLFTIISCTSLVSQIPDISRGQRAASW 1019

Query: 447  LFELLDY----KPTIKSTTGKAFKPLNGK------VEFQHVSFSYPTRKTNQIFKDLNFT 496
            L+ +LD     K ++ S +  A   ++G       +  +++ FSYP+ +T +I+K++   
Sbjct: 1020 LYRILDESDDNKESVDSGSRSADIIISGNTNSVPLISIKNLRFSYPSAQTVEIYKNITLH 1079

Query: 497  IEPGS-NVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQ 555
            +      + IVG SG GKST+  LL + Y   +  I +DG D+ +  +  LR+Q+ VV+Q
Sbjct: 1080 VTSSQKTIGIVGESGSGKSTLMYLLTKLYKTPANSIYIDGTDVNEWDTLKLRKQISVVEQ 1139

Query: 556  EPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGG 615
             P L  GT+R+N+ YG     S  EI  V K    + FI   P G ++ I  +  L+SGG
Sbjct: 1140 NPTLFEGTVRDNLVYGTLNDISEIEIYDVLKYLGIYEFIENLPMGLDSRIDTK--LVSGG 1197

Query: 616  QKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIA--HRLS 673
            Q QR+ IARALL KP ILILDE TSALD  S   IN     L+K+   T+++I   H   
Sbjct: 1198 QAQRLCIARALLRKPTILILDECTSALDAASAHLIN----NLVKNGLPTVLTIVITHSKQ 1253

Query: 674  TIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLL 711
             +    ++ V+  DG + E G F +L  N +S L +++
Sbjct: 1254 MMEACNSLAVIK-DGRLAEQGNFAELMKN-NSELRRII 1289

>SAKL0A10208g Chr1 (894334..898266) [3933 bp, 1310 aa] {ON} similar to
            uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1310

 Score =  186 bits (473), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 147/504 (29%), Positives = 241/504 (47%), Gaps = 27/504 (5%)

Query: 212  FGRVVLLKILGERLVARLRSNVIKKTMHHDMEFY--DRNKVGDLLSRLGADAYIVSRSMT 269
            F +   L    E  +  LR   I+K    D+ ++  D NK  ++ + +  D   +   ++
Sbjct: 808  FLKNFFLGYCSEYWIRDLRMLAIRKITAQDLHWFSLDMNKSSEISALVLNDLRDLRSLVS 867

Query: 270  QNISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQAS 329
            + +S     +I   VGI   F     L+ V     P  ++ +  YG  ++    + +   
Sbjct: 868  EFLSSISTLIIVSSVGIVWAFISGWKLSLVCISLFPIFILFSCFYGGLLQRYETDYKTKV 927

Query: 330  GNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGD 389
              L     E   GI T++    E + + +Y N  +++    KK A T     +++N L  
Sbjct: 928  AELENQLHEIFRGITTIRYLKLEYQFLEKYYNLEKKMRRASKKRAITIGFGVAASNTLTL 987

Query: 390  FSFLLVLAYGSHLVLQGNLT---IGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATR 446
                ++  YG  LV  G+ +   + +    +L+T  T  ++ G      ++ +G  AAT 
Sbjct: 988  AVQAILFYYGIKLVTTGSYSTEKMFETFTLLLFTVMTCVSLIGQ---IPDISRGQRAATY 1044

Query: 447  LFELLDYK-PTIKSTTGK--AFK----PLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEP 499
            +F ++D + P  K    K  ++K    PL   +  +++SFSYP+  +  I+K L   +  
Sbjct: 1045 IFRIIDNQSPAAKDEKKKIASYKFTHDPL---ISVKNLSFSYPSAPSTAIYKGLKLDVFS 1101

Query: 500  GSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPIL 559
            G  + +VG SG GKST+  L+   Y   +G I +DG DI +  +  LR  + VV+Q+P  
Sbjct: 1102 GETIAVVGESGSGKSTLTLLISALYEVPNGSIEIDGIDINRWDTNKLRTIISVVEQKPQF 1161

Query: 560  MSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQR 619
              GT+ EN+ YG+S + +  +++          F+   P G +T I    +L+SGGQ QR
Sbjct: 1162 FDGTVGENLLYGISGRVTQIQVKEALCLAGVQDFVFSLPEGLDTRIDT--SLISGGQAQR 1219

Query: 620  IAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSK--ELTIISIAHRLSTIRR 677
            ++IARA+L KPKIL LDE TSALD  +  AI      L+K     +T I I H    +R 
Sbjct: 1220 LSIARAMLRKPKILFLDECTSALDTSNTHAI----ANLIKKHFCGITTIVITHNEQMMRA 1275

Query: 678  SENVIVLGIDGSVVEMGKFKDLYA 701
             E + VL  +G V E G F DLYA
Sbjct: 1276 CERIAVLQ-NGKVAEDGSFDDLYA 1298

 Score =  134 bits (337), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 130/518 (25%), Positives = 228/518 (44%), Gaps = 44/518 (8%)

Query: 221 LGERLVARLRSNVIKKTMHHDMEFYDRN--------KVGDLLSRLGADAYIVSRSMTQNI 272
           LGE+   R+R  ++   +   + +YD++        ++   +  L +     S    QN+
Sbjct: 104 LGEKQGLRVRRKLLNTYLDKPLTWYDKSEQASGEFTQLNRCVEELRSSCAESSAITFQNV 163

Query: 273 SDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNL 332
              F   I         F+ S +L  V+    P ++V + I    I   +R     S   
Sbjct: 164 VTVFALTITS-------FYYSWSLTLVIMAGVPIIIVFSVILSKLIERFTRLENMESSRA 216

Query: 333 TKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTN--VLGDF 390
            ++        + ++ F  +  E+ ++  +V++       + F   + FSS +  +L  F
Sbjct: 217 AQMVSWSFDAAEMIRLFCTQQFEIEKFELSVKKC-----TKYFIRISLFSSASYAMLRFF 271

Query: 391 SFLLVL---AYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRL 447
           +  + +    +G+ ++ QG LT GD+          G+ +         + KG  A  ++
Sbjct: 272 TLCMFIQGFWFGNKMIRQGVLTTGDVITCFSSCLLLGNTLNNTLQQVITMQKGKVALGKI 331

Query: 448 F-------ELLDYKPTIKS-------TTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDL 493
                   +  D++  I S            F+   G++ F++VSFSYPTR    + K++
Sbjct: 332 LMFTSEENDFPDHRNEIISDAFILNHINANKFR-CGGEISFKNVSFSYPTRPNYHVLKNV 390

Query: 494 NFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVV 553
           +          IVG SG GKSTI  LLL+ Y   +G I VDG DI  + +  L   + +V
Sbjct: 391 SLNFPKNKTTFIVGKSGSGKSTIGKLLLKSYGGYTGAIEVDGIDIQHIKTSWLAENITLV 450

Query: 554 QQEPILMSGTIRENITYGVSRQPSMEE-IRSVAKKCFCHAFISKFPNGYETIIGPRGALL 612
           +Q   L + TI+ NI  G   +   +  +R   +       I   PNG +T++G  G  L
Sbjct: 451 EQSCTLFNDTIKNNILLGCKGKAYGDSLVREACQMALLDRLIFDLPNGLDTVLGSGGVSL 510

Query: 613 SGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRL 672
           SGGQKQR+A+ARA +    ILILDEA S +D+     +   + +  K   +T + + H L
Sbjct: 511 SGGQKQRVALARARVRDSPILILDEAISGMDIIHRDLLVEAIKKWRKG--MTTVIVTHEL 568

Query: 673 STIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
           + I   E+ +    +G + E G   +L  N +S  ++L
Sbjct: 569 TQI-SDEDYLYFMEEGQIRESGFKCNLEKNENSHFNRL 605

>Skud_11.11 Chr11 complement(25896..29783) [3888 bp, 1295 aa] {ON}
            YKL209C (REAL)
          Length = 1295

 Score =  185 bits (469), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 147/515 (28%), Positives = 245/515 (47%), Gaps = 35/515 (6%)

Query: 211  NFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFY--DRNKVGDLLSRLGADAYIVSRSM 268
            NF +  LL    E  +  LR+ +++K    ++ ++  + NK  ++ + +  D   + RS+
Sbjct: 778  NFAKGFLLGYCSEYWIMDLRNEIMEKVTRKNINWFSGENNKAAEISALVMNDLRDL-RSL 836

Query: 269  TQNISDGFKALICGGVGIGMMFHISS--TLASVLFLFAPPLLVGATIYGNKIRAISRELQ 326
                     + I     IG+++ + S   L+ V     P +++ + IYG+ ++    + +
Sbjct: 837  VSEFLSAMTSFITVST-IGLVWALISGWKLSLVCISMFPLIIIFSVIYGSSLQTYETDYK 895

Query: 327  QASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNV 386
             +   L     + ++ IKT++   AE      Y++   ++  +  K A       S TN+
Sbjct: 896  SSVAQLENCLYQIVTSIKTIKCLQAEFHFQLTYHDMKTKMEGIASKRAIATGFGVSMTNM 955

Query: 387  LGDFSFLLVLAYGSHLVLQGNLTIGDLTA---FMLYTEYTGSAVFGLSTFYSELMKGAGA 443
            +      ++  YG  LV+    T   + A    +L+T  + + + G      ++ +G  A
Sbjct: 956  IAMCIQAILYYYGLKLVMVHEYTSKKMFATFTLLLFTIMSCTTLVGQ---IPDISRGQRA 1012

Query: 444  ATRLFELLDYKPT---IKSTTGKAF------------KPLNGKVEFQHVSFSYPTRKTNQ 488
            A+ ++ +LD       I+   G+              KP+   V  Q+++F+YP+     
Sbjct: 1013 ASWIYRILDEAECTLEIEDNNGRVLGISGGTYYGNSNKPI---VSIQNLTFAYPSAPNIS 1069

Query: 489  IFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRR 548
            I+K ++  +  G  V IVG SG GKST+  LL   Y    G I +DG D+   +  SLRR
Sbjct: 1070 IYKRMDLNMFCGQTVGIVGESGSGKSTLVLLLTGLYACKVGCIEIDGTDVNDWNLTSLRR 1129

Query: 549  QLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPR 608
            ++ VV+Q+P L  G+IR+N+TYG   Q    E+    K    + F++  P   +T I   
Sbjct: 1130 EISVVEQKPSLFDGSIRDNLTYGCLGQMPDFELYDALKYVGIYDFVASLPQSLDTRIDTN 1189

Query: 609  GALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISI 668
              LLSGGQ QR+ IARALL K KILILDE TSALD  S   IN  + +      L  + I
Sbjct: 1190 --LLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSRIINDIVKK--GPPALLTMVI 1245

Query: 669  AHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANH 703
             H    +R   +V+V   DG +VE G F  LY +H
Sbjct: 1246 THNEEMMRCCSSVVVFK-DGKIVEEGSFDTLYNDH 1279

 Score =  167 bits (423), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 139/512 (27%), Positives = 238/512 (46%), Gaps = 33/512 (6%)

Query: 221 LGERLVARLRSNVIKKTMHHD-MEFYDRNK--VGDLLSRLGADAYIVSRSMTQNISDGFK 277
           +GER   R+RS +++  +    +E+YD N+  +GD  +++      +  S  +  +  F+
Sbjct: 100 IGERQGFRIRSMLLEAYLKKKPIEWYDANETLLGDF-TQINRCVEELRSSSAEASAITFQ 158

Query: 278 ALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAE 337
            L+     IG  F  S +L  ++   +P + + A  +   I   +++    +G   ++  
Sbjct: 159 NLVAICALIGTSFFYSWSLTLIILCSSPIIALFAVAFCRMIHIYTKKENTETGKAAQLLT 218

Query: 338 EQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLV-- 395
             ++  + V+ +  +  E  ++   V           F  + F+ + N  G   FL +  
Sbjct: 219 WSMNAAQLVRLYCTQPLERKKFEEIVSNC-----NTFFIKSCFYLAANA-GVLRFLTLTM 272

Query: 396 ----LAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELL 451
                 +GS ++ +G L I D+          G+ +         L KG  A  ++  LL
Sbjct: 273 FVQGFWFGSTMIRKGRLNINDVITCFHSCIMLGTTLNNTLHQIVVLQKGEVALEKIMTLL 332

Query: 452 DYKPTIK-STTGKAFKPL----NGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIV 506
           +  P    S T + ++PL     G + F++VSF+YP+R T  I ++       G    IV
Sbjct: 333 ENGPKRNTSNTIELYQPLIDYATGDLVFENVSFAYPSRPTETILQNAGIKFPGGQFTFIV 392

Query: 507 GPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRE 566
           G SG GKSTI++LLL++Y+   G I ++G++I  +  KSL   + VV+Q   L + T++ 
Sbjct: 393 GKSGSGKSTISNLLLKFYDGYDGSISINGRNIQTIPQKSLIENITVVEQRCTLFNNTLKN 452

Query: 567 NITYGVSRQPSMEE---------IRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQK 617
           NI  G +      +         I+   +       I   P+G ETIIG  G  LSGGQ+
Sbjct: 453 NILLGSTGSIRNADSNTIDNNNLIKEACRMALLDRLILDLPDGLETIIGSGGITLSGGQQ 512

Query: 618 QRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRR 677
           QR+AIARA +    IL LDEA SALD+     +   +    K K  T I + H+LS I  
Sbjct: 513 QRVAIARAFIRDTPILFLDEAISALDIVHRNLLMKAIRHWRKGK--TTIILTHQLSQI-E 569

Query: 678 SENVIVLGIDGSVVEMGKFKDLYANHDSALHK 709
           +++ + L  DG V+E G   +L  +  +   K
Sbjct: 570 ADDYLYLMQDGKVIESGIQSELLVDSTTTFSK 601

>ZYRO0G02244g Chr7 (169369..173190) [3822 bp, 1273 aa] {ON} similar to
            uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1273

 Score =  184 bits (468), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 157/519 (30%), Positives = 242/519 (46%), Gaps = 34/519 (6%)

Query: 215  VVLLK--ILG---ERLVARLRSNVIKKTMHHDMEFY--DRNKVGDLLSRLGADAYIVSRS 267
            + LLK  ILG   E  +  LR + ++K  ++ +E+   D NK  +L + L  D   +  S
Sbjct: 764  LTLLKEFILGYHSEIYIRTLRDDAMRKITYNRIEWLTQDNNKPSELSALLMNDLRDLRTS 823

Query: 268  MTQNISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQ 327
             +  IS     +I   VG+         L+ V     P L++ + IYG  ++    E + 
Sbjct: 824  TSNFISFVSSFVIVSSVGLIWAIVTGWKLSLVCISMFPLLVIFSMIYGILLKKYETEYKN 883

Query: 328  ASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVL 387
                L  V  E ++G+KT++    E     ++N   +    +G++ A       + +N L
Sbjct: 884  TIAKLENVQYEVVTGMKTIRCLQIEDHFKAKFNVLKQTAKLMGQRRAIVTGFGVAVSNGL 943

Query: 388  GDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRL 447
                  ++  Y   LV+ G  T   +        +T      L     ++ +G  AA+++
Sbjct: 944  TMSIQGILYYYAIKLVIHGEYTTKKMFETFTLLLFTIMTCNNLVNQIPDIRRGQRAASKI 1003

Query: 448  FELLD--------------YKPTIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDL 493
            + +L+                P +++ TG    P+   + F  +SF+YPT  T +I K L
Sbjct: 1004 YRILEGIDESECFETEGHRIVPIVENPTG----PI---IRFNDLSFAYPTAPTVKILKHL 1056

Query: 494  NFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVV 553
            +  I  G  + IVG SG GKST+ +++ R Y   S  + VD  D+   +   LR Q+ VV
Sbjct: 1057 SMEIYSGDRIAIVGESGCGKSTLVNIITRLYECPSNSLFVDNTDVNDWALPKLREQIAVV 1116

Query: 554  QQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLS 613
            +Q+P L  GTIREN+ YG     +  ++ ++ K    + F +  P G ET I     LLS
Sbjct: 1117 EQKPTLFKGTIRENLVYGSPLGTADVDVFNMLKYVGIYDFFATLPEGLETKID--SGLLS 1174

Query: 614  GGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLS 673
            GGQ QR+ IARALL +PKILILDE TSALD  S   IN  +        +  ISI H   
Sbjct: 1175 GGQNQRLCIARALLQRPKILILDECTSALDTMSSHIINEIIRE--GPPTMLTISITHDEQ 1232

Query: 674  TIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLLT 712
             +R    V VL   G +VEMG  +DL       L KL+T
Sbjct: 1233 MVRACNKVAVLD-QGHIVEMGNREDL-LRQKGQLWKLVT 1269

 Score =  168 bits (425), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 158/587 (26%), Positives = 266/587 (45%), Gaps = 34/587 (5%)

Query: 220 ILGERLVARLRSNVIKKTMHHDMEFYDRNKV--GDLLSRLGADAYIVSRSMTQNISDGFK 277
           +LGER   R+R+ +I   +   M++YD N    GDL ++       +  S  +  +  +K
Sbjct: 88  LLGERQNFRVRTQLIDSYLQKPMKWYDDNDTLTGDL-TQTNRCVEELRSSSAEASALTWK 146

Query: 278 ALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAE 337
            L+         F+ S +L  V    AP +++ A  +   I   S +    +   +++  
Sbjct: 147 NLVTILALTVTSFYYSWSLTLVTMCGAPVIVLCAIFFSRLIHIYSEKENSHTAISSQLLS 206

Query: 338 EQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNV-----LGDFSF 392
             +   + V+    +  EV  +  AV++       + F     ++S N      L    F
Sbjct: 207 WSMEAAQLVRLSCMQLVEVQNFQLAVKKC-----SKNFMKMCLYASANTAILKFLTLTIF 261

Query: 393 LLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLD 452
           +    +GS ++ +  L I D+          G+ + G       L KG      + E L 
Sbjct: 262 VQAFWFGSTMIRKHKLRIEDVITCFQSCVLLGATINGTLHQIVILQKGKVGVINVNEFLK 321

Query: 453 YKPTIKS--TTGKAFKPLNG---KVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVG 507
               +K      + F    G   K+E ++V F+YP+R T    K+++ T+  G    +VG
Sbjct: 322 KDEYLKEDFKNNRRFYLDGGISEKIELRNVQFNYPSRPTVPALKNVSLTLPVGKITYVVG 381

Query: 508 PSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIREN 567
            SG GKS++ +LLL+ Y+  +G I +DG DI  +  KS+ + + +V+Q   L + T+R N
Sbjct: 382 KSGSGKSSLGNLLLKLYDDYNGSISIDGIDIKGIDQKSILKNITLVEQRCTLFNDTLRNN 441

Query: 568 ITYGVSRQPSM---EEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIAR 624
           I +G      +   E +++  +      FI   P G +T+IG  G   SGGQ+QRIAIAR
Sbjct: 442 ILFGSKETDELVRDESLKAACRISLLDNFIYDLPEGLDTLIGTGGITPSGGQQQRIAIAR 501

Query: 625 ALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVL 684
           A +    IL+LDEA SALD+   G +   + R  +S++ TII + H LS I   +++I L
Sbjct: 502 AYMRDTPILVLDEAVSALDIIHRGLLMNAI-RNWRSEKTTII-LTHDLSEI-GPDDMIYL 558

Query: 685 GIDGSVVEMGKFKDLYANHDSALHKLLTXXXXXXXXXXXXYAPPAITQESEPQTEENGKD 744
             DG VVE G+ ++L  N       +++             +   IT    P      K 
Sbjct: 559 LEDGEVVEQGQQRNLLLNQQGRFFNMVSLGAGTDLAD----SSSLITTIEIPG---RFKT 611

Query: 745 DSGEDQNSDHEENSQ--DQNEKRLQEEVIHQVLEDISHDQKTSTLRP 789
            + ED   ++E N+   D++   L  E+    L+D SH QK  +  P
Sbjct: 612 STYEDSLIEYELNTPRIDEDSGSLM-EICSIPLDDFSHRQKDRSKAP 657

>Suva_11.11 Chr11 complement(26032..29904) [3873 bp, 1290 aa] {ON}
            YKL209C (REAL)
          Length = 1290

 Score =  183 bits (464), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 147/521 (28%), Positives = 255/521 (48%), Gaps = 30/521 (5%)

Query: 211  NFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFY--DRNKVGDLLSRLGADAYIVSRSM 268
            NF +  LL    E  +  LR+ ++ K    ++ ++  + NK  ++ + +  D   + RS+
Sbjct: 778  NFAKGFLLGYCSEYWIMDLRNKIMDKLTRKNINWFSGESNKASEITALVLNDLRDL-RSL 836

Query: 269  TQNISDGFKALICGGVGIGMMFHISS--TLASVLFLFAPPLLVGATIYGNKIRAISRELQ 326
                     + +     IG+++ + S   L+ V     P +++ + IYG  ++    + +
Sbjct: 837  VSEFLSAMTSFVTVST-IGLVWALVSGWKLSLVCISMFPLIVIFSAIYGGILQKYETDYK 895

Query: 327  QASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNV 386
             +   L     + ++ IKT++   AE      Y++  +++  +  K A       S TN+
Sbjct: 896  TSVAQLENCLYQIMTSIKTIKCLQAEFHFQLSYHDLKKKMEQIAYKRAIATGFGISVTNM 955

Query: 387  LGDFSFLLVLAYGSHLVLQGNLT---IGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGA 443
            +      ++  YG  LVL    T   + +    +L+T  + +++ G      ++ +G  A
Sbjct: 956  IAMCIQAILYYYGLKLVLVHEYTSKKMFETFTLLLFTIMSCTSLVGQ---IPDISRGQRA 1012

Query: 444  ATRLFELLDYKP---TIKSTTGKAFKPLNGK---------VEFQHVSFSYPTRKTNQIFK 491
            A+ ++ +LD +     I++   +A      +         +  +++SF+YP+     IFK
Sbjct: 1013 ASWIYRILDEEEDTLEIENNDARALDISGAEYYGDRNIPIISIRNLSFAYPSAPNVPIFK 1072

Query: 492  DLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLG 551
             ++  +     + IVG SG GKST+A LL R YN  +  I++DG D+   +  SLR+Q+ 
Sbjct: 1073 HMDLDMFCEQTIGIVGESGSGKSTLALLLTRLYNCEANSIIIDGTDVNDWNLTSLRKQIS 1132

Query: 552  VVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGAL 611
            VV+Q+P    G+IR+N+TYG   +    EI  V K    + F++  P G +T +     L
Sbjct: 1133 VVEQKPSFFDGSIRDNLTYGCLGEMLEVEIYDVLKYVGIYDFVASLPQGLDTRVDTN--L 1190

Query: 612  LSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHR 671
            LSGGQ QR+ IARALL K KILILDE TSALD  S   IN  + R      LT++ I H 
Sbjct: 1191 LSGGQAQRLCIARALLRKSKILILDECTSALDSVSSRIIN-DIVRKGPPGLLTLV-ITHS 1248

Query: 672  LSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLLT 712
               +R   ++ VL   G VVE G F +LY N +  L +++ 
Sbjct: 1249 EQMMRCCNSIAVLK-HGKVVEEGNFDNLY-NKEGELFRIVC 1287

 Score =  149 bits (377), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 135/512 (26%), Positives = 237/512 (46%), Gaps = 33/512 (6%)

Query: 221 LGERLVARLRSNVIKKTMHHD-MEFYDRNK--VGDLLSRLGADAYIVSRSMTQNISDGFK 277
           +GER   R+R+ +++  +    M +YD N+  +GD  +++      +  S  +  +  F+
Sbjct: 100 IGERQGFRVRAQLLEAYLETKPMGWYDANETLLGDF-TQVNRCVEELRSSSAEASAITFQ 158

Query: 278 ALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAE 337
            L+     IG  F+ S +L  ++   +P + + A I+   I   +++    + N  ++  
Sbjct: 159 NLVAICALIGTSFYYSWSLTLIILCSSPVITIFAVIFSRLIHTYTQKENTETSNAAQLFT 218

Query: 338 EQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLV-- 395
             ++  + V+ +  +  E  ++   +     +     F  +  + + N  G   FL +  
Sbjct: 219 WSMNAAQLVRLYCTQPLERQKFQEII-----LSCNTFFIKSCLYVAANA-GILRFLTLTM 272

Query: 396 ----LAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELL 451
                 +GS ++ +G L I D+          GS +         L KG  A  ++  LL
Sbjct: 273 FVQGFWFGSTMIRKGKLNINDVITCFHSCIMLGSTLNSTLHQIVVLQKGEVALQKIMALL 332

Query: 452 DY--KPTIKSTTGKAFKPLN---GKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIV 506
           +   K    +T      PLN     + F++VSF+YP+R +  + +++N     G    IV
Sbjct: 333 ESGSKQNASNTREHLQPPLNFATSDLVFENVSFAYPSRPSETVLQNVNLKFPSGQFTFIV 392

Query: 507 GPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRE 566
           G SG GKSTI++LLL +Y+   G IL++G++   +  K L   + VV+Q   L + T+++
Sbjct: 393 GKSGSGKSTISNLLLNFYDNYDGSILINGRNTQSIQQKLLVSNITVVEQRCTLFNDTLKK 452

Query: 567 NITYGVSRQPSMEE---------IRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQK 617
           NI  G +      +         I+   +       I   P+G ET+IG  G  LSGGQ+
Sbjct: 453 NILLGSTGSIGNADTNTIGNNNLIKDACRMALLDRLILDLPDGLETLIGSGGVSLSGGQQ 512

Query: 618 QRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRR 677
           QR+AIARA +    IL LDEA SALD+     +   +    K K  T I + H LS I  
Sbjct: 513 QRVAIARAFIRDTPILFLDEAVSALDIVHRNLLMKAIRHWRKGK--TTIILTHELSQIES 570

Query: 678 SENVIVLGIDGSVVEMGKFKDLYANHDSALHK 709
            +++ V+  +G VVE G   +L A+  +   K
Sbjct: 571 DDHLYVMQ-EGRVVESGIQSELLADSATTFSK 601

>AFR432W Chr6 (1213211..1217065) [3855 bp, 1284 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKL209C (STE6)
          Length = 1284

 Score =  182 bits (463), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 142/512 (27%), Positives = 239/512 (46%), Gaps = 19/512 (3%)

Query: 211  NFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQ 270
            NF ++ LL  + E+ V +LR N+++  +  D+ +  +NK  ++ +    D   +    + 
Sbjct: 778  NFLQLFLLGFVSEQCVRQLRGNMMQLVLKRDLHWISQNKSSEITALTMNDLRDLRNVTSI 837

Query: 271  NISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASG 330
             +S      +   VG+     I   L  V     P  +   T+YG  ++    + + A  
Sbjct: 838  LLSSLTSLCVLASVGLIWAIVIGWKLTLVCLSLLPLFIGVITLYGMFVQKSEVQYKTAVS 897

Query: 331  NLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDF 390
             L  +  E + G+KT++    E     RY    + +    ++ +    +  + T+ L   
Sbjct: 898  QLENLLSEIVKGVKTIKCLQLEPYFQGRYATMEKYLKKQMRRRSILYGSGLAITSCLVIL 957

Query: 391  SFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFEL 450
               ++  YG  LV+ G      L        +T  +  GL +      +G  A T +F +
Sbjct: 958  LQTILYYYGIRLVVTGEYDSKQLFQTFTLILFTTMSSVGLLSALPSSSRGQRAGTFVFGM 1017

Query: 451  LD--------YKPTIKSTTGKAF--KPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPG 500
            L+        Y   ++      F  +PL   V  + ++F+YP  K  QI+K+ N  I  G
Sbjct: 1018 LEEPLPEPDNYSAVLRKAPTNHFSREPL---VVLRALNFAYPAAKDVQIYKNFNLRINQG 1074

Query: 501  SNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILM 560
            + V IVG SG GKST+  L+   Y      + +DG DI      +LR+ + VV+Q+P   
Sbjct: 1075 TKVAIVGESGSGKSTLFYLICGLYPVKPASLFIDGTDICNWEMSALRKIIAVVEQKPRFF 1134

Query: 561  SGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRI 620
            +GTIREN+ YG+    +  EI  V  +     F+   P G ET +     L+SGGQ QR+
Sbjct: 1135 NGTIRENLVYGLEGTITDNEIYEVLAEVRIINFVRSLPEGLETRVDTN--LVSGGQLQRL 1192

Query: 621  AIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSEN 680
            +I RALL +P +LILDE TSALD  +  AI   +   +   ++T+I I H    ++  + 
Sbjct: 1193 SIVRALLRRPTLLILDECTSALDAANANAIANVVRNSL--HDITVIVITHSKQMMKMCDR 1250

Query: 681  VIVLGIDGSVVEMGKFKDLYANHDSALHKLLT 712
            ++VL  +G+V E G F DL+      LH+++T
Sbjct: 1251 IVVLK-NGAVAEDGSFDDLFRARGE-LHRMVT 1280

 Score =  125 bits (313), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 130/512 (25%), Positives = 232/512 (45%), Gaps = 34/512 (6%)

Query: 220 ILGERLVARLRSNVIKKTMHHDMEFYDR----NKVGDLLSRLGADAYIVSRSMTQNISDG 275
           +LGER   R+R  +++  +   M++YD+    N +  + +R   +A     S  +     
Sbjct: 97  LLGERQSLRIRRELLRSYLAKPMQWYDKIDDINGMYTITNRCVEEA---RASCAEASGVL 153

Query: 276 FKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKV 335
           F++ +   +     F  S+ L  V    AP L +   ++   ++  +    + + + +  
Sbjct: 154 FQSAVTALILAVTAFKFSAKLTVVTLAGAPLLALLTVVFSKFVQKYAALENEQTSSASST 213

Query: 336 AEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTN-----VLGDF 390
               L+    V+ F  +  E+ ++N AV    N+ KK  F      SS N      L   
Sbjct: 214 LSWALNSATMVKLFGTQDLELRKFNKAV----NLSKK-YFVRTLICSSINQAAMRFLSLM 268

Query: 391 SFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFEL 450
            F+    YGS L+ +  +    +      +    S++  + +    L KG  A  ++ E 
Sbjct: 269 MFVQAFWYGSILIQRDEVETAAVITVFSASVLLSSSINAMLSKVVLLQKGKVACRQIAEA 328

Query: 451 LDYKP-------TIKSTTGK--AFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGS 501
           ++ +P             G   A +    ++ F  VSF+YP R   +    ++ T  P  
Sbjct: 329 VNVEPEGRPNQYAFPYEVGHIIALEDQPSEIVFDQVSFNYPARPDTKALDGVSLTFRPNQ 388

Query: 502 NVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMS 561
              IVG SG GKST+ +LLL++Y+   G I V+  ++  +    L + + +V+Q   L +
Sbjct: 389 ITFIVGKSGSGKSTLGNLLLKFYSDYEGIITVNSTNLRGIDRSWLLQNITLVEQSCTLFN 448

Query: 562 GTIRENITYGVSRQPSMEEIRSVAKKC---FCHAFISKFPNGYETIIGPRGALLSGGQKQ 618
           GT+ ENIT  +S +P  +   +V + C        +   P G  T +G  G  +SGGQ+Q
Sbjct: 449 GTLFENIT--LSAKPVNKTAGAVKRACQMALLEKLVFDLPEGLHTKVGSGGISMSGGQQQ 506

Query: 619 RIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRS 678
           R+A+ARA+L    +LILDEA SALD+     +   + R  ++ + TII + H LS +   
Sbjct: 507 RVALARAILRDAPVLILDEAISALDIIHRDLLMEVI-RSWRADKTTII-LTHELSHVLDD 564

Query: 679 ENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
           + + ++   G V+E G   +L +N +S    L
Sbjct: 565 DYLYMME-HGQVIEQGYKSELLSNPNSRFRAL 595

>NCAS0G03510 Chr7 (652949..656815) [3867 bp, 1288 aa] {ON} Anc_1.527
          Length = 1288

 Score =  181 bits (458), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 144/520 (27%), Positives = 248/520 (47%), Gaps = 26/520 (5%)

Query: 209  MANFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFY--DRNKVGDLLSRLGADAYIVSR 266
            ++NF +  +L    E  +  LR+  ++  ++ D+ ++  D NK  +L + L  D   +  
Sbjct: 773  VSNFLKAYILGYCSENWIMDLRNEAMESILNKDLFWFSKDTNKSSELSALLLNDLRDLRS 832

Query: 267  SMTQNISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQ 326
             +++ +S     ++   +G+         L+ V     P ++  + +YG  ++      +
Sbjct: 833  LVSEFLSAMTTFMVVSLIGLIWALVSGWKLSLVCLSMFPLIIAFSAVYGTMLQKYETTYK 892

Query: 327  QASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNV 386
             +   L     E ++GIKT++S  AE   +  Y+     +  +  K +       S TN+
Sbjct: 893  TSVAALENQEYEIMTGIKTIRSLQAESHFIKNYSGLEHNMRAIAHKRSIATGFGISVTNM 952

Query: 387  LGDFSFLLVLAYGSHLVLQGNLT---IGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGA 443
            +      ++  YG  LV +G  +   + +    +L+T  T ++   L     ++ +G  +
Sbjct: 953  ITICIQSILYYYGIKLVFEGEYSSKKMFETFTLLLFTIMTCTS---LVNQIPDISRGQRS 1009

Query: 444  ATRLFELLD---------YKPTIKS--TTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKD 492
            AT L+ +LD         ++   K+     K     N  ++ Q+++F+YP+     +++D
Sbjct: 1010 ATFLYRILDEGLASDESEFETHRKAEIVAPKQESKSNPLIKIQNLTFAYPSETNVNVYED 1069

Query: 493  LNFTIEPGS-NVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLG 551
            LN  +      + +VG SG GKST+  LL + Y      I +DG D+      +LR Q+ 
Sbjct: 1070 LNLEMHASEKTIGLVGESGSGKSTLMYLLTKLYQVAPHSIYLDGTDVNDWGLMNLRTQIS 1129

Query: 552  VVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGAL 611
            VV+Q+P L  GT+REN++YG+S      E+  + K    + F+   P G +T I  +  L
Sbjct: 1130 VVEQKPTLFDGTVRENLSYGISTDILDMELFDMLKYVGIYEFVESLPFGLDTRIDTK--L 1187

Query: 612  LSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHR 671
            LSGGQ QRI IARALL KPKILILDE TSALD  S   I   +        L  I I H 
Sbjct: 1188 LSGGQAQRICIARALLRKPKILILDECTSALDALSANIIIDIVKN--GPPALLTIVITHS 1245

Query: 672  LSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLL 711
               +R    + VL  +G ++E G FK+L  N +  L K++
Sbjct: 1246 EKMMRACNTIAVLK-NGKIIEKGGFKEL-VNGNGELKKII 1283

 Score =  150 bits (378), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 148/560 (26%), Positives = 247/560 (44%), Gaps = 51/560 (9%)

Query: 221 LGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDG----- 275
           LGER    +R  ++++ +   + +YD N        L  D   ++R + +  S       
Sbjct: 102 LGERQGFAVREKILQEYLTKPITWYDSN------DNLSGDFTQINRCVEELRSSSAEASA 155

Query: 276 --FKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLT 333
             F+ L+     IG  F+ S +L  ++   AP ++  A  + + I   +      +G   
Sbjct: 156 IIFQNLVSILALIGTSFYYSWSLTLIILCTAPIIIAFAVFFSHMIHKYTELENTETGKAA 215

Query: 334 KVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNV-----LG 388
           ++A   +  I+ V+ +  + +EV  +             + F     + S N      L 
Sbjct: 216 QLANWAMDSIQLVKLYCTQFREVRNFRELTSNC-----NDLFIKCCLYVSANTALLRFLS 270

Query: 389 DFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLF 448
              F+    +G+ +V +G L I ++          GS +         L KG  A  ++ 
Sbjct: 271 LSMFIQGFWFGATMVRKGKLQISNVVTCFQSCLMLGSTLSNTLQVIVILQKGDVALKKIL 330

Query: 449 ELLDYKPTIKSTTGKAFKPLN--------GKVEFQHVSFSYPTRKTNQIFKDLNFTIEPG 500
             L       S    A +P+           + F +++FSYP+R ++ + K+++   EP 
Sbjct: 331 GFLS-----TSVDHGADEPIYEPETPAELCTIAFNNITFSYPSRPSHPVLKNVSLCFEPT 385

Query: 501 SNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILM 560
               I+G SG GKST+++LLL++Y+  +G I V G D+ +++   L   + VV+Q   L 
Sbjct: 386 KFTFIIGKSGSGKSTLSNLLLKFYDDYNGTITVKGNDVKEINRNWLLNNVTVVEQRCTLF 445

Query: 561 SGTIRENITYGVSRQPSMEEIRSVAKK----C---FCHAFISKFPNGYETIIGPRGALLS 613
           + T+R NI  GVS+   +E+  S+ +K    C        +   P+G  TIIG  G  LS
Sbjct: 446 NDTLRNNILLGVSKD-QLEDHESIEQKLKDACSISMLDRLVCDLPHGLNTIIGSGGISLS 504

Query: 614 GGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLS 673
           GGQ+QR+AIARA +    ILILDEA SALD+     +   + R  +S + TI+ + H LS
Sbjct: 505 GGQQQRVAIARAFMRNKPILILDEAVSALDIIHRELLMKNI-RQWRSGKTTIL-LTHELS 562

Query: 674 TIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLLTXXXXXXXXXXXXYAPPAITQE 733
            I   +   V+  +G V E G  KDL     S  + +L             YA    T  
Sbjct: 563 QIEPDDYTYVIQ-EGEVKENGYQKDLKQKKTSVFNHMLN----LQTNNRDSYAISDRTAL 617

Query: 734 SEPQTEENGKDDSGEDQNSD 753
             P  E N   D+  D +S+
Sbjct: 618 ETPIKENNIFADTTIDSDSE 637

>KAFR0E00230 Chr5 complement(47473..51285) [3813 bp, 1270 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1270

 Score =  180 bits (457), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 149/521 (28%), Positives = 250/521 (47%), Gaps = 32/521 (6%)

Query: 209  MANFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFY--DRNKVGDLLSRLGADAYIVSR 266
            ++ F +   L  + E  +  LR+  ++   + ++E++  D NK  +L + +  D   +  
Sbjct: 760  ISTFLKSFSLGFVSENWIMDLRNKAMESITNKELEWFYKDENKSSELAALVLNDLRDLRS 819

Query: 267  SMTQNISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQ 326
             +++ IS     ++    G+         L+ V     P +++ + IYG+ ++      +
Sbjct: 820  LISEFISAMSTFIVVSLAGLIWALTTGWKLSLVCIAMFPLIILFSAIYGSILQRYETTYK 879

Query: 327  QASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNV 386
                +L     E + GIKT++    E   + RY+    ++ ++G+K A       + T  
Sbjct: 880  TTVADLENCVYEIMLGIKTIRCLQLEQHFIQRYSVLEARMKHIGRKRAIATGFGIAITTA 939

Query: 387  LGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYS------ELMKG 440
            L      ++  YG  LV      IG+ T   ++  +T   +F + T  S      ++ +G
Sbjct: 940  LVMCIEAILFYYGLKLVF-----IGEYTTMKMFKTFT-LLLFTIMTCTSLINQIPDVTRG 993

Query: 441  AGAATRLFELLDYKPTIKSTTGKAFK----PLNGKVE----FQHVSFSYPTRKTNQIFKD 492
              AA+R+F +LD        + +  +    P N  ++      ++ F YP+ +++ +F  
Sbjct: 994  QRAASRIFRILDESDRFLEDSDEHGRTRGIPKNNSIKSIITINNLQFHYPSAESSNVFNR 1053

Query: 493  LNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGV 552
            LN  I     V +V  SG GKST+  LL R Y      I +DG DI +    SLR  + +
Sbjct: 1054 LNLQIADNQTVAVVAESGSGKSTLLYLLTRLYKVDFNSIFIDGTDINEWQLTSLRNLIAI 1113

Query: 553  VQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALL 612
            V+Q+P L  G+IR+N+ YG   +    +I  V K+     F++  PNG +T +    +LL
Sbjct: 1114 VEQKPTLFEGSIRKNLIYGNKLEIMDMDIYDVLKQVGIFDFVTSLPNGIDTNVDT--SLL 1171

Query: 613  SGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKS--KELTIISIAH 670
            SGGQ QRI IARALL K KILILDE TSALD ES     + +  L+KS    +  I+I H
Sbjct: 1172 SGGQAQRICIARALLRKSKILILDECTSALDAESA----FVIQNLVKSGLPGVLTIAITH 1227

Query: 671  RLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLL 711
                +R   NVIVL  DG   + G F +LY   +  LH+++
Sbjct: 1228 SEPMMRACGNVIVLQ-DGETAQQGTFDELYKPGNE-LHRIV 1266

 Score =  135 bits (341), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 131/520 (25%), Positives = 243/520 (46%), Gaps = 52/520 (10%)

Query: 221 LGERLVARLRSNVIKKTMHHDMEFYDRNK--VGDLLS--------RLG-ADAYIVSRSMT 269
           +GE    R+R  ++   +   ME++D N   +GD +         R G A+A  ++    
Sbjct: 96  IGETQSFRIRRTILLSYLKKPMEWFDENDQLLGDFVQMHRCVEEVRSGSAEASAIT---F 152

Query: 270 QNISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQAS 329
           QN      AL+C        F+ S +L  ++   +P L+V A  +   I   ++     +
Sbjct: 153 QNFV-AIIALVCTS------FYYSWSLTLIILCSSPLLIVLAAFFSRMIENFTKLENDET 205

Query: 330 GNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNV--- 386
           G   +     ++  + V+ +  +  E+ ++   V     +   + F NA F+ S N    
Sbjct: 206 GIAAQSLTWSMNAAQLVKLYCTQDFEIKKFKEIV-----IRCNDYFINAWFYVSANTSIL 260

Query: 387 --LGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFG--LSTFYSE---LMK 439
             L    F+    +GS ++ +  +++  +      T ++   + G  L+T   +   L K
Sbjct: 261 RFLSLAMFVQGFWFGSTMIKKNKMSVDQVI-----TCFSSCLMLGSILNTTLPQIVLLQK 315

Query: 440 GAGAATRLFELLDYKPTIKS----TTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNF 495
                 R+ + L+ K  + +     T      +   + F  +SF YP+R  + + K+++ 
Sbjct: 316 AHVGLNRVQDFLEDKSEMATDRDRQTSINLDNVPISISFDAISFCYPSRPDDMVLKNISM 375

Query: 496 TIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQ 555
             +P     IVG SG GKST+++LLL++YN  +G I V+G ++  +    + + + +V+Q
Sbjct: 376 NFDPNKTTFIVGKSGSGKSTMSNLLLKFYNGYNGCIKVNGVNVQSIDRHWITKNVTLVEQ 435

Query: 556 EPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAF----ISKFPNGYETIIGPRGAL 611
           +  L + T+R N+  G+S   + E++ S  ++    A     I K P+G +T +G  G  
Sbjct: 436 KCTLFNDTLRNNLLIGLSHISAAEDVDSRLQEACRFALLDNVIEKLPSGLDTKVGSGGVS 495

Query: 612 LSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHR 671
           LSGGQ+QR+A+ARA L    ++ILDEA SALD  +   +   +    +SK  T I + H 
Sbjct: 496 LSGGQQQRVALARAYLRDTPVVILDEAISALDARNRRQLMENIRIWTRSK--TAIILTHE 553

Query: 672 LSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLL 711
           L+ I  S+ + ++  +G + E G   +L  N +S   K  
Sbjct: 554 LNQILPSDFLYLME-NGQIKEEGYQNELIENVESTFCKFF 592

>CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209c STE6
          Length = 1227

 Score =  179 bits (453), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 138/504 (27%), Positives = 241/504 (47%), Gaps = 14/504 (2%)

Query: 209  MANFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDR--NKVGDLLSRLGADAYIVSR 266
            ++ F ++  L   GE  +  LR     K + + + ++ +  NK   L + L  D   +  
Sbjct: 720  VSTFIKLFFLGYSGEFWIFELRQETFIKIIKNPISWFSKSNNKAPILSTLLINDLRDLRN 779

Query: 267  SMTQNISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQ 326
             +T+ +S     ++   +G+     I   L+ V     P ++V   +YG  +       +
Sbjct: 780  LVTEFLSVITTLILVTSIGLVWAIAIGWKLSLVCIAIIPLVVVLTGLYGTILIKTENRYK 839

Query: 327  QASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNV 386
             +  NL  +  E + G+KT+QS   +     ++N  ++ +   G   A       + TN+
Sbjct: 840  TSVANLESIVYEAIIGMKTIQSLCLQQYITKKFNCKIKLLEKNGTYRAVATGLGIALTNM 899

Query: 387  LGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATR 446
            L      ++  YG  LVL G  T   L   +    +T   V  L T   ++ +G  + + 
Sbjct: 900  LVLLFQSILFYYGFKLVLTGEYTHSKLFETIALLLFTIVTVASLVTQLPDITRGQRSISW 959

Query: 447  LFELL--DYKPTIK-----STTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEP 499
            + ++L  D + TI+     STT   + P    +E  ++SF+Y      +   ++N  +  
Sbjct: 960  IDQILKGDNQQTIEPPSNLSTTKGIWNPNQPVIEVSNLSFTYAQVHNKKTLTNINMQLYS 1019

Query: 500  GSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPIL 559
                 IVG SG GKST+ +L+   Y+ + G I +   DI K S+K L + + ++QQ P+L
Sbjct: 1020 NQIYGIVGKSGSGKSTLINLICGLYSLSEGSINICSCDINKWSTKELHKTVALLQQNPVL 1079

Query: 560  MSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQR 619
               TIR N+ YG++     E + +V +     +FI    NG ++ +    +LLSGGQ QR
Sbjct: 1080 QFDTIRNNLLYGLTETVGDEHLLNVLEYVGLKSFIISLNNGLDSKLD--DSLLSGGQSQR 1137

Query: 620  IAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSE 679
            + +AR +L  PK+LILDE TSALDV S   IN  +G   +S     I ++H+  TI+  +
Sbjct: 1138 LCMAREMLRNPKVLILDECTSALDVTSAKKINDIIGS--RSLAPVTIIVSHQKETIKLCD 1195

Query: 680  NVIVLGIDGSVVEMGKFKDLYANH 703
             +  L +DG+V  MG +++L  N+
Sbjct: 1196 KIFFL-VDGTVAMMGTYEELMENN 1218

 Score =  170 bits (430), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 133/487 (27%), Positives = 222/487 (45%), Gaps = 36/487 (7%)

Query: 218 LKILGERLVARLRSNVIKKTMHHD-----MEFYDRNK---VGDL--LSRLGADAYIVSRS 267
           L I G  ++   +S +I+K + H+       ++D+ +   +G+   L R   +    S  
Sbjct: 90  LAIYGWMMLGERQSYIIRKKLFHEYFNLPCSWFDKYRSDIMGEFTQLHRCIEEVRSSSAE 149

Query: 268 MTQNISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQ 327
            +  +S    A+I     IG  F+ S +L  ++F   P +++ A I+   I   + +   
Sbjct: 150 ASAIMSQSLVAVI---ALIGTAFYFSWSLTLIIFCSTPFIIICAVIFSKYIHKYTEKENT 206

Query: 328 ASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVL 387
            S    +     L  I+ V+    +  E+  Y + + Q       E +  A+ F S N+ 
Sbjct: 207 ESECAAERLAWMLKNIEFVRLHNGDDFEISMYTHYIAQA-----NEYYIKASLFISANIS 261

Query: 388 GDFS-----FLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAG 442
                    F+    +GS ++ QG L I  +          GS +         L KG  
Sbjct: 262 ILRLLSLLMFVQGFWFGSSMIKQGKLNIDSVITSFHCCLMLGSIINSALGQAVVLQKGDV 321

Query: 443 AATRLFELLDYKPT-----IKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTI 497
           A  RL +++D  P      I + +G    P    + F +VSF YP RKT+++F  +NF I
Sbjct: 322 AMKRLLKMIDRTPRESLAFIDAISGIDLLP----IVFNNVSFCYPERKTDKVFDKMNFII 377

Query: 498 EPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEP 557
           +P     ++GPSG GKST+  L+L +Y+   G I++   DI  ++   +   + +V Q P
Sbjct: 378 KPNKMTYVIGPSGSGKSTLFDLILLHYDNYHGSIMLGDLDIRSINRNIILENITLVSQTP 437

Query: 558 ILMSGTIRENI--TYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGG 615
            L + TIR NI      +  PS  E+  + K       I++ P+G +T IG  G  LSGG
Sbjct: 438 TLFNDTIRNNILACSNWTNLPSKLEMECICKFALLENLIAELPDGLDTRIGSGGIKLSGG 497

Query: 616 QKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTI 675
           Q Q++A+ARA      IL+LDE  SA+D+     +   + R    K  T + I H L  I
Sbjct: 498 QAQKVALARAFARNTSILLLDEPLSAVDMRQRIVLMENIKRWRNGK--TTVIITHDLEFI 555

Query: 676 RRSENVI 682
           R ++N++
Sbjct: 556 RNTDNIL 562

>Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON} YKL209C
            (STE6) - ABC transporter, glycoprotein, component of
            a-factor secretory pathway [contig 290] FULL
          Length = 1297

 Score =  179 bits (453), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 140/522 (26%), Positives = 234/522 (44%), Gaps = 39/522 (7%)

Query: 212  FGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYD--RNKVGDLLSRLGADAYIVSRSMT 269
            F +  +L   GE  +  LR N  +  M  D  ++    N   ++ S +  D     R + 
Sbjct: 790  FLKCYILSRCGENWIKELRINAFRSVMEKDFTWFQDSNNSTSNITSLILNDL----RDLR 845

Query: 270  QNISDGFKAL----ICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISREL 325
               S+   AL    +    G+         L+ V     P  ++ + IYG  ++      
Sbjct: 846  ALASEFLAALSTLAVVSLCGLLWALVAGWKLSLVCISLIPMFVLFSGIYGGLLQNYEARY 905

Query: 326  QQASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTN 385
            +     L     + +  +KT++    E K    Y           +K A       +S+N
Sbjct: 906  KTCIAELENELYKAIRCMKTIKCLQMENKVARSYEMLEVTSKGAARKRAMGTGFGVASSN 965

Query: 386  VLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAAT 445
             L   +  ++L +G  LV+ G  T G +   +    +T      L +   E+ +G  AAT
Sbjct: 966  ALTFITQSILLYFGMKLVITGEYTPGKMLETLTLLLFTIMTCMTLMSQVPEISRGQRAAT 1025

Query: 446  RLFELLD-------------YKPTIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKD 492
             LF+L               + P IK+ + +        +  +H+ FSY       ++K+
Sbjct: 1026 YLFKLFGNEHEEGASVLKERHAPIIKTCSKQTL------ISIKHLKFSYSNINNPMVYKN 1079

Query: 493  LNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGV 552
            L+  ++ G  V ++G SG GKST+ SLL R Y   +G I +DG DI +   K+LR  + V
Sbjct: 1080 LSLKVDRGEIVGLIGTSGSGKSTLWSLLTRLYPVENGSISIDGTDINQWDRKALRSCIAV 1139

Query: 553  VQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALL 612
            V+Q+P+  SG+I EN+TYG+ R+ S EE+  +        F++  P    ++I  +  LL
Sbjct: 1140 VEQKPLFFSGSIIENLTYGLMRKVSDEEVNELLLTLGMLEFVNSTPKRLHSVIDTQ--LL 1197

Query: 613  SGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSK--ELTIISIAH 670
            SGGQ QR+AI RALL KP++L+LDE TSALD       ++ +   +K      T + + H
Sbjct: 1198 SGGQVQRLAIVRALLRKPQLLVLDECTSALDARH----SFIMSEFVKHHLYHTTTLVVTH 1253

Query: 671  RLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLLT 712
                +R    ++     G +VE G   +L+ N    L+++LT
Sbjct: 1254 SEQMMRSCHRILTFN-KGEIVEEGSIDNLF-NQKGELYRILT 1293

 Score =  157 bits (396), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 141/504 (27%), Positives = 231/504 (45%), Gaps = 35/504 (6%)

Query: 221 LGERLVARLRSNVIKKTMHHDMEFYDRN-KVGDLLSRLGADAYIVSRSMTQNISDGFKAL 279
           LGER   RLR  +++      M +YD N ++    ++L      +  S  +  +  F+ L
Sbjct: 103 LGERQGFRLRRKLLRSYFEKSMAWYDINEQISGEYTQLNRCVEELRSSSAEASAIIFQNL 162

Query: 280 ICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNK-IRAISRELQQASGNLTKVAEE 338
           +     +G   + S +L  V+ +   PL++G  IY ++ +    +     +     +   
Sbjct: 163 VTVIALLGTALYYSWSLTLVI-MANSPLVIGFAIYCSRNVEKYGKIENSETSVAADIMAW 221

Query: 339 QLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTN-----VLGDFSFL 393
            L+  K V+    +  E+ ++  +V +      +  F   + FSS N      L    F+
Sbjct: 222 SLNAAKMVRLLGTQDYEIAKFRASVLKC-----RMNFNKMSLFSSLNYSILRFLTLCMFV 276

Query: 394 LVLAYGSHLVLQGNLTIGD-LTAFMLYTEYTGSAVFGLSTFYSEL------MKGAGAATR 446
               YG+  +  GNL  GD +T F        S +   ST  S L       KGA    +
Sbjct: 277 QGFWYGNVRIKSGNLKPGDVMTCF-------SSCILLASTLNSTLHQVVTLQKGAVGLKK 329

Query: 447 LFELL--DYKPTIKSTTGKAFKPL---NGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGS 501
           + E L  D     +        PL     ++ F++VSF+YP+R  + + K+LN  +  G 
Sbjct: 330 IQEFLTSDVVQGKECVVNSMHLPLLWEQAQISFENVSFAYPSRSKHPVIKNLNLKVPGGR 389

Query: 502 NVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMS 561
              IVG SG GKSTI++LLL+ Y P SG I V+  DI +++ + L R + +V+Q   L  
Sbjct: 390 FTFIVGKSGSGKSTISNLLLKLYRPCSGLIKVNDVDIREINQQDLFRSITLVEQNSPLFE 449

Query: 562 GTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIA 621
            +I+ NI            +    +       I     G +TIIG  G  LSGG++QR+A
Sbjct: 450 DSIKNNIQLTSDEHRDDGRLSQACQAAMLEGVIRDLAKGLDTIIGSSGVDLSGGEQQRVA 509

Query: 622 IARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENV 681
           +ARA +    ILILDEA SA D   +  +   + R  +    TII + H L+ I   + V
Sbjct: 510 LARAFVRDSPILILDEALSAQDRMHKDLLMEAI-RFWRKGRTTII-LTHELNDILEDDFV 567

Query: 682 IVLGIDGSVVEMGKFKDLYANHDS 705
           +++  DG+V+E G+  DL ++  S
Sbjct: 568 LLME-DGNVIERGQKSDLLSDSTS 590

>KLLA0B14256g Chr2 (1248654..1252469) [3816 bp, 1271 aa] {ON}
           similar to uniprot|P12866 Saccharomyces cerevisiae
           YKL209C STE6 ATP-binding cassette (ABC) transporter
           required for the export of a-factor catalyzes ATP
           hydrolysis coupled to a-factor transport contains 12
           transmembrane domains and two ATP binding domains
           expressed only in MATa cells
          Length = 1271

 Score =  175 bits (444), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 146/515 (28%), Positives = 238/515 (46%), Gaps = 39/515 (7%)

Query: 221 LGERLVARLRSNVIKKTMHHDMEFYDRN--------KVGDLLSRLGADAYIVSRSMTQNI 272
           LGER   R+R+++I      D+++YD N        ++   +  + A +   S    QN+
Sbjct: 91  LGERQGFRIRNSLIMFYFEKDLKWYDSNENLEGDFIQINRCIEEVRASSAEASAIFFQNV 150

Query: 273 SDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIY-GNKIRAISRELQQASGN 331
                  I   +   M +  S TL   + L + PLL    ++   K+   S+     S  
Sbjct: 151 IS-----IIALIATSMYYSWSLTL---IILCSLPLLATLAVFLSMKVEKFSKLENLESSK 202

Query: 332 LTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFS 391
            + V    L   + ++ F     E  ++   V +      K    +A   SS   L    
Sbjct: 203 ASSVLAWSLDAFQMIRLFNTSYWEQKKFETLVSKCNKHFVKSCLYSALNASSLRFLTLCM 262

Query: 392 FLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELL 451
           F+    +G+  + +G +  GD+          GS++         + KG  A  R+ + L
Sbjct: 263 FVQGFWFGNTQIKRGKMKAGDVITCFSSCLLLGSSLSSTLQQIVTIQKGKAAIQRINQFL 322

Query: 452 DYKPTIKSTTGKAFK--------------PL--NGKVEFQHVSFSYPTRKTNQIFKDLNF 495
              P  KS  G+  K              P+  +G +EF+ VSF+YPTR  + + K+++ 
Sbjct: 323 --VPNSKSAVGEWEKRSSLISTSSSIGLAPIFCDGDIEFRDVSFAYPTRPDDYVLKNVSI 380

Query: 496 TIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQ 555
            I+ G+   IVG SG GKST+ASLLL+ Y   +G+I     +I  L    L   + +V+Q
Sbjct: 381 KIKSGATCFIVGKSGSGKSTLASLLLKMYGEYTGEIKFGEYEIDSLDDSWLVENITLVEQ 440

Query: 556 EPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGG 615
              L +GT+++N+T  V++  S  E++   +    +  +   PNG +T++G  G  LSGG
Sbjct: 441 RCTLFNGTLKDNLTI-VNKYASCTEVKQACQFALLNTVLLNLPNGIDTLLGRHGVTLSGG 499

Query: 616 QKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTI 675
           Q+QR+A+ARA L    +LILDE+ SALD+ S   I   +    K K  T I + H  + I
Sbjct: 500 QQQRVALARAYLRNTPVLILDESLSALDIMSRELIVEAIRHWRKGK--TTIILTHEYTQI 557

Query: 676 RRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
           +  E V ++  +G+VVE G   DL  N DS   +L
Sbjct: 558 KDDEYVYLMS-EGTVVESGFKYDLLENPDSYFAQL 591

 Score =  167 bits (424), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 139/504 (27%), Positives = 242/504 (48%), Gaps = 19/504 (3%)

Query: 209  MANFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYD--RNKVGDLLSRLGADAYIVSR 266
            ++ F +  +L    E  + RLR + + K     ++++    N   +L S +  D   + R
Sbjct: 760  ISTFLKDFILGYCSEVWIERLRVDAMAKISSKSLDWFKLPTNNSSELNSLMMNDLRDL-R 818

Query: 267  SMTQNISDGFKALICGGVGIGMMFHISS--TLASVLFLFAPPLLVGATIYGNKIRAISRE 324
             +          L+     IG+++ + S   L+ V     P  ++ + IYG+ ++     
Sbjct: 819  GLASEFLSAITTLVFVA-SIGLIWALVSGWKLSLVCISLFPAFILFSGIYGSLLQVYETA 877

Query: 325  LQQASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSST 384
             +     L     E +  +KT++    +      +   + +V  V KK +       + T
Sbjct: 878  YKTEIAELETRVHELVISMKTIKLLQLQQHFEGSFKTQLAKVRIVCKKRSVAVGFGIAVT 937

Query: 385  NVLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAA 444
            N L      ++  +G  LV+QG  ++  +        ++      L     E+ +G  AA
Sbjct: 938  NALAMVVQAILFFFGIKLVIQGEYSVAQMFETFTLLLFSIMTCVSLINQVPEISRGQRAA 997

Query: 445  TRLFELLDYKPTIKST-----TGKAFKPLNGK---VEFQHVSFSYPTRKTNQIFKDLNFT 496
            T +F++L+   ++ ++       ++F    G    ++  ++SF++ +   N+IF  L+  
Sbjct: 998  TYIFKVLEDSGSVDTSKPDPSQNQSFFSTAGNRETIKISNLSFAFSSAPMNKIFNSLSCE 1057

Query: 497  IEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQE 556
            I     V IVG SG GKST++ LL R Y   SGK+ + G DI K    +LRR + +V+Q+
Sbjct: 1058 ICLNETVGIVGESGSGKSTLSLLLTRLYPVPSGKVYIGGIDINKWDEYALRRTISIVEQK 1117

Query: 557  PILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQ 616
            P    GT+REN+ YG+ R  S  E+RSV K     +F+   PN   T +     L+SGGQ
Sbjct: 1118 PKFFDGTVRENLVYGLKRNVSNSELRSVLKSVDLLSFVQTLPNDLNTRV--HDGLMSGGQ 1175

Query: 617  KQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIR 676
             QR++IAR LL +PKI+ILDE TSALD  +  AI   +  ++K+  +T+I I H    ++
Sbjct: 1176 AQRLSIARTLLRQPKIIILDECTSALDAANSFAIAELIRTVLKN--VTVIVITHSEQLMQ 1233

Query: 677  RSENVIVLGIDGSVVEMGKFKDLY 700
              + V+VL   G V E G + +L+
Sbjct: 1234 ICDRVLVLK-KGKVKEEGSYAELF 1256

>Ecym_3612 Chr3 (1167419..1171366) [3948 bp, 1315 aa] {ON} similar to
            Ashbya gossypii AFR432W
          Length = 1315

 Score =  172 bits (435), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 141/501 (28%), Positives = 242/501 (48%), Gaps = 22/501 (4%)

Query: 212  FGRVVLLKILGERLVARLRSNVIKKTMHHDMEFY--DRNKVGDLLSRLGADAYIVSRSMT 269
            F +  +L +  E  +  LR   + +  + D+ ++  D NK  ++ + +  D   +   ++
Sbjct: 808  FLKKFILSVCSELWIMSLRIKAMDRISNQDVHWFSLDINKPSEISALILNDLRDLRYLVS 867

Query: 270  QNISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGAT-IYGNKIRAISRELQQA 328
              +S     +    +G+   F +S    S++ +   PL +G T IYG  ++    + + A
Sbjct: 868  GFLSAVTTLIFVSAIGLAWAF-VSGWKLSLVCISTIPLFIGVTGIYGGVLQKYETDYKTA 926

Query: 329  SGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLG 388
               L     E + GIKTV+    E    ++Y      + +  ++ A       + +N L 
Sbjct: 927  VAELENNMFEFVKGIKTVRCLQLESHFSNKYTMLEEGMKHQSRRRAVVTGFGVALSNALV 986

Query: 389  DFSFLLVLAYGSHLVLQGNLTIGDLT---AFMLYTEYTGSAVFGLSTFYSELMKGAGAAT 445
                 ++  YG  LV+ G  T  +L      +++T  T SA+      +S   +G  AAT
Sbjct: 987  IGVQAILYYYGIKLVVDGEYTPDNLLQTFTLLVFTIMTCSALMYEVPSFS---RGRRAAT 1043

Query: 446  RLFELLDYKPTIKST-----TGKAFKP--LNGKVEFQHVSFSYPTRKTNQIFKDLNFTIE 498
             +F +L+ +    S      T    KP  +N  +  Q ++F+YP+    +++K L+ TI 
Sbjct: 1044 YVFRILNTRSDFLSIDDDFRTEPIEKPSHMNPLIRIQDLTFAYPSALDVEVYKKLSLTIN 1103

Query: 499  PGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPI 558
             G N+ IVG SG GKST+  +L   Y      + +D  DI K +  SLR+ + +V+Q+  
Sbjct: 1104 FGENLAIVGESGSGKSTMGLILCGLYPVNGNTVFIDDTDICKWNLSSLRKHISMVEQKAK 1163

Query: 559  LMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQ 618
               G+IR+N+ YG+ R  +  +I  V        F+ + P G  T I     L+SGGQ Q
Sbjct: 1164 FFDGSIRDNLIYGLDRIVTDSQIFEVLSLVGIADFVKELPQGLNTRIDTN--LISGGQAQ 1221

Query: 619  RIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRS 678
            RI+I RALL +PK+LILDE TS+LD ++  AI   +G  +    +T I I H  + + +S
Sbjct: 1222 RISIGRALLRQPKLLILDECTSSLDAKNAQAIASLVGSSLYG--ITTIVITHN-TQMMKS 1278

Query: 679  ENVIVLGIDGSVVEMGKFKDL 699
             N I+   +G + E G F++L
Sbjct: 1279 CNRILFFKNGRISEEGTFQEL 1299

 Score =  124 bits (310), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 135/572 (23%), Positives = 250/572 (43%), Gaps = 44/572 (7%)

Query: 220 ILGERLVARLRSNVIKKTMHHDMEFYDRNK--VGDLLS-RLGADAYIVSRSMTQNISDGF 276
           +LGER   R+R  ++   +   M +YD N+   GD      G +    S + +  ++   
Sbjct: 101 LLGERQGFRVRRRLLGAYLSKTMAWYDTNENLEGDFTQIHRGVEELRSSAAESSAVTFLN 160

Query: 277 KALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQA-SGNLTKV 335
              +   +   + F  S TL   + L + PL++   I  +K+     EL+   + +   +
Sbjct: 161 AVTVVTLLTTSLYFSWSLTL---VILASTPLIIALAIIFSKLVEKYTELENTETSHAASI 217

Query: 336 AEEQLSGIKTVQSFVAEGKEVHRYNNAVRQV----FNVGKKEAFTNATFFSSTNVLGDFS 391
               +   + ++ F  E  E+ +++ +V++      N+ K  A   A+    + ++    
Sbjct: 218 LTWSMEAPQLIRLFGTEQVELQKFSISVKKCSKFFINLSKYAAANQASLRGLSLIM---- 273

Query: 392 FLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELL 451
           F+    +G+ ++ +G L  G +          G+ +         + KG  A  ++  ++
Sbjct: 274 FVQGFWFGNTMIKRGKLNSGQVITCFSACILLGTTLNNTLQHIVIMQKGKVALQKILSMV 333

Query: 452 DYKP-TIKSTTGKAFK----PLNG---------KVEFQHVSFSYPTRKTNQIFKDLNFTI 497
           + +   ++   G+ F+    P++G         ++ F++VSFSYP+R       +++ T 
Sbjct: 334 ESESDALRGRRGETFEIFPSPISGMFVSPVFPKQITFENVSFSYPSRPNEYALDNVSLTF 393

Query: 498 EPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEP 557
            P     IVG SG GKST+++LLL+ Y+   G I V   DI       L   + +V+Q  
Sbjct: 394 YPEKITFIVGKSGSGKSTLSNLLLKLYSDYEGTIKVGTLDIRATKDSWLLENITLVEQSC 453

Query: 558 ILMSGTIRENITYGVSRQPSME-EIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQ 616
            L + ++  N+          E  I+   +       +   P+G  T+IG  G  LSGGQ
Sbjct: 454 TLFNDSLLNNLLLTAKDDNKNEASIKRACQMALLEKLLFDLPDGLSTVIGSNGISLSGGQ 513

Query: 617 KQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIR 676
           +QR+A+ARA+L    +LILDE+ SALD+     +   + R  ++ + TII + H LS I 
Sbjct: 514 QQRVALARAILRDTPVLILDESISALDIIHRDLLMEVI-RNWRAGKTTII-LTHELSHI- 570

Query: 677 RSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLLTXXXXXXXXXXXXYAPPAITQESEP 736
             ++ + L  DG V E G  +DL +       +L                P AI    E 
Sbjct: 571 LDDDYLYLMEDGKVGEHGYKRDLLSYTSGRFTELHNAVIPSD--------PSAIEASHEK 622

Query: 737 QTEENGKDDSGE---DQNSDHEENSQDQNEKR 765
               N ++ +G     + S+ E+N+    + R
Sbjct: 623 AIRLNTEETTGSGIVSEESEEEDNTVVSYDTR 654

>Smik_11.14 Chr11 complement(26603..30553) [3951 bp, 1316 aa] {ON}
            YKL209C (REAL)
          Length = 1316

 Score =  166 bits (421), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 145/508 (28%), Positives = 243/508 (47%), Gaps = 23/508 (4%)

Query: 211  NFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFY--DRNKVGDLLSRLGADAYIVSRSM 268
            NF +  LL    E  +  LR+ V++K     M ++  + NK  ++ + +  D   + RS+
Sbjct: 803  NFAKGFLLGYCSEYWIMDLRNEVMEKLTKKSMNWFSGEDNKASEVSALVLNDLRDL-RSL 861

Query: 269  TQNISDGFKALICGGVGIGMMFHISS--TLASVLFLFAPPLLVGATIYGNKIRAISRELQ 326
                     + I     IG+++ ++S   L+ V     P +++ + IYG+ ++    + +
Sbjct: 862  VSEFLSAITSFITVSF-IGLVWALASGWKLSLVCISMFPLIIIFSAIYGSILQKHETDYK 920

Query: 327  QASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNV 386
             +   L     + ++ IKT++   AE      Y+    ++  +  K A       S TN+
Sbjct: 921  TSVVQLENCLYQIVTNIKTIKYLQAEFHFQLSYHKLKTKMEQIASKRAIATGFGISMTNM 980

Query: 387  LGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATR 446
            +      ++  YG  LV+    T   +        +T  +   L +   ++ +G  AA+ 
Sbjct: 981  IAMCIQAILYYYGLKLVMVHEYTSKKMFTTFTLLLFTIMSCTSLVSQIPDISRGQRAASW 1040

Query: 447  LFELLDYKPT---IKSTTGKAF---------KPLNGKVEFQHVSFSYPTRKTNQIFKDLN 494
            ++ +LD K     I+    ++          K     +  Q+++F+YP+  +  I+K++N
Sbjct: 1041 IYRILDEKQVTLEIEDNNARSIGIIGETYHEKQTTPMLSIQNLTFAYPSAPSVLIYKNMN 1100

Query: 495  FTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQ 554
              +  G  + IVG SG GKST+  LL R Y+   G I +DG D+   +   LRR++ VV+
Sbjct: 1101 LNMFCGQTIGIVGGSGSGKSTLVLLLTRLYDCEVGSIKLDGTDVNDWNLTVLRREISVVE 1160

Query: 555  QEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSG 614
            Q+P+L +GTIR+N+TYG   +    EI    K    + F++  P G  T I     LLSG
Sbjct: 1161 QKPLLFNGTIRDNLTYGCLGEILEIEIYDALKYVGIYDFVASLPLGLGTRIDTN--LLSG 1218

Query: 615  GQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLST 674
            GQ QR+ IARAL+ KPKILILDE TSALD  S   I   + +      L  + I H    
Sbjct: 1219 GQAQRLCIARALVRKPKILILDECTSALDSMSSHVIKEIVKK--GPPALLTLVITHDEQM 1276

Query: 675  IRRSENVIVLGIDGSVVEMGKFKDLYAN 702
            +R  +++ V   DG V+E G F  LY N
Sbjct: 1277 MRCCDSIAVFK-DGKVIEEGSFDTLYNN 1303

 Score =  158 bits (400), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 133/512 (25%), Positives = 232/512 (45%), Gaps = 33/512 (6%)

Query: 221 LGERLVARLRSNVIKKTMHHD-MEFYDRNK--VGDLLSRLGADAYIVSRSMTQNISDGFK 277
           +GE+   R+RS +++  +    M++YD N   +GD  +++      +  S  +  +  F+
Sbjct: 125 IGEKQGLRIRSQLLEAYLEKKPMKWYDVNDTLLGDF-TQINRCVEELRSSSAEASAITFQ 183

Query: 278 ALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAE 337
            L+     +G  F+ S +L  ++   +P +   A  +   +   S++  + +    ++  
Sbjct: 184 NLVAICALLGTSFYYSWSLTLIILCSSPIITFFAVAFSRMVHMYSQKENEETSKAAQLFA 243

Query: 338 EQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLV-- 395
             ++  + V+ +  +  E  ++   +     +     F  +  F + N  G   FL +  
Sbjct: 244 WSMNAAQLVRLYCTQPLERKKFQRII-----LSCNTFFIKSCLFVAANA-GILRFLTLTM 297

Query: 396 ----LAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELL 451
                 +GS ++ QG L I D+          GS +         L KG  A  ++  LL
Sbjct: 298 FVQGFWFGSTMIKQGKLNINDVITCFHSCILLGSTLNNTLHQIVVLQKGEVALQKIMNLL 357

Query: 452 DYKPTIKSTTGKAFK--PL---NGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIV 506
           +  P             PL   N  + F +VSFSYP+R +  + ++ +     G    IV
Sbjct: 358 ENGPKCNPPNEIELHQYPLDYANSDLVFDNVSFSYPSRPSEIVLENASLKFPAGQFTFIV 417

Query: 507 GPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRE 566
           G SG GKST++SLLL++Y+   G I ++G++I  +  K L + + VV+Q   L + T+R+
Sbjct: 418 GKSGSGKSTLSSLLLKFYDGYDGSISINGRNIQAIPQKLLIKNITVVEQRCTLFNDTLRK 477

Query: 567 NITYG---------VSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQK 617
           NI  G          S   +   I+   +       I   P+G ET+IG  G  LSGGQ+
Sbjct: 478 NILLGSTELAKNADYSTNKNTNLIKDACRMALLDRLILDLPDGLETLIGSGGVTLSGGQQ 537

Query: 618 QRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRR 677
           QR+A+ARA +    IL LDEA SALD+     +   +    K K  T I + H L  +  
Sbjct: 538 QRVAMARAFIRDTPILFLDEAVSALDIIHRNLLMKAIRHWRKGK--TTIILTHELGQV-E 594

Query: 678 SENVIVLGIDGSVVEMGKFKDLYANHDSALHK 709
           S++ + L  +G V+E G   +L A+  S   K
Sbjct: 595 SDDHLYLMQEGKVIESGTQSELLADSTSTFSK 626

>KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209C STE6 ATP-binding cassette (ABC) transporter
            required for the export of a-factor catalyzes ATP
            hydrolysis coupled to a-factor transport contains 12
            transmembrane domains and two ATP binding domains
            expressed only in MATa cells
          Length = 1298

 Score =  165 bits (418), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 133/512 (25%), Positives = 234/512 (45%), Gaps = 19/512 (3%)

Query: 212  FGRVVLLKILGERLVARLRSNVIKKTMHHDMEFY--DRNKVGDLLSRLGADAYIVSRSMT 269
            F +   L   GE  +  LR    K   + ++ ++  ++N   ++ S +  D   + R++ 
Sbjct: 791  FLKCFTLSKCGENWIRALRLRAFKNISNRELAWFNSEQNSTSNVSSLVINDLRDL-RALA 849

Query: 270  QNISDGFKALICGGVGIGMMFHISS--TLASVLFLFAPPLLVGATIYGNKIRAISRELQQ 327
                     L+      G+++ ++S   L+ V     P  ++    YG  ++      + 
Sbjct: 850  SEFLAAVTTLVVVSF-CGLIWALASGWKLSLVCISLIPAFILFTGAYGGLLQKCEANYKS 908

Query: 328  ASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVL 387
            A  ++       +  IKT++    E + +  Y     +    G+K A       + +N L
Sbjct: 909  AVASMEDQLYSAVRRIKTIRCLQVEERVIKEYEVLEGKAKLAGRKRALGTGFGVALSNAL 968

Query: 388  GDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRL 447
               +  ++L YG  LV+ G  +   +   +    +T      L     E+ +G  AAT L
Sbjct: 969  TLITQSILLYYGMKLVITGEYSSERMFQTLTLLLFTIMTCMSLIAQIPEISRGQRAATYL 1028

Query: 448  FELLDYKPTIKSTTGKAFKPLNGK-------VEFQHVSFSYPTRKTNQIFKDLNFTIEPG 500
            F +LD +        +    L  +       +  + + FSY       +++ LN +++ G
Sbjct: 1029 FRILDSETQFADANLEGESALTSRGCSNEALIFIKDLRFSYSFLNNPMVYRGLNLSVKAG 1088

Query: 501  SNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILM 560
              V +VG SG GKST+  L+ R Y   SG I  DG D+ +    +LR+++ VV+Q P L 
Sbjct: 1089 ETVALVGLSGSGKSTLWHLITRLYRVPSGSIWFDGLDVNEWEEWALRKRIAVVEQRPSLF 1148

Query: 561  SGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRI 620
             G+I +N+TYG+S      EIR + +      F++  P G ++ I     +LSGGQ QR+
Sbjct: 1149 RGSIFDNLTYGLSTSVDEREIRELLELVGMMDFVNSNPLGLQSFIDTD--VLSGGQLQRL 1206

Query: 621  AIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSEN 680
            AI RALL KP++L+LDE TSALD +  G I     R   S+  T + + H    +R    
Sbjct: 1207 AIVRALLRKPQLLVLDECTSALDAQ-HGFIMSEFVR-QGSQSTTTLVLTHSEQMMRACNR 1264

Query: 681  VIVLGIDGSVVEMGKFKDLYANHDSALHKLLT 712
            ++    +G+++E G F+ LY+     L K+L+
Sbjct: 1265 ILTFA-NGNIIEDGSFERLYS-QKGELFKILS 1294

 Score =  155 bits (392), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 142/514 (27%), Positives = 236/514 (45%), Gaps = 41/514 (7%)

Query: 221 LGERLVARLRSNVIKKTMHHDMEFYDRNK--VGDLLSRLGADAYIVSRSMTQNISDGFKA 278
           LGER   RLR  +++  +   M +YD N+   GD  ++L      +  S  ++ +  F+ 
Sbjct: 99  LGERQAFRLRRKMLQSYLDKSMAWYDANEQISGDF-TQLNRCVEELRSSSAESSAIVFQN 157

Query: 279 LICGGVGIGMMFHISSTLASVLFLFAPPLLVG-ATIYGNKIRAISRELQQASGNLTKVAE 337
           ++     +G   + S +L +++ +   PL++G A  +  K+   ++     + +      
Sbjct: 158 VVTVAALLGSALYYSWSL-TLIIMANSPLVIGFAVFFSRKVEKYAKRENSETSSAADAMA 216

Query: 338 EQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTN-----VLGDFSF 392
             L   K V+    + +E+ R+   V++      ++ F   + FSS N      L    F
Sbjct: 217 WSLDAAKMVRLLGTQDRELARFEACVQKC-----RQHFNKMSLFSSLNYSVLRFLTLCMF 271

Query: 393 LLVLAYGSHLVLQGNLTIGDL-TAFMLYTEYTGSAVFGLSTFYSEL------MKGAGAAT 445
           +    YG+  +  G L  GD+ T F        S V   ST  S L       KGA    
Sbjct: 272 VQGFWYGNSRINIGKLKPGDVVTCF-------SSCVLLASTLNSTLHQIIILQKGAVGLQ 324

Query: 446 RLFELLDYKPTIKSTTGK---AFKPL-----NGKVEFQHVSFSYPTRKTNQIFKDLNFTI 497
           ++   ++ +   +S   K   +F+ L        + FQ+V F+YPTR  + + K ++   
Sbjct: 325 KIMAFVNSRDASESQKNKVEISFRRLPLCWERASITFQNVHFAYPTRPDDFVLKGVSLDF 384

Query: 498 EPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEP 557
             G    ++G SG GKSTI +LLL +Y   SG I V+GQD+ +++   L R + +V+Q  
Sbjct: 385 PSGETTFVIGKSGSGKSTIGNLLLGFYGIGSGTINVNGQDVKEINQSELARNIMLVEQTT 444

Query: 558 ILMSGTIRENITYGVSRQPSME-EIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQ 616
            L + T+  N+T G +     E  ++   +       I     G ET IG  G  LSGG+
Sbjct: 445 SLFTETLANNVTIGEAGVDDDEIRLKQACQMAMLGNIIRDLAKGLETTIGCSGLDLSGGE 504

Query: 617 KQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIR 676
           +QR+A+ARA      ILILDEA SA D   +  +   + R  ++ + TII + H LS I 
Sbjct: 505 QQRVALARAYFRNAPILILDEALSAQDRIHKSLLMEAI-RKWRADKTTII-LTHELSDIL 562

Query: 677 RSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
            ++ V V+  DG + E G    L +N  S    L
Sbjct: 563 DTDYVYVMS-DGQIREHGYKSGLLSNPKSEFSNL 595

>CAGL0E03982g Chr5 (378442..383421) [4980 bp, 1659 aa] {ON} similar to
            uniprot|P32386 Saccharomyces cerevisiae YLL048c YBT1
            yeast bile transporter
          Length = 1659

 Score =  157 bits (398), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 141/518 (27%), Positives = 238/518 (45%), Gaps = 59/518 (11%)

Query: 228  RLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALI-CGGVGI 286
            R+   ++ K +H  + F D   +G +++R   D   V + +T  +   F  L+ C    I
Sbjct: 1141 RIFKKLLSKVLHSRLRFIDSTPIGRIMNRFSKDIEAVDQELTPFLEAAFFCLVQCISTII 1200

Query: 287  GMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEEQLSGIKTV 346
             + F     L   + +     LVG   Y N  R + R        + +   E L+G+ T+
Sbjct: 1201 LITFITPQFLFVAVLVCVLYYLVGY-FYINTSRELKRIESITKSPIYQHFSETLTGVATI 1259

Query: 347  QSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLL-----VLAYGSH 401
            ++F   G E+       R + +  +K    N  FF         +F +     ++ +GS 
Sbjct: 1260 RAF---GDEI-------RFIMHNLEKIDENNKPFFYLWVANRWLAFRIDMIGALIIFGSG 1309

Query: 402  LVLQGNLTIGD-------LTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDY- 453
            + +  NL   D       LT  + +TE        L  FYS +     +  RL E +D  
Sbjct: 1310 VFILLNLNRIDSGMAGISLTYAISFTE----GALWLVRFYSTVEMNMNSVERLKEYMDVP 1365

Query: 454  -----KPTIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGP 508
                 + TI ++T     P  GK+E + +S  Y      ++ K+++F IEP + V IVG 
Sbjct: 1366 QEPYNEGTITTSTNW---PTEGKIEVKDLSLRY-AENLPRVIKEVSFDIEPHNMVGIVGR 1421

Query: 509  SGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENI 568
            +G GKSTI + L R+  P +G I +DG DIT +  ++LRR + ++ Q+P L +GTIR N+
Sbjct: 1422 TGAGKSTIITALFRFLEPETGSIKIDGIDITSIDLQTLRRSITIIPQDPTLFTGTIRSNL 1481

Query: 569  TYGVSRQPSMEEIRSVAKKCFCH----------------AFISKFPNGYETIIGPRGALL 612
                 + P  E  R + +                       ++KF N  E  I   G  L
Sbjct: 1482 D-PFGKYPDEEIFRVLHRVNLIDDDEMTAQSSDNNSLSSDNVNKFLN-LENEITEGGNNL 1539

Query: 613  SGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRL 672
            S GQKQ + +ARALL  PK+++LDEAT+++D  S+  I  T+  +      T+++IAHRL
Sbjct: 1540 SQGQKQLMCLARALLRNPKVILLDEATASIDYASDAKIQQTIRNVFDKS--TVLTIAHRL 1597

Query: 673  STIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
             ++   + ++V+   G V+E  +   L  + +S  + +
Sbjct: 1598 RSVIDYDKILVMD-AGEVIEYDQPYTLLLDKNSHFYSM 1634

 Score =  105 bits (261), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 109/459 (23%), Positives = 205/459 (44%), Gaps = 30/459 (6%)

Query: 250 VGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLV 309
           +G +++ +  DA+ VS  +   +    +A++   V   +++ +    A V  L    +++
Sbjct: 494 IGAIINLMAVDAFKVSE-ICAYLHTFIEAMVMSVVAFSLLYKLLGYAAIVGIL----IVI 548

Query: 310 GATIYGNKIRAISRELQQASGNLT----KVAEEQLSGIKTVQSFVAEGK---EVHRYNNA 362
           G      K+ ++  + Q+ +  +T    +   E L  I+ ++ F  E     E+     A
Sbjct: 549 GMIPVNFKLVSLMGKYQKKALGITDKRIQKLNEALQAIRIIKFFSWEDNFFSEIDEIREA 608

Query: 363 VRQVF-NVGKKEAFTNATFFSSTNVLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTE 421
             Q++ N     AF+   +F +  ++   SF  V  Y    VL   +    L  F L  +
Sbjct: 609 EIQMYINKAYAWAFSAFIWFLTPTIVTGASFT-VYIYVQKQVLTAPVAFTALALFQLLKQ 667

Query: 422 YTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIKSTTGKAFKPLNGKVEFQHVSFSY 481
                   LS   S +++   +  R+   LD + T K    K   P   K+ F++ + ++
Sbjct: 668 PLDQ----LSNMLSYVIQSKVSLDRVQNFLDEEDTQKYNQLKV-APDGNKLAFENATIAW 722

Query: 482 PTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILV---DGQDI 538
                +   KDL+   + G    ++GP+G GK+++   LL      SG+I+V   D +  
Sbjct: 723 SNNNQDFKLKDLDINFKIGKLNVVIGPTGSGKTSLLLALLGEMQLLSGRIVVPSLDARHE 782

Query: 539 TKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEE-IRSVAKKCFCHAFISKF 597
             + S  +   +    Q   L++ T+R NI +     P  E+  + V   C        F
Sbjct: 783 MLIDSDGMTNSIAYCSQSAWLLNDTVRNNILF---YSPYNEDRYKEVIIACGLKRDFELF 839

Query: 598 PNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAI--NYTLG 655
             G +T IG +G  LSGGQKQRI++ARAL +  + L+LD+  SA+D  +   I  N   G
Sbjct: 840 DAGDQTEIGEKGITLSGGQKQRISLARALYSNCRHLLLDDCLSAVDSHTAAWIYDNCITG 899

Query: 656 RLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMG 694
            LM+ +  T + ++H ++   ++  ++V+  +G +   G
Sbjct: 900 PLMEGR--TCVLVSHNIALTLKNAELVVMLENGRITNRG 936

>TDEL0E05610 Chr5 (1038912..1043519) [4608 bp, 1535 aa] {ON} Anc_4.52
            YLL015W
          Length = 1535

 Score =  157 bits (396), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 148/534 (27%), Positives = 248/534 (46%), Gaps = 56/534 (10%)

Query: 211  NFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQ 270
            N   +VLL     R  A+L   + K  +   M F++   VG +++R  +D   V  ++  
Sbjct: 1012 NLRTIVLLLFCTIRGAAQLHDTMAKTVLRSPMSFFETTPVGRIINRFSSDVQAVDSTLQW 1071

Query: 271  NISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQ--- 327
              +  F++++   V + +   IS  +   L + A  LL+    Y      +SREL++   
Sbjct: 1072 VFAFFFRSILNYAVTVIL---ISYNMPWFLIVNAV-LLIIYIYYQAFYITLSRELKRLTS 1127

Query: 328  -ASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATF-FSSTN 385
             ++  +  +  E L G   + +F    K   R++       N    +   N +F F STN
Sbjct: 1128 VSTSPIMSLFSETLGGHAVINAF----KHFDRFD-----FINFNNVQFNINCSFNFRSTN 1178

Query: 386  --------VLGDFSFLLVLAYG----SHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTF 433
                     +G F   +VLA      S +  +  L+ G +   M Y     S++  +   
Sbjct: 1179 RWLSVRLQTIGAF---IVLATALLALSTINSERRLSPGMVGLLMSYALQVTSSLMWIVRM 1235

Query: 434  YSELMKGAGAATRLFELLDYKP----TIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQI 489
              ++     +  R++E  +  P     I+S   K   P  G++ F++ S  Y T K +  
Sbjct: 1236 SVQIETNIVSVERIYEYCNLTPEAPEVIESCRPKKTWPSEGEIIFKNYSTKYKT-KGDLA 1294

Query: 490  FKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQ 549
             K +N +I+P   + +VG +G GKST++  L R    T G I +DG DI+K+  K LR  
Sbjct: 1295 LKGINLSIKPQEKIGVVGRTGAGKSTLSLALFRLLEATEGTIEIDGLDISKMGLKDLRSH 1354

Query: 550  LGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFI---------SKFPNG 600
            LG++ Q+     GT+R N+      Q S EE+ +  +       I         S+ P  
Sbjct: 1355 LGIIPQDAQAFEGTVRSNL--DPFEQYSTEELWASIELSHLKPHIVEMFRKEDNSELPAS 1412

Query: 601  YETI----IGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGR 656
             E +    I   G  LS GQ+Q + ++RALLN  K+L+LDEAT+A+D+E++  I  T+  
Sbjct: 1413 KEKMLDVKISENGGNLSVGQRQLLCLSRALLNTSKVLVLDEATAAVDMETDKIIQETIRS 1472

Query: 657  LMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
             +K K  TI++IAHR+ T+  S+ +IVL   G V E    ++L +N  S  + L
Sbjct: 1473 ELKEK--TILTIAHRIDTVLDSDKIIVLD-AGQVKEFDTPENLLSNKQSIFYAL 1523

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 67/224 (29%), Positives = 117/224 (52%), Gaps = 19/224 (8%)

Query: 495 FTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQ--LGV 552
           F  + G   CIVG  G GKST+   +L       G++      +  L  K L R   +  
Sbjct: 644 FQAKKGELTCIVGRVGSGKSTMLRAIL-------GQLPCVNASVGGLEPKVLIRASTVAY 696

Query: 553 VQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALL 612
             QEP +M+ +I++NIT+G     +     +  K C     +   P    T++G +G  L
Sbjct: 697 CPQEPWIMNASIKDNITFGFRYDETY--YNATIKACQLLPDLDILPERDNTLVGEKGISL 754

Query: 613 SGGQKQRIAIARALLNKPKILILDEATSALDVE-SEGAINYTLGR---LMKSKELTIISI 668
           SGGQK RI++ARA+ ++  + +LD+  SA+D E S+  +   L +   L+++K  T++  
Sbjct: 755 SGGQKARISLARAVYSRADLFLLDDILSAVDAEVSKNIVEMVLDKKMGLLRNK--TVVLT 812

Query: 669 AHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHD-SALHKLL 711
            + +S + RS+ + +L   GS+VE G F ++ ++ + S L K++
Sbjct: 813 TNAISVLNRSQKIYMLE-GGSIVEEGSFTEVTSSPEPSKLKKMI 855

>Ecym_4265 Chr4 (560254..564771) [4518 bp, 1505 aa] {ON} similar to
            Ashbya gossypii AGR047W
          Length = 1505

 Score =  155 bits (393), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 143/501 (28%), Positives = 226/501 (45%), Gaps = 35/501 (6%)

Query: 227  ARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGI 286
            ARL   + K  +   M F++   VG +L+R   D Y V   + ++ S  F  +    V  
Sbjct: 1015 ARLHDAMAKAVLRAPMSFFETTPVGRILNRFSNDIYKVDELLGRSFSQFF--IHVTKVVF 1072

Query: 287  GMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVA-----EEQLS 341
             M+   S T   + F+   PL V    Y       SREL++ + ++TK       +E L+
Sbjct: 1073 TMIVICSITWQFIFFIL--PLSVLYLFYQQYYLRTSRELRRLA-SVTKSPVYAHFQETLT 1129

Query: 342  GIKTVQSFVAEGKEVH-------RYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLL 394
            G+ TV+SF  + + +H        Y  A     N  +  AF           +G    L 
Sbjct: 1130 GVTTVRSFKKQDRFIHINQSRINTYMCAYYLSINANRWLAF-------RLEFMGSIVILA 1182

Query: 395  VLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYK 454
                    + QG LT G L   + Y      ++  +     E+     +  R+ E  D K
Sbjct: 1183 AAVLSVFRLKQGKLTAGMLGLGLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYTDLK 1242

Query: 455  P----TIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSG 510
            P     I ++      P NG ++F+H S  Y   + + I +D+N  I P   V IVG +G
Sbjct: 1243 PEAPMIIPTSRPPKNWPANGDIKFEHFSTRYRP-ELDLILEDINLHIHPREKVGIVGRTG 1301

Query: 511  RGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITY 570
             GKS++   L R     +G+IL+D   I  +    LR  L ++ Q+  +  GT RENI  
Sbjct: 1302 AGKSSLTVSLFRLIEAAAGRILIDDLPIDSIGLNDLRSSLSIIPQDSEVFEGTFRENI-- 1359

Query: 571  GVSRQPSMEEIRSVAKKCFCHAFISKF-PNGYETIIGPRGALLSGGQKQRIAIARALLNK 629
                + + +EI +  +       +      G  T +   G+ LS GQ+Q + +ARALL  
Sbjct: 1360 DPCNKFTDDEIWNALELAHLKQHVMTLGTEGLNTSLKEGGSNLSVGQRQLMCLARALLVP 1419

Query: 630  PKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGS 689
             KIL+LDEAT+A+DVE++  I  T+    K +  TI++IAHRL+TI  S+ ++VL   G 
Sbjct: 1420 SKILVLDEATAAIDVETDKLIQRTIRTAFKDR--TILTIAHRLNTIMDSDKIVVLD-KGR 1476

Query: 690  VVEMGKFKDLYANHDSALHKL 710
            + E     +L  +  S  + L
Sbjct: 1477 IAEFDTPCNLLKDETSIFYSL 1497

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 68/224 (30%), Positives = 112/224 (50%), Gaps = 21/224 (9%)

Query: 491 KDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQL 550
           K++NF    G   CIVG  G GKS +   +L             G       S +L   +
Sbjct: 635 KNINFQARKGELSCIVGKVGTGKSALIQAML-------------GDLFRVKGSATLHGSV 681

Query: 551 GVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGA 610
             V Q   +M+GTI++NI +G        E     K C     ++  P+G +T +G RG 
Sbjct: 682 AYVSQVSWIMNGTIKDNILFGYKYDAEFYE--KTIKACALSLDLNTLPDGDQTFVGERGI 739

Query: 611 LLSGGQKQRIAIARALLNKPKILILDEATSALDVE-SEGAINYTLGR--LMKSKELTIIS 667
            LSGGQK R+A+ARA+  K  +  LD+  +A+D   S+  + Y +G   L+K+K  T I 
Sbjct: 740 SLSGGQKARLALARAVYAKADVYFLDDPLAAVDEHVSKHLVKYVIGPTGLLKTK--TRIL 797

Query: 668 IAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLL 711
             +++  +  ++++ +L  +G +V+ G +  + +N DS L KL+
Sbjct: 798 TTNKIHVLSVADSITLLD-NGVIVQQGSYDQVNSNKDSPLFKLI 840

>NDAI0B00640 Chr2 (141258..145733) [4476 bp, 1491 aa] {ON} Anc_5.10
          Length = 1491

 Score =  155 bits (392), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 145/529 (27%), Positives = 246/529 (46%), Gaps = 50/529 (9%)

Query: 214  RVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNIS 273
            +  LL  +G R    L    + + +H  M + D   +G +L+R   D   +   +T++I 
Sbjct: 969  QFTLLCAIGIRASKWLNLKAVHRILHTPMSYLDTTPLGRILNRFTKDTDSLDNELTESIR 1028

Query: 274  DG-FKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNL 332
               F+     GV +  + ++     ++ FLF     +G T+  +  ++  RE+++     
Sbjct: 1029 LMLFQTANIVGVCVMCIIYLPWFAIAIPFLF-----IGFTLITDHYQSTGREVKRLEAIQ 1083

Query: 333  TKVA----EEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTN---ATFFSSTN 385
                     E L G+ T++S+ +E + + + +  + ++   G          A F     
Sbjct: 1084 RSFVYNNFNEILGGMDTIKSYGSEERFLAKSDYLINKMNEAGYLSVALQRWVAIFLDLVA 1143

Query: 386  VLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGA---- 441
            V   F+ ++ L   +       +++G L  ++L      + V    T     M  A    
Sbjct: 1144 VC--FALIITLLCVTRAFHISAVSVGVLLTYVLQLPGLLNGVLRALTQTENDMNSAERLV 1201

Query: 442  GAATRL-FELLDYKPTIKSTTGKAFKPLNGKVEFQHVSFSY-PTRKTNQIFKDLNFTIEP 499
              AT L  E    +P +         P  GK+EF+HV FSY P      + KDL+  I+ 
Sbjct: 1202 SYATELPLEAAYRRPEVSPPENW---PSEGKIEFKHVDFSYRPGLPI--VLKDLDLDIKS 1256

Query: 500  GSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPIL 559
            G  + I G +G GKSTI S L R    + G+IL+D  DI+KL    LRR+L ++ Q+P+L
Sbjct: 1257 GEKIGICGRTGAGKSTIMSALYRLNEISQGEILIDNVDISKLGLYDLRRKLAIIPQDPVL 1316

Query: 560  MSGTIREN----------------ITYGVSRQPSMEEIRSV-AKKCFCHAFISKFPNGYE 602
              GTIR+N                +  G   + ++ +I++    K   HA + KF    +
Sbjct: 1317 FRGTIRKNLDPFNEHDDDLLWDSLVRGGAIERAALNKIKNQKVDKDGTHADMFKF--HLD 1374

Query: 603  TIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKS-K 661
             ++   GA  S G++Q +A+ RAL+ + K+LILDEATS++D E++G I     R++K   
Sbjct: 1375 QLVEEEGANFSLGERQLLALTRALVRQAKVLILDEATSSVDYETDGKIQ---ARIVKEFG 1431

Query: 662  ELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
            + TI+ IAHRL+TI   + ++VL   G V E  K K L+   DS    +
Sbjct: 1432 DCTILCIAHRLNTILNYDRILVLE-KGEVAEFEKPKVLFDQEDSIFRSM 1479

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 75/224 (33%), Positives = 108/224 (48%), Gaps = 22/224 (9%)

Query: 490 FKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQ 549
           F D+   I+ G  + +VGP G GK++  + L  + N T G+I V+G D+           
Sbjct: 627 FHDITLDIKKGEFIIMVGPIGTGKTSFLNALAGFMNKTEGRIQVNG-DL----------- 674

Query: 550 LGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRG 609
             ++   P + + T+R+NI +G        E   V + C   A +   P G  T IG RG
Sbjct: 675 --LLCGYPWIQNATVRDNILFGSPYDKKKYE--EVLRCCSLEADLDILPAGDSTEIGERG 730

Query: 610 ALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAI--NYTLGRLMKSKELTIIS 667
             LSGGQK RI +AR +  K  I + D+  SA+D      I     LG L   K  T I 
Sbjct: 731 ITLSGGQKARINLARCVYKKKDIYLFDDVLSAVDSRVGKHIMDECFLGLL---KNETRIL 787

Query: 668 IAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLL 711
             H+LS + R+  VIVLG DGS  E+G    L   + + ++ LL
Sbjct: 788 ATHQLSLLERASRVIVLGTDGS-FEIGPVDVLKRTNQTLINLLL 830

>NCAS0J00160 Chr10 complement(12361..17325) [4965 bp, 1654 aa] {ON} 
          Length = 1654

 Score =  155 bits (392), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 136/521 (26%), Positives = 235/521 (45%), Gaps = 39/521 (7%)

Query: 214  RVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNIS 273
            +V++   LG +   ++  +++KK MH  + F+D   +G +++R   D   + + +   + 
Sbjct: 1126 KVLINFFLGVKASRKIFIDLLKKVMHSKLRFFDSTPIGRIMNRFSKDIEAIDQELAPVVQ 1185

Query: 274  DGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLT 333
              F +L+     I ++  I+    SV  L      +    Y    R   R        + 
Sbjct: 1186 GAFYSLVSCVTTILLITFITPQFLSVAILVTGLYYLIGYFYLAASREFKRFDSITKSPIY 1245

Query: 334  KVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSF- 392
            +   E L G+ T+++F  EG+ +           N+ K +   N  FF         SF 
Sbjct: 1246 QHFSETLVGVTTIRAFGDEGRFMQE---------NLSKIDE-NNRPFFYLWVANRWLSFR 1295

Query: 393  ------LLVLAYGSHLVLQ-GNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAAT 445
                  L+V   GS ++    N+  G     + Y          L   YS +     +  
Sbjct: 1296 IDMVGALVVFGSGSFIIWNIKNIDAGMAGISLTYAISFTEGALWLVRLYSNVEMNMNSVE 1355

Query: 446  RLFELL--DYKPTIKST-TGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSN 502
            RL E +  + +P   +T T     P  GK+E   +S  Y      ++ K++ FT+ P + 
Sbjct: 1356 RLKEYMKIEQEPYEDATCTPPPEWPQEGKIEVCDLSLRY-AEGLPRVIKNVTFTVAPKAK 1414

Query: 503  VCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSG 562
            + IVG +G GKSTI + L R+ +P +G I +D  DIT ++   LRR + ++ Q+P L +G
Sbjct: 1415 IGIVGRTGAGKSTIITALFRFLDPETGYIKIDNIDITSINLNKLRRSINIIPQDPTLFTG 1474

Query: 563  TIRENIT-YGVSRQPSM-----------EEIRS-VAKKCFCHAFISKFPNGYETIIGPRG 609
            TI+ N+  YG      M           E++ S +  +      ++KF N     I   G
Sbjct: 1475 TIKSNLDPYGEYSDEDMFTALRRVNLVPEDVSSNIETESISSQNVNKFLN-LNNEISEGG 1533

Query: 610  ALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIA 669
            + LS GQ+Q + +AR+LL  PKI++LDEAT+++D  S+  I  T+ +   S   TI++IA
Sbjct: 1534 SNLSQGQRQLVCLARSLLRSPKIMLLDEATASIDYNSDAKIQETIRKEFNSS--TILTIA 1591

Query: 670  HRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
            HRL ++   + ++V+   G V E      L  N  S  + +
Sbjct: 1592 HRLRSVIDYDKILVMD-AGEVKEYDHPYSLLLNKKSIFYNM 1631

 Score = 88.2 bits (217), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 105/461 (22%), Positives = 204/461 (44%), Gaps = 34/461 (7%)

Query: 250 VGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGMMFHI---SSTLASVLFLFAPP 306
           +G +++ +  DA+ VS  +   +    +A +   + + +++ +   S+ + +++ L A P
Sbjct: 490 LGGIINLMAVDAFKVSE-VCAYLFAFVEATVMAIISLTLLYRLIGSSAIIGTIVILIAAP 548

Query: 307 L-LVGATIYGNKIRAISRELQQASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQ 365
                AT+ G     I +     +    +   E L  I+ ++ F  E       N+   Q
Sbjct: 549 ANYYFATLLGK----IQKATLLVTDKRIQKLNESLQAIRIIKFFSWEDNFEKSINDVREQ 604

Query: 366 VFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAYGSHLVLQGNL--TIGDLTAFMLYTEYT 423
              +  K +   A   SS       S +   A+  ++ +Q  +  T    TA  L+T   
Sbjct: 605 ELQLLLKRSM--AWVCSSFVWFVTPSLVTAAAFAFYIYVQKEVLTTPIAFTALSLFT-LL 661

Query: 424 GSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIKSTTGK----AFKPLNGKVEFQHVSF 479
            + +  LS   S +++   +  R+ + L     +++ T K       P   ++EF++ + 
Sbjct: 662 RNPLDQLSDMLSFVIQSKVSLDRIRDFL-----LETDTAKYDQLTVAPQGDQLEFKNTTV 716

Query: 480 SYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILV---DGQ 536
           S+ +   +   KDLN   + G    ++GP+G GK+++   LL       G+I+V   D +
Sbjct: 717 SWDSSAQDFKLKDLNIDFKIGKLNVVIGPTGSGKTSLLMALLGEMKIMEGEIIVPSLDPR 776

Query: 537 DITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSME-EIRSVAKKCFCHAFIS 595
           +   +        +    Q   L++ T+R NI +     P  E    SV + C       
Sbjct: 777 EDLVVDENGTTNSIAYCSQAAWLLNDTVRNNILFN---SPYNEARYTSVIEACGLKRDFE 833

Query: 596 KFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAI--NYT 653
               G  T IG +G  LSGGQKQR+++ARA+ +  + ++LD+  SA+D  +   I  N  
Sbjct: 834 ILKAGDMTEIGEKGITLSGGQKQRVSLARAMYSNSRHILLDDCLSAVDSHTALWIYDNCI 893

Query: 654 LGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMG 694
            G LM  +  T I ++H ++   ++ +++V+  DG V + G
Sbjct: 894 TGPLMDGR--TCILVSHNIALTLKNADLVVILEDGKVKDQG 932

>TBLA0G00710 Chr7 (157927..163002) [5076 bp, 1691 aa] {ON} Anc_4.6
            YHL035C
          Length = 1691

 Score =  154 bits (390), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 138/516 (26%), Positives = 236/516 (45%), Gaps = 51/516 (9%)

Query: 228  RLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALI-CGGVGI 286
            ++ ++++K ++H  + F+D   +G +++R   D   V + +   +   F  L+ C  + +
Sbjct: 1169 KMFNSLLKNSLHAKLRFFDSTPLGRIMNRFSKDIEAVDQEVPMYLGGTFACLVECFSIIV 1228

Query: 287  GMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEEQLSGIKTV 346
             +       L   +F+      VGA +Y +  R + R        + +   E L+GI TV
Sbjct: 1229 LITLITPQFLGVAIFIAVFYWFVGA-VYISGSRELKRFDSITKSPIYQHFSETLAGITTV 1287

Query: 347  QSFVAEGKEVHRYNNAVRQVFNVGKKEAF----TNATFFSSTNVLGDFSFLLVLAYGSHL 402
            +++  E     R+     +  +   K  F    +N      T ++G F   ++L  G   
Sbjct: 1288 RAYGDES----RFMRENLEKIDENNKPFFYMWVSNRWLSFRTQIIGAF---VILGAGGFS 1340

Query: 403  VLQGNLTIGDLTAFMLYTEYTGS-AVFGLSTFYSELMKGAGAATRLFELL--DYKPTIKS 459
            +   N     L    L    T S A   L  FY +      +  R+ E +  D +P  + 
Sbjct: 1341 IWNINKIDSGLAGISLTYALTFSDAALWLVRFYGDTEMNMNSTERIQEYMNIDQEPYNEG 1400

Query: 460  TTGK-AFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIAS 518
            T    A  P NGK+E   VS  Y      ++ K+++FT++  S V IVG +G GKSTI +
Sbjct: 1401 TVEPPADWPENGKIEINDVSLRYAPNLP-RVIKNVSFTVDSKSKVGIVGRTGAGKSTIIT 1459

Query: 519  LLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENI----TYG--- 571
             L R+  P +G I +D  DI  +  + LRR + ++ Q+P L +GTIR N+     Y    
Sbjct: 1460 ALFRFLEPETGNIKIDNIDIVSIDLQKLRRSISIIPQDPTLFTGTIRSNLDPYTQYSDKE 1519

Query: 572  ----------VSRQ-------PSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSG 614
                      VSR+       PS  +  S+  + F H          E  +   G+ +S 
Sbjct: 1520 IFDSLICVNLVSREELAQVQSPSSNDTSSIVSENFNHFL------DLEYNVSEGGSNISQ 1573

Query: 615  GQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLST 674
            GQ+Q + +AR+LL KPKI++LDEAT+++D ES+  I  T+     +   TI++IAHRL +
Sbjct: 1574 GQRQLLCLARSLLGKPKIILLDEATASIDYESDKKIQETIRNEFGNS--TILTIAHRLRS 1631

Query: 675  IRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
            +   + ++V+   G V E      L  N +S  + +
Sbjct: 1632 VIDYDKILVMDA-GEVEEYDHPYSLLLNKNSIFYSM 1666

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 62/233 (26%), Positives = 112/233 (48%), Gaps = 15/233 (6%)

Query: 470 GKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSG 529
            K+ F++ + S+     +   ++L+   + G    ++GP+G GK+++   LL     T G
Sbjct: 756 NKLSFKNATMSWGNDNDSFKLRNLDIDFKIGQLNVVIGPTGSGKTSLLMALLGEMTLTEG 815

Query: 530 KILVDGQDITK---LSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVA- 585
           +I +   D      + S      +    Q   L++ T+R NI +         +   VA 
Sbjct: 816 QINIPSLDPRHDLIIESDGHTNSIAYCSQAAWLLNDTVRNNILFNSPYNKDRYDAAIVAA 875

Query: 586 --KKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALD 643
             K+ F          G  T IG RG  LSGGQKQRI++ARAL +  + ++LD+  SA+D
Sbjct: 876 GLKRDF-----EILAAGDLTEIGERGITLSGGQKQRISLARALYSNARHVLLDDCLSAVD 930

Query: 644 VESEGAI--NYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMG 694
             +   I  N   G LM+ +  T + ++H ++   ++ +++V+  +G V + G
Sbjct: 931 AHTAAWIYDNCISGPLMEGR--TCVLVSHNIALTLKNASLVVMLKNGRVADQG 981

>NCAS0C05930 Chr3 (1220180..1225153) [4974 bp, 1657 aa] {ON} Anc_4.6
          Length = 1657

 Score =  153 bits (387), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 132/510 (25%), Positives = 248/510 (48%), Gaps = 65/510 (12%)

Query: 213  GRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNI 272
             + VL  +LG R   ++  +++ +T+H  + F+D   +G +++R   D   V + +T  +
Sbjct: 1125 SKSVLNFVLGIRASRKIFESLLYRTLHAKLGFFDATPIGRIMNRFSKDIESVDQELTPYL 1184

Query: 273  SDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIY--GNKIRAISRELQQ--- 327
               F  L+     + ++  I+    SV       +LVG   Y  G    A SREL++   
Sbjct: 1185 EAAFFCLVQCIATMALITFITPQFLSV------AILVGCLYYLVGYFYMAASRELKRFES 1238

Query: 328  -ASGNLTKVAEEQLSGIKTVQSFVAEGK----EVHRYNNAVRQVFNVGKKEAFTNATFFS 382
             +   + +   E L G+ T++++  E +     +H+ +   +  F +     F     F 
Sbjct: 1239 ISKSPIYQHFSETLVGVATIRAYGDESRFMLENLHKIDENNKPFFYLW---VFNRWLSFR 1295

Query: 383  STNVLGDFSFLLVLAYGSHLVLQGNLTIGD-------LTAFMLYTEYTGSAVFGLSTFYS 435
              +++G F     + +G+ + +  N+   D       LT  + +TE        L  FY+
Sbjct: 1296 -IDMIGAF-----VIFGAGVFILTNIKNIDSGMAGISLTYAISFTE----GALWLVRFYA 1345

Query: 436  ELMKGAGAATRLFELLD--------YKPTIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTN 487
            ++     +  RL E ++        YK T+         P NGK+E + +S  Y      
Sbjct: 1346 DVEMNMNSVERLKEYMEIEQEPYDEYKDTLLHDEW----PSNGKIEVKDLSLRYAP-NLP 1400

Query: 488  QIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLR 547
            ++ K+++F +EP + + IVG +G GKSTI + + R+ NP SG I +D  +I  ++   LR
Sbjct: 1401 KVIKNVSFVVEPKTKIGIVGRTGAGKSTIITAMFRFLNPESGYIKIDDVNIASINLTKLR 1460

Query: 548  RQLGVVQQEPILMSGTIRENI----------TYGVSRQPSM---EEIRSVAKKCFCHAFI 594
            R + ++ Q+P L +GTI+ N+           +   ++ ++   EE+++   +       
Sbjct: 1461 RSITIIPQDPTLFTGTIKLNLDPYNEFTDDAIFEALKRVNLVTEEELQNNGTQTGTSENA 1520

Query: 595  SKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTL 654
            +KF N  E  I   G+ LS GQ+Q + +AR+LL  PKI++LDEAT+++D  S+  I  T+
Sbjct: 1521 NKFLN-LENEITEGGSNLSHGQRQLVCLARSLLRNPKIILLDEATASIDYASDAKIQETI 1579

Query: 655  GRLMKSKELTIISIAHRLSTIRRSENVIVL 684
             +  +  + TI++IAHRL ++   + +IV+
Sbjct: 1580 RK--EFSQSTILTIAHRLRSVIDYDKIIVM 1607

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 117/474 (24%), Positives = 214/474 (45%), Gaps = 58/474 (12%)

Query: 250 VGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLV 309
           +G +++ +  DA+ VS  +   +    +A+I   V I +++ +    A V       L++
Sbjct: 492 LGAIINLMAVDAFKVSE-ICGYLHFFVEAVIMVFVAITLLYKLLGYAAFV----GAALII 546

Query: 310 GATIYGNKIRAISRELQQASGNLT----KVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQ 365
                  K+     +LQ+ S   T    +   E L  I+ ++ F  E       +N  R 
Sbjct: 547 ACLPLNLKLATFLGKLQKESLGFTDKRIQKLNETLQAIRIIKFFSWE-------DNFSRD 599

Query: 366 VFNVGKKE-----------AFTNATFFSSTNVLGDFSFLLVLAYGSHLVLQGNL--TIGD 412
           +  V +KE           AF++  +F + +++   SF        ++ +QG +  T   
Sbjct: 600 IKEVREKELHLLLKRSLIWAFSSFVWFVTPSIVTSASF------AFYIYVQGEVLTTPVA 653

Query: 413 LTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIKSTTGKAFKPLNGKV 472
            TA  L+T    + +  LS   S +++   +  R+ + L  + T K       K L  ++
Sbjct: 654 FTALSLFT-LLKTPLDQLSNMISFVIQSKVSLDRIQDFLGEQDTDKYNQLTIDK-LGNRI 711

Query: 473 EFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKIL 532
            F++V+ ++   + +   +DLN   +PG+   ++GP+G GK+++   LL       G+I+
Sbjct: 712 AFKNVTVTWDNGEEDFKLRDLNIEFKPGALNVVIGPTGSGKTSLLLALLGEMCLEKGEII 771

Query: 533 VDG----QDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEE-IRSVAKK 587
           V      QD+  +    L   +    Q   L++ T+R NI +     P  EE   +V   
Sbjct: 772 VPALNPRQDLV-IDKFGLTNSIAYCSQAAWLLNETVRNNILFN---SPYNEERYNAVIDA 827

Query: 588 CFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESE 647
           C     +        T IG +G  LSGGQKQR+++ARAL +  K ++LD+  SA+D  + 
Sbjct: 828 CGLRRDLKILKASDMTEIGEKGITLSGGQKQRVSLARALYSNSKHVLLDDCLSAVDSHTA 887

Query: 648 GAI--NYTLGRLMKSKELTIISIAHRLS-TIRRSENVIVLGIDGSVVEMGKFKD 698
             I  N   G LM  +  T I ++H ++ T++ +E V++L       E G+ KD
Sbjct: 888 LWIYDNCITGPLMSGR--TCILVSHNIALTLKNAELVVIL-------ENGRVKD 932

>NDAI0J01150 Chr10 complement(262920..267473) [4554 bp, 1517 aa] {ON}
            Anc_8.303
          Length = 1517

 Score =  152 bits (385), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 146/516 (28%), Positives = 243/516 (47%), Gaps = 46/516 (8%)

Query: 216  VLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDG 275
            V   I G R +  L +N +   +   M F++   +G +L+R   D Y V   + +  S  
Sbjct: 1018 VFCTIQGSRYLHTLMTNAV---LRAPMSFFETTPIGRILNRFSNDIYKVDSVLGRTFSQF 1074

Query: 276  FKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKV 335
            F   +     IG+   I  T    +F+  P L V    Y       SREL++   ++T+ 
Sbjct: 1075 FVNAVKVSFTIGV---ICVTTWQFIFVIVP-LGVFYIYYQQYYLRTSRELRRLD-SITRS 1129

Query: 336  A-----EEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDF 390
                  +E L GI T++ +  + K   + N    +V N         + F+ S N     
Sbjct: 1130 PVYSHFQETLGGIVTIRGY-GQQKRFSQINQC--RVDN-------NMSAFYPSVNANRWL 1179

Query: 391  SFLLVLAYGSHLVL-----------QGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMK 439
            ++ L L  GS ++L           QG LT G +   + Y      ++  +     E+  
Sbjct: 1180 AYRLELI-GSIIILGAATLSVMRLKQGTLTAGMVGLSLSYALQITQSLNWIVRMTVEVET 1238

Query: 440  GAGAATRLFELLDYKP----TIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNF 495
               +  R+ E  D K      I+    +   P  G ++F+H S  Y   + + + KD+NF
Sbjct: 1239 NIVSVERIKEYADLKSEAPEIIEDHRPQETWPEEGDIKFEHYSTRYRP-ELDLVLKDINF 1297

Query: 496  TIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQ 555
             I+P   + IVG +G GKS++   L R    + G I++D  DI+ +    LR +L ++ Q
Sbjct: 1298 HIKPKEKIGIVGRTGAGKSSLTLALFRIIEASEGNIIIDNVDISDIGLYDLRHKLSIIPQ 1357

Query: 556  EPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKF-PNGYETIIGPRGALLSG 614
            +  +  GTIRENI    + Q + E+I  V +       I+    +G +T +   G+ LS 
Sbjct: 1358 DSQVFEGTIRENI--DPTNQYTDEQIWRVLELSHLRDHIATMGGDGLDTKLNEGGSNLSV 1415

Query: 615  GQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLST 674
            GQ+Q + +ARALL   KIL+LDEAT+A+DVE++  +  T+    K +  TI++IAHR++T
Sbjct: 1416 GQRQLMCLARALLVPSKILVLDEATAAVDVETDKVLQETIRTSFKDR--TILTIAHRINT 1473

Query: 675  IRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
            I  ++ ++VL  +GS+ E  + K L  N  S  + L
Sbjct: 1474 IMDNDRIMVLD-NGSIKEFDEPKKLLENKSSLFYSL 1508

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 101/452 (22%), Positives = 190/452 (42%), Gaps = 60/452 (13%)

Query: 290 FHISSTLASVLFLFAPPLLVGATIY------GNKIRAISRELQQASGNL----TKVAEEQ 339
           F I   L S+  L    + VG  I        + +    ++LQ++        T+V  E 
Sbjct: 430 FQIVLCLISLYKLLGHSMWVGVIILVIMMPLNSFLMKTQKKLQKSQMQFKDERTRVISEI 489

Query: 340 LSGIKTVQSFVAEGK-----EVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLL 394
           L+ IK+++ +  E       E  R N  ++ +  +G   A  +  F +    L   S   
Sbjct: 490 LNNIKSLKLYAWETPYKAKLENVRNNKELKNLTKLGCYMALMSFQF-NVVPFLVSCSTFA 548

Query: 395 VLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYK 454
           V  Y     L  +L    LT F L        +  +    + L++ + +  RLF  L  +
Sbjct: 549 VFVYTEDRPLTTDLVFPALTLFNL----LHFPLMVIPNVLTALIECSVSVGRLFSFLTNE 604

Query: 455 PTIKSTTGKAFKPLN-GKVEFQ---HVSFSYPTRKTNQI-FKDLNFTIEPGSNVCIVGPS 509
              K +  +  K    G V        +F +  +   ++  K++NF  + G   CIVG  
Sbjct: 605 ELQKDSVQRLPKVTEIGDVAINVGDDATFLWQRKPEYKVALKNVNFQAKKGELTCIVGRV 664

Query: 510 GRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENIT 569
           G GKS +   +L       G   + G              +  V Q   +M+GT+++NI 
Sbjct: 665 GSGKSALIQSILGDLFRVKGFATIHGN-------------VAYVSQVAWIMNGTVKDNIL 711

Query: 570 YGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNK 629
           +G   +   E      K C     +S   +G +T++G +G  LSGGQK R+++ARA+ ++
Sbjct: 712 FG--HKYDAEFYEKTIKACALTIDLSVLVDGDQTLVGEKGISLSGGQKARLSLARAVYSR 769

Query: 630 PKILILDEATSALDVE-SEGAINYTLG---------RLMKSKELTIISIAHRLSTIRRSE 679
               +LD+  +A+D   +   I + LG         +++ + +++++S+A  +S +    
Sbjct: 770 ADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTKTKVLATNKVSVLSVADSVSLLE--- 826

Query: 680 NVIVLGIDGSVVEMGKFKDLYANHDSALHKLL 711
                  +G +V+ G + ++  +  S L+KL+
Sbjct: 827 -------NGEIVQQGSYDEIMKDGASQLNKLI 851

>KNAG0J02730 Chr10 complement(512373..516986) [4614 bp, 1537 aa] {ON} 
          Length = 1537

 Score =  150 bits (380), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 144/535 (26%), Positives = 246/535 (45%), Gaps = 61/535 (11%)

Query: 211  NFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQ 270
            N   ++LL     R   +L  N+    ++  M+F++   +G +L+R  AD   V  ++  
Sbjct: 1022 NLRTIILLVYCTIRGAKKLHDNMAHAIVYSSMQFFETTPIGRILNRFSADIDTVDSTLQM 1081

Query: 271  NISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAI-SRELQQAS 329
                 FK++    + + ++     T++  LFL     L+   IY  K+  + SREL++ +
Sbjct: 1082 VFMVFFKSIFSYLITVILI-----TISMPLFLVFCLFLMVIYIYYQKLFIVQSRELKRMT 1136

Query: 330  G----NLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATF-FSST 384
                  +  +  E L G+  ++++  +   + +Y N  R  FN+       N  F + ST
Sbjct: 1137 SISYSPIMSLVGESLGGLAVIRAY--KHFSMFKYLNNERVQFNI-------NCVFDYRST 1187

Query: 385  NV-----LGDFSFLLVLAYG----SHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYS 435
            N      L     L+VL  G    S +     LT G +   M Y     +++  +     
Sbjct: 1188 NRWLSIRLQTIGALMVLITGMLSLSTISSSKPLTAGMVGLLMSYVLQVTTSLMWIVRSSV 1247

Query: 436  ELMKGAGAATRLFELL-----------DYKPTIKSTTGKAFKPLNGKVEFQHVSFSYPTR 484
             +  G  +  R+ E             DY+P        +  P  G ++F++ S  Y   
Sbjct: 1248 MIETGIVSVERIMEYCELPSEAEQIVDDYRPA-------SNWPSKGAIQFKNYSTRYRA- 1299

Query: 485  KTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSK 544
              + + K+++  I PG  V IVG +G GKST+   L R   P  G I++DG DI+K+   
Sbjct: 1300 NLDPVLKNISININPGEKVGIVGRTGAGKSTLTLALFRLLEPIEGTIIIDGMDISKIGIS 1359

Query: 545  SLRRQLGVVQQEPILMSGTIRENI-------TYGVSRQPSMEEIRSVAKKCFCHAFISKF 597
             LR  L ++ Q+     GT+R N+          +    ++  ++   KK    +  S+ 
Sbjct: 1360 DLRSHLAIIPQDAQAFEGTVRSNLDPFNMFSDKELDTAITLSHLKPHLKKLMEESG-SEL 1418

Query: 598  P-NGY-ETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLG 655
            P N Y E  I   G+ LS GQ+Q + +ARALLN+ KIL+LDEAT+++DVE++  I  T+ 
Sbjct: 1419 PLNDYLELGIKESGSSLSVGQRQLLCLARALLNRSKILVLDEATASVDVETDKIIQATIR 1478

Query: 656  RLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
                 +  TII+IAHR+ T+  S+ ++VL   G V E      L A+  +  ++L
Sbjct: 1479 ESFSDR--TIITIAHRIDTVLDSDRILVLE-QGEVKEFNSPASLLADKSTLFYQL 1530

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 114/238 (47%), Gaps = 35/238 (14%)

Query: 490 FKDLNFTIEPGSNV--CIVGPSGRGKSTIASLLLRYYNPTSG-------KILVDGQDITK 540
            KD++F      NV  C+VG  G GK+T+   +L     TSG       K+++ G+ +  
Sbjct: 648 LKDIDF-FRAKKNVLTCVVGRVGSGKTTLLKSILGQLPCTSGSQKAIPPKLIIRGESV-- 704

Query: 541 LSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNG 600
                         QE  +M+ +I+ENI +G     +   +    K C         P+G
Sbjct: 705 ----------AYCPQEAWIMNDSIKENILFGHRYDETFYNL--TVKACELRPDFKILPDG 752

Query: 601 YETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKS 660
             T++G +G  LSGGQK R+++ARA+ ++  I +LD+  SA+D     +I   + R++ S
Sbjct: 753 DNTLVGEKGITLSGGQKARLSLARAVYSRSDIYLLDDVLSAVDAGVRKSI---IHRVLDS 809

Query: 661 -----KELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSA--LHKLL 711
                K   II   + +S +  S+ + VL  DG ++E   + +   ++D    L+KLL
Sbjct: 810 DTGLLKNKAIILTTNDISVLEHSDRIYVLQ-DGRIIEESTYAEAIEDNDVKPFLYKLL 866

>CAGL0C03289g Chr3 (328799..333745) [4947 bp, 1648 aa] {ON} similar to
            uniprot|P32386 Saccharomyces cerevisiae YLL048c YBT1
            yeast bile transporter
          Length = 1648

 Score =  150 bits (378), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 132/503 (26%), Positives = 232/503 (46%), Gaps = 61/503 (12%)

Query: 220  ILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKAL 279
            + G R    +  +++ + +H  + F+D   +G +++R   D      S+ Q I    +++
Sbjct: 1116 LFGIRASKLIFDSLLDRVLHARVRFFDSTPIGRIMNRFSKDI----ESIDQEIPPNIQSV 1171

Query: 280  ICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQ----ASGNLTKV 335
                + +     + S +    F  A  +++G +I G      SREL++    +   + + 
Sbjct: 1172 FYSAIEVFATLLLISYITPAFFPVAIIIVLGYSIVGFFYLTTSRELKRLDSISKSPIFQH 1231

Query: 336  AEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSF--- 392
              E L G+ T+++F  E + +    + + Q           +  FF    V    SF   
Sbjct: 1232 FSETLVGVTTIRAFGDEQRFIKENLSMIDQ----------NSMPFFYLWVVNRWLSFRID 1281

Query: 393  ----LLVLAYGSHLVLQ-GNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRL 447
                L++ + G  ++L   N+  G     + Y      A   L   YSEL     +  R+
Sbjct: 1282 LIGALVIFSSGVFILLNINNIDAGLAGISLTYAISFTEAALWLVRQYSELEMNMNSVERV 1341

Query: 448  FELLDYK--PTI----KSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGS 501
             E ++ +  P I     + T     P +GKVE  ++S  Y       + KD+ FTIEP  
Sbjct: 1342 LEYMNIEQEPLIADPANAVTPPPQWPDSGKVEVNNLSLKYAPH-LPYVIKDVTFTIEPLE 1400

Query: 502  NVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMS 561
             V IVG +G GKSTI + L R+    +G I +DG +I  +  K LRR + ++ Q+P L +
Sbjct: 1401 KVGIVGRTGAGKSTIITALFRFLEADTGSIKLDGVNIANIDLKRLRRSITIIPQDPTLFA 1460

Query: 562  GTIREN-----------ITYGVSR---------QPSMEEIRSVAKKCFCHAFISKFPNGY 601
            G+IR N           I   + R         + S  EI+S + K      ++KF N  
Sbjct: 1461 GSIRSNLDPYDEYSDEEIFTALKRVNLVSTEEMEASTSEIQSNSSKN-----VNKFLN-L 1514

Query: 602  ETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSK 661
            E+ I   G+  S GQ+Q + +AR+LL  PK+++LDEAT+++D  S+  I  T+ +   + 
Sbjct: 1515 ESEIAEGGSNFSQGQRQLMCLARSLLRMPKVILLDEATASIDYNSDAKIQETIRQEFNNS 1574

Query: 662  ELTIISIAHRLSTIRRSENVIVL 684
              T+++IAHRL +I   + ++V+
Sbjct: 1575 --TVLTIAHRLRSIVDYDKILVM 1595

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 72/244 (29%), Positives = 119/244 (48%), Gaps = 20/244 (8%)

Query: 469 NGK-VEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPT 527
           NGK + F++V+  + + K + + ++L+     G    IVG +G GK++I   LL     +
Sbjct: 702 NGKRLAFENVTLRWDSDKDSFVLRNLDIEFMTGKLNVIVGATGSGKTSILMGLLGEMQLS 761

Query: 528 SGKILVDGQDITKLSSK-SLRRQLGVVQ-------QEPILMSGTIRENITYGVSRQPSME 579
            GKI+V       LS +   + Q GV+        Q   L++ T+R NI +      +  
Sbjct: 762 EGKIIVPS-----LSPRHEYQSQAGVINDSIAYCSQAAWLLNDTVRNNILFNAPFDQARY 816

Query: 580 EIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEAT 639
           +  +V + C           G  T IG +G  LSGGQKQR+++ARAL +    L+LD+  
Sbjct: 817 D--AVVEACSLKRDFQILKAGDSTEIGEKGITLSGGQKQRVSLARALYSSAGHLLLDDCL 874

Query: 640 SALDVESEGAI--NYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFK 697
           SA+D  +   I      G LM+ +  T I + H ++   ++ + +V+  DG V E G   
Sbjct: 875 SAVDSHTALWIYDKCISGPLMEGR--TCILVTHNIALTMKNADFVVMIEDGKVKEKGTPI 932

Query: 698 DLYA 701
           +L A
Sbjct: 933 ELLA 936

>Suva_8.16 Chr8 complement(29573..34372) [4800 bp, 1599 aa] {ON}
            YHL035C (REAL)
          Length = 1599

 Score =  148 bits (374), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 143/528 (27%), Positives = 246/528 (46%), Gaps = 75/528 (14%)

Query: 228  RLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALI-CGGVG- 285
            ++  N++   +H  + F+D   +G +++R   D   V + +T  +      LI C  +  
Sbjct: 1079 KIFDNMLDLVLHAKIRFFDVTPIGRIMNRFAKDIEGVDQELTPYLEVTMFCLIQCTSIIF 1138

Query: 286  ----IGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRE--LQQASGNLTKVAEEQ 339
                I   F I + +  +L+ F     + A+    +I +I++    Q  S        E 
Sbjct: 1139 LITIITPHFLIVAVVVFILYYFVGMWYLTASRELKRIDSITKSPIFQHFS--------ET 1190

Query: 340  LSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSF------- 392
            L G+ T+++F  E + +    + + Q           N  FF  +  +  F+F       
Sbjct: 1191 LVGVCTIRAFGDEKRFILENLDKIDQ----------NNRAFFYLSVAVKWFAFRVDIIGA 1240

Query: 393  LLVLAYGSHLVLQ-GNLTIG----DLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRL 447
             +VLA GS +++  GN+  G     LT  +L+T+        L   YS       +  RL
Sbjct: 1241 FIVLASGSFILINIGNIDSGLAGISLTYAILFTD----GALWLVRLYSTFEMSMNSVERL 1296

Query: 448  FEL--------LDYKPTIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEP 499
             E          DY         ++  P +G++E  ++S  Y +     + K+++FTIEP
Sbjct: 1297 KEYSSIEQENYFDYNKDHIQELQQSSWPEHGQIEVDNLSLRYAS-NLPPVIKNVSFTIEP 1355

Query: 500  GSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPIL 559
             S V IVG +G GKSTI + L R   P +G I +DG DI+++   +LRR + ++ Q+PIL
Sbjct: 1356 QSKVGIVGRTGAGKSTIITALFRLLEPETGHIKIDGYDISQIDLVTLRRAITIIPQDPIL 1415

Query: 560  MSGTIRENI----------TYGVSRQPS------MEEIRSVAKKCFCHAFISKFPNGYET 603
             +GTI+ N+           + V  Q +      ME  +++      +   +KF N  +T
Sbjct: 1416 FTGTIKSNVDPCDEYDNKKIFKVLSQVNLISTGEMEAAQNMGDD--SNTARNKFVN-LQT 1472

Query: 604  IIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTL-GRLMKSKE 662
             I   G  +S G++Q + IAR+LL +PKI++LDEATS++D ES+  I   +     KS  
Sbjct: 1473 EITEGGQNISQGERQLLFIARSLLREPKIILLDEATSSIDYESDHLIQGIIRNEFNKS-- 1530

Query: 663  LTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
             TI++IAHRL ++   + V+V+   G + E     +L  N  S  + +
Sbjct: 1531 -TILTIAHRLRSVIDYDRVLVMD-AGEIKEYDHPYNLLKNEQSIFYSM 1576

 Score = 90.9 bits (224), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 122/474 (25%), Positives = 212/474 (44%), Gaps = 47/474 (9%)

Query: 250 VGDLLSRLGADAYIVSRSMTQNISDGF----KALICGGVGIGMMFHI--SSTLA--SVLF 301
           +G +++ +  D++ VS      IS  F    +A+I   + +G++F     S LA  S++ 
Sbjct: 447 LGTIINLISIDSFKVSE-----ISTYFYMTVQAIIMVLIVVGLLFKFLGISALAGISIIL 501

Query: 302 LFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEEQLSGIKTVQSFVAEG---KEVHR 358
           +  P     A + G   ++    LQ     + K+  E L  I+ V+ F  E    K++  
Sbjct: 502 MMFPLNFRLAELLGKFQKS---ALQCTDKRIAKL-NECLQNIRIVKYFAWENNISKDIKS 557

Query: 359 Y-NNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFM 417
              N +R +F      A ++  +F +  ++   +F + + +  H  L   L    L+ F 
Sbjct: 558 IRQNELRFLFQKALVWALSSFLWFVTPTLVTGVTFAIYI-FVQHQELNAPLAFTTLSLFT 616

Query: 418 LYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIKSTTGKAFKPLNGKVEFQHV 477
           L      + +  LS   S + +   +  R+ + ++   T K        P   K+EF++ 
Sbjct: 617 L----LKTPLDQLSNMLSFMNQSIVSLDRIVKFINEDDTEKYNQLTV-SPDENKIEFKNA 671

Query: 478 SFSY-PTRKTNQIFK--DLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVD 534
           + ++    K + IFK   LN T + G    I+G +G GKS +   LL   +  SG I V 
Sbjct: 672 TLTWNENDKDSTIFKLCGLNITFQIGKLNLILGSTGSGKSALLMGLLGELHLISGSITVP 731

Query: 535 G----QDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIR--SVAKKC 588
           G     D+       L        Q   L++ T++ NI +      + +++R   V   C
Sbjct: 732 GLEPRHDLIP-DHNGLTNSFAYCSQSAWLLNDTVKNNIIFN----GAYDDVRYKEVIDAC 786

Query: 589 FCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEG 648
                +   P G  T IG +G  LSGGQKQRI++ARA+ +  K ++LD+  SA+D  +  
Sbjct: 787 GLKRDLEILPAGDSTEIGEKGITLSGGQKQRISLARAVYSNAKHVLLDDCLSAVDSHTAV 846

Query: 649 AI--NYTLGRLMKSKELTIISIAHRLS-TIRRSENVIVLGIDGSVVEMGKFKDL 699
            I  N   G +M+++  T I + H +S TIR +   ++L  +G V   G  K L
Sbjct: 847 WIYENCITGPIMENR--TCILVTHNVSLTIREAYFAVILE-NGKVKNQGTIKQL 897

>Ecym_8418 Chr8 (874901..879937) [5037 bp, 1678 aa] {ON} similar to
            Ashbya gossypii ACL072C
          Length = 1678

 Score =  147 bits (372), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 138/525 (26%), Positives = 244/525 (46%), Gaps = 44/525 (8%)

Query: 214  RVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNIS 273
            +V+L  I G +   ++ + ++KK ++  + F+D    G +++R   D   +   +     
Sbjct: 1144 KVILSYISGLKASRKIFTLLLKKVLYAKLRFFDSTPTGRIMNRFSRDVEAIDEELIPFFE 1203

Query: 274  DGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLT 333
              F +L+     I ++ +I+     V   FA  + V   I G      SRELQ+   ++T
Sbjct: 1204 GAFASLVQCITTILLIGYITP----VFLFFAIVICVSYYIVGYFYLVGSRELQRFE-SIT 1258

Query: 334  KVA-----EEQLSGIKTVQSFVAEGK----EVHRYNNAVRQVFNVGKKEAFTNATFFSST 384
            K        E L G+ T+++F  E +     + + +   R  F +      TN       
Sbjct: 1259 KSPIHQHFSETLVGVTTIRAFGDERRFLADNLSKVDTHNRPFFYLW----VTNRWLAFRI 1314

Query: 385  NVLGDFSFLLVLAYGSHLVLQGN-LTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGA 443
            + +G F   ++LA G  ++L  N L  G     ++Y          L   YS +     +
Sbjct: 1315 DFIGAF---VILASGIFILLNVNSLDAGLAGISLIYAISFTEGALWLVRLYSNVEMTMNS 1371

Query: 444  ATRLFELL--DYKPTIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGS 501
              RL E +  + +P+          P  GK+E  ++S  Y +    ++ K++ FT+EP S
Sbjct: 1372 VERLKEYMKIEQEPSTGLYEPPPEWPDRGKIEVNNLSLRYAS-NLPKVIKNVTFTVEPQS 1430

Query: 502  NVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMS 561
             V IVG +G GKSTI + L R+ +P +G I +D  DIT +  K LR+ + ++ Q+P+L +
Sbjct: 1431 KVGIVGRTGAGKSTIITALFRFLDPDTGTIKLDNVDITSIRLKRLRQSITIIPQDPVLFA 1490

Query: 562  GTIRENI----TYGVSRQ-PSMEEIRSVAKKCFCHAFI------SKFPNGYETI-----I 605
            GTI+ N+     Y   R   +++ +  + ++      I        F N  + +     I
Sbjct: 1491 GTIKSNLDPYSEYADDRIFEALKRVNLIVQEELTPTDIPSSSSSLSFENVNKFLDLTSEI 1550

Query: 606  GPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTI 665
               G+ LS GQ+Q + +AR+LL  PK ++LDEAT+++D  S+  I  T+         TI
Sbjct: 1551 TEGGSNLSQGQRQLVCLARSLLRNPKAILLDEATASIDYASDAKIQQTIREEFSGS--TI 1608

Query: 666  ISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
            ++IAHRL +I   + V+V+   G + E      L  N  S  +++
Sbjct: 1609 LTIAHRLRSIIDYDKVLVID-SGELAEYDHPYTLLLNKGSLFYRM 1652

 Score = 79.0 bits (193), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 58/217 (26%), Positives = 110/217 (50%), Gaps = 11/217 (5%)

Query: 490 FKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDG----QDITKLSSKS 545
            K+LN   + G    IVGP+G GK+++   LL   N + GKI V      +D+  + +  
Sbjct: 730 LKNLNIDFKIGKLNVIVGPTGSGKTSLLMGLLGEINLSEGKIYVPALNPREDLV-VDADG 788

Query: 546 LRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETII 605
           +   +G   Q   L++ T+R NI +    + +     +V   C     +     G +T +
Sbjct: 789 MTDSIGYCSQSAWLLNDTLRNNILFSAPYEAN--RYNAVIHACGLTRDLEILNAGDQTEV 846

Query: 606 GPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAI--NYTLGRLMKSKEL 663
           G +G  LSGGQKQR+++ARA+ ++ + ++LD+  SA+D  +   I  +   G LM+ +  
Sbjct: 847 GEKGITLSGGQKQRVSLARAMYSRARHILLDDCLSAVDSHTAQWIYKHCITGPLMEGR-- 904

Query: 664 TIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLY 700
           T + ++H  +   ++ + +V+  +  V   G+  +L+
Sbjct: 905 TCVLVSHNTALTLKNADWVVILENAKVTAQGEPLELF 941

>KNAG0E01120 Chr5 (214592..219745) [5154 bp, 1717 aa] {ON} Anc_4.6
            YHL035C
          Length = 1717

 Score =  147 bits (372), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 144/541 (26%), Positives = 250/541 (46%), Gaps = 71/541 (13%)

Query: 214  RVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNIS 273
            +  L  I G     ++ + ++ K +H  + F+D   +G +++R   D   V + +T  ++
Sbjct: 1179 KTFLTYIFGINASRKIFAMLLNKVIHSKLRFFDTTPIGRIMNRFSKDIESVDQELTPYLT 1238

Query: 274  DGFKALI-CGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNL 332
              F + + C    I     + S +    F+ A  + +   + G    A SREL++   ++
Sbjct: 1239 GAFYSFVECFSTII-----LISWITPQFFVVAILISIMYYLVGYFYMAGSRELKRLD-SI 1292

Query: 333  TKVA-----EEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAF---TNATFFSST 384
            TK        E L G+ T+++F   G E+      + ++    K   +    N       
Sbjct: 1293 TKSPIYQHFSETLVGVTTIRAF---GDEMRFLKENLFKIDENNKPFFYLWVANRWLSFRI 1349

Query: 385  NVLGDFSFLLVLAYGSHLVLQGNLTIGD-------LTAFMLYTEYTGSAVFGLSTFYSEL 437
            +++G F     + +G+ + +  ++   D       LT  + +TE        L  FYSE+
Sbjct: 1350 DMIGSF-----VVFGAGVFILADIKNIDSGMAGISLTYAISFTE----GALWLVRFYSEV 1400

Query: 438  MKGAGAATRLFELL-------DYKPTIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIF 490
                 +  R+ E +       D K  I  T    + P  GK+E   +S  Y      ++ 
Sbjct: 1401 EMNMNSVERIKEYMSVEQEPYDIKDEIVRTPPTVW-PDEGKIEVNDLSLRYAA-NLPRVI 1458

Query: 491  KDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQL 550
            K+++FT+EP S V +VG +G GKSTI + L R+ +P SG I +D  DIT +    LRR +
Sbjct: 1459 KNVSFTVEPNSKVGVVGRTGAGKSTIITALFRFLDPESGYIKIDNMDITTIPLTRLRRAI 1518

Query: 551  GVVQQEPILMSGTIRENI----TYG-------------VSRQPSMEEIRSVAKKCFCHAF 593
             ++ Q+P L +GT++ N+     Y              VS +    E  +V+ +   H  
Sbjct: 1519 TIIPQDPTLFAGTLKFNLDPYDEYNDKDIFAALTRVNLVSGEELNGETTAVSDQGSMH-- 1576

Query: 594  ISKFPNGYETI---IGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAI 650
             S   N +  +   I   G  LS GQ+Q I +AR+LL  PKIL+LDEAT+++D ES+  +
Sbjct: 1577 -SNNENRFLDLSNEITEGGGNLSQGQRQLICLARSLLRNPKILLLDEATASIDYESDARL 1635

Query: 651  NYTL-GRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHK 709
              T+ G    S   TI++IAHRL ++   + ++V+   G V+E      L  N +S  +K
Sbjct: 1636 QATIRGEFGNS---TILTIAHRLRSVIDYDKILVMDA-GEVIEYDHPYSLLLNRNSEFYK 1691

Query: 710  L 710
            +
Sbjct: 1692 M 1692

 Score = 84.7 bits (208), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 71/238 (29%), Positives = 118/238 (49%), Gaps = 15/238 (6%)

Query: 471 KVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGK 530
           K+ F + + S+ T  +    ++LN   + G    ++G +G GK+++   LL   +   G+
Sbjct: 758 KLAFDNSTTSWDTNGSGFKLRNLNIDFKVGKLNVVIGATGSGKTSLLMALLGEMHICQGR 817

Query: 531 ILV---DGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIR--SVA 585
           I+V   + +     +S      +    Q   L++ T+R NI +      S +E R   V 
Sbjct: 818 IIVPSLEPRSSLTANSDGFTNSIAYCSQAAWLLNDTVRNNILF----NSSFDENRYHKVV 873

Query: 586 KKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVE 645
           + C           G  T IG +G  LSGGQKQRI++ARAL +  K L+LD+  SA+D  
Sbjct: 874 EACGLKRDFDILKAGDLTEIGEKGITLSGGQKQRISLARALYSDSKHLLLDDCLSAVDSH 933

Query: 646 SEGAI--NYTLGRLMKSKELTIISIAHRLS-TIRRSENVIVLGIDGSVVEMGKFKDLY 700
           +   I  N   G LM  +  T I ++H ++ T+R +E V++L  DG V + G   +L+
Sbjct: 934 TASWIYDNCITGPLMVGR--TCILVSHNIALTLRNAELVVILE-DGRVKDQGDPLNLF 988

>ZYRO0G07612g Chr7 complement(601181..606268) [5088 bp, 1695 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1695

 Score =  147 bits (372), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 128/510 (25%), Positives = 243/510 (47%), Gaps = 53/510 (10%)

Query: 233  VIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGMM--- 289
            +++K +H  + F+D   +G +++R   D   V + +T      F +L+     + ++   
Sbjct: 1182 LLQKVLHAKLRFFDSTPIGRIMNRFSKDIEAVDQELTPFFEGAFYSLVTCLSTVVLITFI 1241

Query: 290  ---FHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEEQLSGIKTV 346
               F I + + +VL+ F     +  +    ++ +ISR        + +   E L G+ T+
Sbjct: 1242 TPQFLIVAVIVAVLYYFIGYFYLAGSRELKRLDSISR------SPIYQHFSETLVGVTTI 1295

Query: 347  QSFVAEGK----EVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAYGSHL 402
            ++F  E +     +H+ +   R  F +       N       +++G    L+V   G  +
Sbjct: 1296 RAFGDESRFIQENLHKIDENNRPFFYLW----VANRWLAMRIDLIGS---LVVFGAGVFI 1348

Query: 403  VLQ-GNLTIG----DLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRL--FELLDYKP 455
            +L   ++  G     LT  + +TE        L   YS +     +  RL  + +++ +P
Sbjct: 1349 LLNIDHIDAGMAGISLTYAITFTE----GALWLVRLYSNVEMNMNSVERLKEYMVVEQEP 1404

Query: 456  TIKST-TGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKS 514
              +   T  +  P +G+VE   VS  Y      ++ K+++FT+EP S V +VG +G GKS
Sbjct: 1405 YNQPIMTPPSDWPQHGRVEMSDVSLRYAP-GLPRVIKNVSFTVEPKSKVGVVGRTGAGKS 1463

Query: 515  TIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENIT-YGVS 573
            TI + L R+ +P +G I +D  DI+ +  + LRR + ++ Q+P L +GTI+ N+  Y   
Sbjct: 1464 TIITALFRFLDPETGHIKIDNVDISLIDLQMLRRSITIIPQDPTLFTGTIKSNLDPYDEY 1523

Query: 574  RQ----PSMEEIRSVAKKCFCHAFISKFPNGYETI---------IGPRGALLSGGQKQRI 620
                   +++ +  V+++    + I     G E +         I   G  LS GQ+Q +
Sbjct: 1524 SDEDIFAALKRVNLVSQEELDRSNIDAASVGSENVNKFLDLNSEINEGGGNLSQGQRQLV 1583

Query: 621  AIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSEN 680
             +AR+LL  PKI++LDEAT+++D +S+  I  T+ +  +    TI++IAHRL ++   + 
Sbjct: 1584 CLARSLLRSPKIILLDEATASIDYQSDAKIQETIRKEFQGN--TILTIAHRLRSVIDYDK 1641

Query: 681  VIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
            ++V+   G V E      L  N +S  + +
Sbjct: 1642 ILVMD-QGEVKEYDHPYSLLLNKNSQFYSM 1670

 Score = 97.1 bits (240), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 77/271 (28%), Positives = 131/271 (48%), Gaps = 12/271 (4%)

Query: 430 LSTFYSELMKGAGAATRLFELLDYKPTIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQI 489
           LS   S +++   +  R+ E L+ +P        +  P   K+ F++ + S+ + K +  
Sbjct: 705 LSDMLSFVIQSKVSLDRIQEFLE-EPDTDKYNQLSVAPGGQKLGFENATISWDSEKQDFK 763

Query: 490 FKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILV---DGQDITKLSSKSL 546
            ++LN   + G    ++GP+G GK++I   LL      +G I+V   D + +  + +  +
Sbjct: 764 LRNLNIDFKVGKLNVVIGPTGSGKTSILMALLGEMKLLNGNIVVPSLDPRALLPIDADGM 823

Query: 547 RRQLGVVQQEPILMSGTIRENITYGVSRQPSME-EIRSVAKKCFCHAFISKFPNGYETII 605
              +    Q   L++ T+R NI +     P  E     V + C           G  T I
Sbjct: 824 TNSIAYCSQAAWLLNDTVRNNILFN---SPYSEARYNDVIEACGLKRDFEILSAGDMTEI 880

Query: 606 GPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAI--NYTLGRLMKSKEL 663
           G RG  LSGGQKQRI++AR+L +  + L+LD+  SA+D  +   I  N   G LM+ +  
Sbjct: 881 GERGITLSGGQKQRISLARSLYSNSRHLLLDDCLSAVDSHTASWIYDNCITGPLMQGR-- 938

Query: 664 TIISIAHRLSTIRRSENVIVLGIDGSVVEMG 694
           T I I+H ++   R+  ++VL  +G V E G
Sbjct: 939 TCILISHNIALTLRNAELVVLLENGQVKEQG 969

>NDAI0H00190 Chr8 complement(20586..25634) [5049 bp, 1682 aa] {ON}
            Anc_4.6
          Length = 1682

 Score =  147 bits (370), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 138/516 (26%), Positives = 240/516 (46%), Gaps = 50/516 (9%)

Query: 228  RLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALI-CGGVGI 286
            ++  +++   +H  + F+D   +G +++R   D   V + +T  +   F  L+ C    +
Sbjct: 1159 KIFKSLLHTVLHSKLRFFDATPIGRIMNRFSKDIEAVDQELTPYLEAAFYCLVECVSTML 1218

Query: 287  GMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEEQLSGIKTV 346
             + F     L   +F+     LVG   Y    R + R        + +   E L GI T+
Sbjct: 1219 LIAFITPQFLILAIFIGFLYYLVGY-FYMAASRELKRFESVTKSPIYQHFSETLVGIVTI 1277

Query: 347  QSFVAEGK----EVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAYGSHL 402
            +++  E +     +H+ +   +  F +    AF     F   +++G    L+V   G  +
Sbjct: 1278 RAYGDEKRFMLENLHKIDENNKPFFYLW---AFNRWLSFR-IDMIGS---LVVFGAGVFI 1330

Query: 403  VLQ-GNLTIG----DLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLD----- 452
            +L   NL  G     LT  + +TE    A   L  FY+++     +  RL E ++     
Sbjct: 1331 ILNIDNLDSGLAGISLTYAISFTE----AALWLVRFYADVEMNMNSVERLKEYMEIDQEP 1386

Query: 453  YKPTIKSTTGKAFK--PLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSG 510
            Y+  ++ +   A    P NGK+E  ++S  Y      ++ K++ F +EP   V +VG +G
Sbjct: 1387 YEEHLERSEVLAVDNWPRNGKIEVNNLSLRYAP-NLPKVIKNVTFVVEPNCKVGVVGRTG 1445

Query: 511  RGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIREN--- 567
             GKSTI + L R+ +  +G I +D  DIT ++   LRR + ++ Q+P L SGTIR N   
Sbjct: 1446 AGKSTIITALFRFLDAETGYIKIDDIDITTVNLTKLRRSITIIPQDPTLFSGTIRSNLDP 1505

Query: 568  --------ITYGVSRQPSMEEIRSVAKKCFCHAF-----ISKFPNGYETIIGPRGALLSG 614
                    I   + R   + E  S        +      ++KF N  +  I   G  LS 
Sbjct: 1506 YNEFSDDAIFKALRRVNLINENESTGPASSETSPSSTENVNKFLN-LKNEITEGGNNLSH 1564

Query: 615  GQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLST 674
            GQ+Q + +AR+LL  PKI++LDEAT+++D  S+  I  T+ +  + KE TI++IAHRL +
Sbjct: 1565 GQRQLVCLARSLLRCPKIILLDEATASIDNASDAKIQETIRK--EFKESTILTIAHRLRS 1622

Query: 675  IRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
            +   + ++V+   G V E      L  N +S  + +
Sbjct: 1623 VCDYDKILVMD-AGEVKEYDHPYSLLLNKNSIFYSM 1657

 Score =  107 bits (268), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 121/474 (25%), Positives = 222/474 (46%), Gaps = 60/474 (12%)

Query: 250 VGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGMMFHISSTLA----SVLFLFAP 305
           +G +++ +  DA+ VS  +   +    +AL+   V + +++H+    A    +++  F P
Sbjct: 512 LGAIINLMAVDAFKVSE-ICGYLHFFVEALLMVVVALALLYHLLGYAALVGGALVVAFLP 570

Query: 306 PLLVGATIYGNKIRAISRELQQASGNLT----KVAEEQLSGIKTVQSFVAEGKEVHRYNN 361
             L  AT+ G        E Q+ S  +T    +   E    I+ ++ F  E       +N
Sbjct: 571 LNLKLATLLG--------EYQKKSLAVTDKRIQKLNETFQAIRIIKYFSWE-------DN 615

Query: 362 AVRQVFNVGKKE-----------AFTNATFFSSTNVLGDFSFLLVLAYGSHLVLQGNLTI 410
             R +  V +KE           AF++  +F + +++   SF        ++ +QG  T+
Sbjct: 616 FTRDIETVREKELHLLFKRSLIWAFSSFIWFITPSIVTSCSF------AFYIYVQGE-TL 668

Query: 411 GDLTAFMLYTEYT--GSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIKSTTGKAFKPL 468
               AF   + +T   + +  LS   S +++   +  R+ +LL  K T K +     K  
Sbjct: 669 TTPVAFTALSLFTLLKTPLDQLSNMISFVIQSKVSLDRIQDLLQEKETEKYSQLTIDK-- 726

Query: 469 NG-KVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPT 527
           NG ++ FQ+ + ++  + +    +DLN   +PG    ++GP+G GKS++   LL   +  
Sbjct: 727 NGNRIAFQNATVAWDKKNSEFKLRDLNIDFKPGKLNVVIGPTGSGKSSLLLALLGEMHLE 786

Query: 528 SGKILV---DGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSME-EIRS 583
           +G I+V   D +D   +    +   +    Q   L++ T+R NI +     P  E    +
Sbjct: 787 NGNIIVPSLDPRDELVIDHDGMTNSIAYCSQGAWLLNDTVRNNILFN---SPYNEARYNA 843

Query: 584 VAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALD 643
           V + C           G  T IG +G  LSGGQKQR+++ARAL +  + ++LD+  SA+D
Sbjct: 844 VVEACCLKRDFEILKAGDMTEIGEKGITLSGGQKQRVSLARALYSNSRHVLLDDCLSAVD 903

Query: 644 VESEGAI--NYTLGRLMKSKELTIISIAHRLS-TIRRSENVIVLGIDGSVVEMG 694
             +   I  N   G LM+++  T I ++H ++ T+R +E V++L  DG V + G
Sbjct: 904 SHTALWIYDNCITGPLMENR--TCILVSHNIALTLRNAELVVILE-DGRVKDQG 954

>YHL035C Chr8 complement(27978..32756) [4779 bp, 1592 aa] {ON}
            VMR1Vacuolar membrane protein involved in multiple drug
            resistance and metal sensitivity; ATP-binding cassette
            (ABC) family member involved in drug transport; potential
            Cdc28p substrate; induced under respiratory conditions
          Length = 1592

 Score =  146 bits (369), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 135/499 (27%), Positives = 229/499 (45%), Gaps = 56/499 (11%)

Query: 222  GERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALI- 280
            G R   ++ +N++   +H  + F+D   VG +++R   D   V + +   +      LI 
Sbjct: 1067 GMRASRKIFNNLLDLVLHAQIRFFDVTPVGRIMNRFSKDIEGVDQELIPYLEVTIFCLIQ 1126

Query: 281  CGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEEQL 340
            C  +   +       L   + +F     VG   Y    R + R        + +   E L
Sbjct: 1127 CASIIFLITVITPRFLTVAVIVFVLYFFVGKW-YLTASRELKRLDSITKSPIFQHFSETL 1185

Query: 341  SGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSF-------L 393
             G+ T+++F  E + +    N + Q           N  FF  +  +  FSF        
Sbjct: 1186 VGVCTIRAFGDERRFILENMNKIDQ----------NNRAFFYLSVTVKWFSFRVDMIGAF 1235

Query: 394  LVLAYGSHLVLQ-GNLTIG----DLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLF 448
            +VLA GS ++L   N+  G     LT  +L+T+        L   YS       +  RL 
Sbjct: 1236 IVLASGSFILLNIANIDSGLAGISLTYAILFTD----GALWLVRLYSTFEMNMNSVERLK 1291

Query: 449  EL--LDYKPTIKSTTGKAF------KPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPG 500
            E   ++ +  +    G+         P +G++E +++S  Y       + ++++F ++P 
Sbjct: 1292 EYSSIEQENYLGHDEGRILLLNEPSWPKDGEIEIENLSLRYAP-NLPPVIRNVSFKVDPQ 1350

Query: 501  SNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILM 560
            S + IVG +G GKSTI + L R   P +G I +DGQDI+K+   +LRR + ++ Q+PIL 
Sbjct: 1351 SKIGIVGRTGAGKSTIITALFRLLEPITGCIKIDGQDISKIDLVTLRRSITIIPQDPILF 1410

Query: 561  SGTIRENIT-YGVSRQPSMEEIRSVAKKCFCHAF-------------ISKFPNGYETIIG 606
            +GTI+ N+  Y    +  + +  S       H F              +KF N   T I 
Sbjct: 1411 AGTIKSNVDPYDEYDEKKIFKALSQVNLISSHEFEEVLNSEERFNSTHNKFLN-LHTEIA 1469

Query: 607  PRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTL-GRLMKSKELTI 665
              G  LS G++Q + IAR+LL +PKI++LDEATS++D +S+  I   +     KS   TI
Sbjct: 1470 EGGLNLSQGERQLLFIARSLLREPKIILLDEATSSIDYDSDHLIQGIIRSEFNKS---TI 1526

Query: 666  ISIAHRLSTIRRSENVIVL 684
            ++IAHRL ++   + +IV+
Sbjct: 1527 LTIAHRLRSVIDYDRIIVM 1545

 Score = 79.3 bits (194), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 118/489 (24%), Positives = 212/489 (43%), Gaps = 56/489 (11%)

Query: 250 VGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGMMFHISSTLA----SVLFLFAP 305
           +G +++ +  D++ VS  +   +    +A+I   V +G++F+     A    S++ +  P
Sbjct: 445 LGTIINLISIDSFKVSE-LANYLYVTVQAVIMIIVVVGLLFNFLGVSAFAGISIILVMFP 503

Query: 306 PLLVGATIYGNKIRAISRELQQASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQ 365
              + A + G   +   + L+     ++K+  E L  I+ V+ F  E        N + +
Sbjct: 504 LNFLLANLLG---KFQKQTLKCTDQRISKL-NECLQNIRIVKYFAWE-------RNIINE 552

Query: 366 VFNVGKKE-----------AFTNATFFSSTNVLGDFSFLLVLAYGSHLVLQGNLTIGDLT 414
           + ++ +KE           + T+  +F +  ++   +F  +  +  H  L   L    L+
Sbjct: 553 IKSIRQKELRSLLKKSLVWSVTSFLWFVTPTLVTGVTFA-ICTFVQHEDLNAPLAFTTLS 611

Query: 415 AFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIKSTTGKAFKPLNGKVEF 474
            F L      + +  LS   S + +   +  R+ + L    T K        P   K+EF
Sbjct: 612 LFTLLK----TPLDQLSNMLSFINQSKVSLKRISDFLRMDDTEKYNQ-LTISPDKNKIEF 666

Query: 475 QHVSFSYPTRKTN-QIFK--DLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKI 531
           ++ + ++    ++   FK   LN   + G    I+G +G GKS +   LL   N  SG I
Sbjct: 667 KNATLTWNENDSDMNAFKLCGLNIKFQIGKLNLILGSTGSGKSALLLGLLGELNLISGSI 726

Query: 532 LVDG----QDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKK 587
           +V       D+     + L        Q   L++ T++ NI +      + +    V   
Sbjct: 727 IVPSLEPKHDLIP-DCEGLTNSFAYCSQSAWLLNDTVKNNIIF--DNFYNEDRYNKVIDA 783

Query: 588 CFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESE 647
           C     +   P G  T IG +G  LSGGQKQRI++ARA+ +  K ++LD+  SA+D  + 
Sbjct: 784 CGLKRDLEILPAGDLTEIGEKGITLSGGQKQRISLARAVYSSAKHVLLDDCLSAVDSHTA 843

Query: 648 GAI--NYTLGRLMKSKELTIISIAHRLS-TIRRSENVIVL-----GIDGSVVEM---GKF 696
             I  N   G LMK++  T I + H +S T+R +   IVL        G++ E+   G F
Sbjct: 844 VWIYENCITGPLMKNR--TCILVTHNVSLTLRNAHFAIVLENGKVKNQGTITELQSKGLF 901

Query: 697 KDLYANHDS 705
           K+ Y    S
Sbjct: 902 KEKYVQLSS 910

>CAGL0E03355g Chr5 complement(307479..312086) [4608 bp, 1535 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015w BPT1 or uniprot|P39109 Saccharomyces cerevisiae
            YDR135c YCF1
          Length = 1535

 Score =  146 bits (369), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 136/512 (26%), Positives = 242/512 (47%), Gaps = 43/512 (8%)

Query: 228  RLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIG 287
            +L + + K  M   M F++    G +++R  +D   V  ++    S  F++++   + + 
Sbjct: 1027 KLHNKMAKTIMRSPMSFFETTPTGRIINRFSSDMDSVDTTLQNVFSLFFRSILDYIITVI 1086

Query: 288  MM-FHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASG----NLTKVAEEQLSG 342
            ++ F++      + FL    LLV    Y +    +SREL++ +      +  +  E LSG
Sbjct: 1087 LVTFNMP-----LFFLLNAGLLVIYLYYQSFYIVLSRELKRLTSISYSPIMSLMGESLSG 1141

Query: 343  IKTVQSFVAEGKEVHRYN--NAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAYG- 399
              T+ ++    +++ R++  N  R  F++     + ++  + S   L     L+VL+ G 
Sbjct: 1142 HFTISAY----EQIRRFSHLNYERIQFSINCFFNYRSSNRWLSVR-LQSIGALIVLSTGL 1196

Query: 400  ---SHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPT 456
               S L     L+ G +   M Y     S++  +      +     +  R+ E  D  P 
Sbjct: 1197 LALSSLGTDHQLSSGLVGLLMSYALQVTSSLIWIIRSSVLIETNIVSVERIVEYCDISPE 1256

Query: 457  IKSTTGKAF----KPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRG 512
                  +       P  G++EF++ S SY     + + K +N  I PG  + +VG +G G
Sbjct: 1257 APEVKEEHRLDDNWPNQGQIEFKNYSTSY-RENLDPVLKHINLVISPGEKIGVVGRTGAG 1315

Query: 513  KSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIREN----- 567
            KST++  L R   PT+G I +D  DIT +  + LR  + ++ Q+     GTIR N     
Sbjct: 1316 KSTLSMALFRLLEPTAGTISIDNIDITSIGLRDLRSHIAIIPQDAQAFEGTIRSNLDPFE 1375

Query: 568  ------ITYGVSRQPSMEEIRSVAKKC---FCHAFISKFPNGYETIIGPRGALLSGGQKQ 618
                  + + +        + ++AK+      ++  S+  +  +  +   G+ LS GQKQ
Sbjct: 1376 KFSDDDLWHAIELSHLKFHLETIAKEINDDSEYSDRSRLESPLDIPVREAGSNLSVGQKQ 1435

Query: 619  RIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRS 678
             + +ARALLNK KIL+LDEAT+++DVE++  I  T+ +    +  TI++IAHRL T+  S
Sbjct: 1436 LLCLARALLNKSKILVLDEATASVDVETDKIIQETIRKEFADR--TILTIAHRLDTVFDS 1493

Query: 679  ENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
            + +IVL   G V E  K + L    DS  +KL
Sbjct: 1494 DRIIVLD-GGEVKEFDKPETLLEQKDSIFYKL 1524

 Score = 84.7 bits (208), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 64/223 (28%), Positives = 111/223 (49%), Gaps = 15/223 (6%)

Query: 494 NFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVV 553
           NF +   S +C+VG  G GKSTI   +L      SG       D      +     +   
Sbjct: 639 NFEVPKSSLICVVGRVGAGKSTILKCILGQLPCISG-----NNDHLSPQFQINATTVAYC 693

Query: 554 QQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLS 613
            QE  +M+ ++++NI +G     +    ++  K C     I   P+G ET++G +G +LS
Sbjct: 694 PQEAWIMNASVKDNILFGHKYDEAF--YKATIKACQLLPDIKVLPDGDETMVGEKGIVLS 751

Query: 614 GGQKQRIAIARALLNKPKILILDEATSALDVE-SEGAINYTLGR---LMKSKELTIISIA 669
           GGQK R+++ARA+ ++  + +LD+  SA+D E  +  I   L     L+K K  +I+   
Sbjct: 752 GGQKTRLSLARAVYSRADLYLLDDILSAVDTEVCKTIIKEVLDEKTGLLKDK--SIVLAT 809

Query: 670 HRLSTIRRSENVIVLGIDGSVVEMGKFKDLYAN-HDSALHKLL 711
           + +S ++ S  + +L  + S+ + G + D+  N  DS L  +L
Sbjct: 810 NTISVLKHSTKIYLLE-NKSIAQEGNYDDIMNNQQDSKLKNIL 851

>CAGL0G00242g Chr7 complement(20428..24861) [4434 bp, 1477 aa] {ON}
            highly similar to uniprot|P53049 Saccharomyces cerevisiae
            YGR281w YOR1 ATP-binding cassette transporter protein
          Length = 1477

 Score =  146 bits (368), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 151/541 (27%), Positives = 251/541 (46%), Gaps = 74/541 (13%)

Query: 214  RVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNIS 273
            +  +L ++G      L    +K+ +H  M + D   +G +L+R   D   +   +T+NI 
Sbjct: 953  QFTMLCMMGIMASKWLNLKAVKRILHAPMSYLDTTPLGRILNRFTKDTDSLDNELTENIR 1012

Query: 274  ---DGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISR-ELQQAS 329
                 F  +I  GV +  + ++     ++ FL    +L+ A  Y +  R I R E  Q S
Sbjct: 1013 LMMSQFANII--GVCVLCIVYLPWFAIAIPFLLLVFVLI-ADHYQSAGREIKRLEAIQRS 1069

Query: 330  ---GNLTKVAEEQLSGIKTVQSFVAEGKE-------VHRYNNAVRQVFNVGKKEA-FTNA 378
                NL +V    L G+ T++++ ++ +        +++ N     V +V +  A F + 
Sbjct: 1070 FVYNNLIEV----LGGMDTIKAYKSQDRYMTKMDFLINKMNEVSYMVVSVQRWVAIFLDM 1125

Query: 379  TFFSSTNVLGDFSFLLVLAYGSHL-----------VLQGNLTIGDLTAFMLYTEYTGSAV 427
               +   ++     LL +    H+           VLQ    +  +   +  TE   ++ 
Sbjct: 1126 IAVAFALIIS----LLCVTRQFHISPSAVGVLLTYVLQLPGLLNTVLRALTQTENDMNSA 1181

Query: 428  FGLSTFYSELMKGAGAATRLFELLDYKPTIKSTTGKAFKPLNGKVEFQHVSFSY-PTRKT 486
              L T+ +EL + A      +   DY P           P NG+V F+ VSF+Y P   T
Sbjct: 1182 ERLVTYATELPQEAA-----YRKSDYSPPDNW-------PTNGEVIFEDVSFAYRPGLPT 1229

Query: 487  NQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSL 546
              + K++N +I  G  + I G +G GKSTI + L R    TSG+I +DG D  KL    L
Sbjct: 1230 --VLKNVNLSIAGGEKIGICGRTGAGKSTIMTALYRLNELTSGRIFIDGIDTFKLGLYDL 1287

Query: 547  RRQLGVVQQEPILMSGTIREN----------------ITYGVSRQPSMEEIR-SVAKKCF 589
            RR+L ++ Q+P+L  GTIR+N                I  G   +  +E+I+     K  
Sbjct: 1288 RRKLSIIPQDPVLFRGTIRKNLDPFNEFSDDSLWNSLIRGGAIEKDDLEDIKHQKPDKNG 1347

Query: 590  CHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGA 649
             +  + KF    + I+   GA  S G++Q +A+ RAL+ + KILILDEATS++D E++G 
Sbjct: 1348 SYNNMHKF--HLDQIVEEDGANFSLGERQVLALTRALVRQSKILILDEATSSVDYETDGK 1405

Query: 650  INYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHK 709
            I   +    + ++ TI+ IAHRL TI   + ++VL   G V E  K + L+ N  S    
Sbjct: 1406 IQTRIA--TEFQDCTILCIAHRLKTILNYDRILVLE-KGEVAEFDKPEILFNNEKSIFRS 1462

Query: 710  L 710
            +
Sbjct: 1463 M 1463

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 69/227 (30%), Positives = 117/227 (51%), Gaps = 20/227 (8%)

Query: 485 KTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSK 544
           KT   F +LNF I+ G  + I GP G GKS++ + +  +   T+G++ ++G         
Sbjct: 612 KTFTKFSNLNFEIKKGEFIMITGPIGTGKSSLLNAMAGFMPQTTGELDINGH-------- 663

Query: 545 SLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETI 604
                  ++   P + + T+R+NI +G       E+ + V + C   A I   P G  T 
Sbjct: 664 ------MLLCGYPWIQNATVRDNIIFGSPY--DREKYKEVIRVCSLQADIDILPAGDMTE 715

Query: 605 IGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVE-SEGAINYTLGRLMKSKEL 663
           IG RG  LSGGQK RI +AR++     I + D+  SA+D    +  ++    + ++SK  
Sbjct: 716 IGERGITLSGGQKARINLARSVYKNKDIYLFDDVLSAVDSRVGKHIMDECFLQTLQSK-- 773

Query: 664 TIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
           T I   H+LS I +++ VIVL  +GS V++G  ++L   + + ++ L
Sbjct: 774 TRILATHQLSLIEKADRVIVLSTNGS-VDIGTVEELKTRNQTLINLL 819

>TPHA0C00960 Chr3 (204061..208632) [4572 bp, 1523 aa] {ON} Anc_8.303
            YDR135C
          Length = 1523

 Score =  146 bits (368), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 142/531 (26%), Positives = 237/531 (44%), Gaps = 42/531 (7%)

Query: 208  TMANFGRVVLLKIL----GERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYI 263
            ++AN  + ++L I     G +   +L S++        M F++   +G +L+R   D Y 
Sbjct: 997  SLANLIQTIILWIFCTIQGSK---QLHSSMTSSIFRAPMSFFETTPIGRILNRFSNDVYK 1053

Query: 264  VSRSMTQNISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISR 323
            +   + ++ S  F+  I     I +   I ST    +FL  P   +    Y       SR
Sbjct: 1054 IDEILGRSFSQFFQNTIRVSFTIVV---ICSTTWQFIFLIIPMAFL-YIYYQQYFLRTSR 1109

Query: 324  ELQQASGN----LTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNAT 379
            EL++        L    +E L G+ T++ F  + + +H   + V            +N  
Sbjct: 1110 ELRRLDSTTRSPLYAHFQETLCGVSTIRGFAQQDRFIHINQSRVDSNMMAYYPSINSNRW 1169

Query: 380  FFSSTNVLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMK 439
                   LG    L         +  G+LT G +   M Y      ++  +     ++  
Sbjct: 1170 LAFRLEFLGSLIILGAATLSIFRLKNGSLTAGMIGLSMSYALQVTQSLNWIVRMTVDVES 1229

Query: 440  GAGAATRLFELLDYKPT-----IKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLN 494
               +  R+ E   + P+     I++       P  G +EF++ S  Y   + + + K++N
Sbjct: 1230 NIVSVERI-EEYSHLPSEAPLIIENNRPSEEWPSKGAIEFKNYSTRYRP-ELDLVLKNIN 1287

Query: 495  FTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQ 554
              I P   V IVG +G GKS++   L R    +SG I +DG +I +L    LR +L ++ 
Sbjct: 1288 LKILPKEKVGIVGRTGAGKSSLTLALFRIIEASSGSIEIDGVNINELGLYDLRHKLSIIP 1347

Query: 555  QEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKF---------------PN 599
            Q+  +  G+IRENI    ++Q S +EI +  +       I K                 N
Sbjct: 1348 QDSQVFEGSIRENI--DPTQQFSEQEIWNALEMAHLKPHILKMNEISPESENSDTNQSSN 1405

Query: 600  GYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMK 659
              +  I   G+ LS GQ+Q I +ARALL    +LILDEAT+A+DVE++  I +T+    K
Sbjct: 1406 PLDAKITEGGSNLSVGQRQLICLARALLVPSNVLILDEATAAVDVETDELIQHTIRTAFK 1465

Query: 660  SKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
             +  TI++IAHR++TI  S+ +IVL  +G V E  K + L  N +S  + L
Sbjct: 1466 DR--TILTIAHRINTIMDSDKIIVLD-NGEVAEFDKPEILLTNKNSLFYSL 1513

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 123/514 (23%), Positives = 224/514 (43%), Gaps = 57/514 (11%)

Query: 222 GERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALIC 281
           G  + + L S + +K +    E  + +  GD+++ +  D   V R   Q++S     L  
Sbjct: 362 GMNIRSALTSVIYQKALLLSNEATEVSTTGDIVNLMSVD---VQR--LQDLSQWINILWS 416

Query: 282 GGVGIGMMFHISSTLASVLFLFAPPLLVGATIYG------NKIRAISRELQQASGNL--- 332
           G       F ++  L S+  L    + +G  I G      + I  I ++LQ+        
Sbjct: 417 GP------FQLTLCLISLYNLLGHSMWIGVFILGIMIPINSYIMRIQKKLQKDQMKYKDE 470

Query: 333 -TKVAEEQLSGIKTVQSFVAEG--KEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNV--L 387
            T +  E L+ IK+++ +  E   +E   +    +++ N+ K   F     F    V  L
Sbjct: 471 RTGLVNEILNNIKSLKLYAWEKPFQEKLEFVRNEKELKNLKKIGVFNAMIAFQFNIVPFL 530

Query: 388 GDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRL 447
                  +  +     L  +L    LT F L      +    +S F    ++ + + +RL
Sbjct: 531 VSCCTFAIFVWVEDKPLTTDLVFPALTLFNLLNFPLVAVPITISAF----IEASVSISRL 586

Query: 448 FELLDYKPTIKSTTGK-AFKPLNGKVEFQ---HVSFSYPTRKTNQI-FKDLNFTIEPGSN 502
           +  L  +   K    +  F   NG+   +   + +F +  +   ++  K++NF    G  
Sbjct: 587 YSYLTNEELQKDAIQRLPFVKQNGETTVKIGDNATFLWKRKPEYKVALKNINFEARKGEL 646

Query: 503 VCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSS-KSLRRQLGVVQQEPILMS 561
            CIVG  G GKS     +L               D+ ++    S+   +  V Q   +M+
Sbjct: 647 ACIVGKVGSGKSAFIQSIL--------------GDLFRVKGFASIHGNVAYVSQLAWIMN 692

Query: 562 GTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIA 621
           GT+++NI +G    P   E     K C     +S  P+G +T++G +G  LSGGQK R++
Sbjct: 693 GTVKDNIIFGHRYDPEFYE--KTIKACALTIDLSILPDGDQTLVGEKGISLSGGQKARLS 750

Query: 622 IARALLNKPKILILDEATSALDVE-SEGAINYTLGR--LMKSKELTIISIAHRLSTIRRS 678
           +ARA+  +  I +LD+  +A+D   S+  I   LG   L+KSK  T I   +++  +  +
Sbjct: 751 LARAVYARADIYLLDDPLAAVDEHVSKHLIQNVLGAKGLLKSK--TRILTTNKIPVLSIA 808

Query: 679 ENVIVLGIDGSVVEMGKFKDLYANHDSALHKLLT 712
           +++ +L  +G + E G + D+ A   S+L KL+T
Sbjct: 809 DSITLLE-NGEITEQGTYFDVMATEGSSLSKLIT 841

>NCAS0E04160 Chr5 (818254..822774) [4521 bp, 1506 aa] {ON} Anc_5.10
          Length = 1506

 Score =  144 bits (364), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 144/533 (27%), Positives = 248/533 (46%), Gaps = 49/533 (9%)

Query: 208  TMANFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRS 267
            T + F  +  + +L  + +  LR+  +K+ +H  M + D   +G +L+R   D   +   
Sbjct: 981  TTSQFTLLCCIGVLSSKWL-NLRA--VKRILHTPMSYLDTTPLGRILNRFTKDTDSLDNE 1037

Query: 268  MTQNIS---DGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRE 324
            +T+++      F  ++  GV I  + ++     ++ FLF   +L+ A  Y +  R I R 
Sbjct: 1038 LTESVRMLLYQFANIV--GVCIMCIIYLPWFAIAIPFLFVGFVLI-ADHYQSSGREIKRL 1094

Query: 325  LQQASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTN---ATFF 381
                   +     E L G+ T++S+ +E + + + +  + ++   G          A F 
Sbjct: 1095 EAIQRSFVYNNFNEVLGGMDTIKSYRSENRFIAKSDFLIDKMNEAGYLVVAVQRWVAIFL 1154

Query: 382  SSTNVLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGA 441
                V   F+ ++ L   +        ++G L  ++L      + V    T     M  A
Sbjct: 1155 DVIAVC--FALIITLLCVTRAFPISAASVGVLLTYVLQLPGLLNGVLRSLTQTENDMNSA 1212

Query: 442  ----GAATRLFELLDY-KPTIKSTTGKAFKPLNGKVEFQHVSFSY-PTRKTNQIFKDLNF 495
                  AT L    DY KP +         P  G++ F++V FSY P   T  + K+L+ 
Sbjct: 1213 ERLVTYATELPLEADYRKPEVSPPEEW---PTKGEIHFENVDFSYRPGLPT--VLKNLSL 1267

Query: 496  TIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQ 555
             I+ G  + I G +G GKSTI S L R    +SGK+++D  DI+ +    LRR+L ++ Q
Sbjct: 1268 DIKSGEKIGICGRTGAGKSTIMSALYRLNEISSGKMIIDDVDISTIGLYDLRRKLAIIPQ 1327

Query: 556  EPILMSGTIREN----------------ITYGVSRQPSMEEIRSV-AKKCFCHAFISKFP 598
            +P+L  GTIR+N                +  G   Q  + EI++    +   H+ + KF 
Sbjct: 1328 DPVLFRGTIRKNLDPFNEHQDEHLWNALVRGGAIEQKELNEIKAQKPDEKGNHSEMYKF- 1386

Query: 599  NGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLM 658
               + ++   GA  S G++Q +A+ RAL+ + +ILILDEATS++D E++G I     R++
Sbjct: 1387 -HLDQLVEEEGANFSLGERQLLALTRALVRQARILILDEATSSVDYETDGKIQ---ARIV 1442

Query: 659  KS-KELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
            +     TI+ IAHRL TI   + ++VL   G V E    K L+A  DS    +
Sbjct: 1443 EEFGHCTILCIAHRLKTILTYDRILVLE-KGEVAEFDTPKTLFAQEDSIFRSM 1494

 Score = 92.4 bits (228), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 66/211 (31%), Positives = 110/211 (52%), Gaps = 20/211 (9%)

Query: 490 FKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQ 549
           F DLNF I+ G  + +VGP G GK+++ +    + N  SG+I ++G D+           
Sbjct: 649 FHDLNFEIKKGEFIIMVGPIGTGKTSLLNAFAGFMNKVSGRIQING-DL----------- 696

Query: 550 LGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRG 609
             ++   P + + ++++NI +G     +  +   V + C   + +   P G  T IG RG
Sbjct: 697 --LLCGYPWIQNASVKDNIIFGSPYNKAKYD--EVIRVCSLKSDLDILPAGDLTEIGERG 752

Query: 610 ALLSGGQKQRIAIARALLNKPKILILDEATSALDVE-SEGAINYTLGRLMKSKELTIISI 668
             LSGGQK RI +AR++  +  I + D+  SA+D    +  ++     L+K K  T I  
Sbjct: 753 ITLSGGQKARINLARSVYKQKDIYLFDDVLSAVDSRVGKHIMDECFLGLLKDK--TRILA 810

Query: 669 AHRLSTIRRSENVIVLGIDGSVVEMGKFKDL 699
            H+LS + R+  VIVLG DGS  ++G  ++L
Sbjct: 811 THQLSLLERASRVIVLGNDGS-FDIGTVEEL 840

>KLLA0F20075g Chr6 complement(1868786..1873336) [4551 bp, 1516 aa]
            {ON} similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1516

 Score =  144 bits (363), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 138/485 (28%), Positives = 224/485 (46%), Gaps = 33/485 (6%)

Query: 242  MEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGMMFHISSTLASVLF 301
            M F++   +G +L+R   D Y V   + +  +  F  ++     I ++      +A+  F
Sbjct: 1041 MSFFETTPIGRILNRFSNDIYKVDEILGRTFAQFFANVVKVSFTIVVI-----CMATWQF 1095

Query: 302  LF-APPLLVGATIYGNKIRAISRELQQ----ASGNLTKVAEEQLSGIKTVQSFVAEGKEV 356
            +F   PL V    Y       SREL++        +    +E L G+ T++ +  + + V
Sbjct: 1096 IFIVLPLSVLYIYYQQYYLRTSRELRRLDSVTRSPIYAHFQETLGGLTTIRGYSQQNRFV 1155

Query: 357  H----RYNNAVRQVF---NVGKKEAFTNATFFSSTNVLGDFSFLLVLAYGSHLVLQGNLT 409
            H    R +N +   +   N  +  AF    F  S  +L   S L V+  G+     G LT
Sbjct: 1156 HINQTRVDNNMSAFYPSVNANRWLAF-RLEFIGSVIILAA-SMLAVIRLGN-----GTLT 1208

Query: 410  IGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKP----TIKSTTGKAF 465
             G +   + +      ++  +     E+     +  R+ E  + K      IK     A 
Sbjct: 1209 AGMIGLSLSFALQITQSLNWIVRMTVEVETNIVSVERIKEYAELKSEAPYIIKDHRPPAS 1268

Query: 466  KPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYN 525
             P +G+++F + S  Y   +   I KD++  I P   + IVG +G GKS++   L R   
Sbjct: 1269 WPESGEIKFVNYSTRYRP-ELELILKDIDLHIHPKEKIGIVGRTGAGKSSLTLALFRIIE 1327

Query: 526  PTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVA 585
              SG I++DG  I  +    LR  L ++ Q+  +  GT+RENI    +R    E   ++A
Sbjct: 1328 AASGHIVIDGIPIDSIGLADLRHGLSIIPQDSQIFEGTVRENID-PTNRYTDEEIWNALA 1386

Query: 586  KKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVE 645
                    +    NG ET++   G+ LS GQ+Q + +ARALL    ILILDEAT+A+DVE
Sbjct: 1387 LSHLKDHILGMGSNGLETMLTEGGSNLSVGQRQLMCLARALLISSNILILDEATAAVDVE 1446

Query: 646  SEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDS 705
            ++  I  T+      KE TI++IAHR++TI  S+ +IVL   G V E    ++L    DS
Sbjct: 1447 TDQLIQKTIRNAF--KERTILTIAHRINTIMDSDRIIVLD-KGRVTEFDTPQNLLQKKDS 1503

Query: 706  ALHKL 710
              + L
Sbjct: 1504 IFYSL 1508

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 114/457 (24%), Positives = 196/457 (42%), Gaps = 71/457 (15%)

Query: 290 FHISSTLASVLFLFAPPLLVGATIY------GNKIRAISRELQQAS----GNLTKVAEEQ 339
           F I   L S+  L  P + VG  I        + I  I ++LQ+         T+V  E 
Sbjct: 429 FQIVLCLVSLYKLLGPCMWVGVIIMIVMIPINSVIVRIQKKLQKIQMKNKDERTRVTSEI 488

Query: 340 LSGIKTVQSFVAE----GKEVH-RYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLL 394
           L+ IK+++ +  E     K  H R    ++ +  +G   A  N  F +    L   S   
Sbjct: 489 LNNIKSLKVYGWEIPYKAKLDHVRNEKELKNLKKMGCTLALANFQF-NIVPFLVSCSTFA 547

Query: 395 VLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLD-- 452
           V  Y     L  +L    LT F L +         +S+F    ++ + +  RLF  L   
Sbjct: 548 VFVYTEERPLSTDLVFPALTLFNLLSFPLAVVPNAISSF----IEASVSINRLFAFLTNE 603

Query: 453 --------YKPTIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVC 504
                    +P +K+   +  K  +    +Q      P  K     K++NF  + G   C
Sbjct: 604 ELQNDAVLREPKVKNIGDEGVKVNDATFLWQR----KPEYKVA--LKNINFVAKKGELTC 657

Query: 505 IVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTI 564
           IVG  G GKS +   LL       G   V G D+  +S            Q P +M+GT+
Sbjct: 658 IVGKVGSGKSALIQSLLGDLIRVKGFATVHG-DVANVS------------QVPWIMNGTV 704

Query: 565 RENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIAR 624
           ++NI +G    P   ++    K C     +S  P+G +T++G +G  LSGGQK R+++AR
Sbjct: 705 KDNILFGHKYDPEFYQL--TIKACALSIDLSMLPDGDQTLVGEKGISLSGGQKARLSLAR 762

Query: 625 ALLNKPKILILDEATSALDVE-SEGAINYTLG---------RLMKSKELTIISIAHRLST 674
           A+ ++    +LD+  +A+D   ++  I + LG         +++ + ++T++SIA     
Sbjct: 763 AVYSRADTYLLDDPLAAVDEHVAKHLIEHVLGPHGLLHSKTKVLATNKITVLSIA----- 817

Query: 675 IRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLL 711
                + I L  +G +++ G +  +  + +S L KL+
Sbjct: 818 -----DSITLMENGEIIQQGSYDQVNESTNSPLSKLI 849

>KLLA0E00529g Chr5 complement(39173..44125) [4953 bp, 1650 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1650

 Score =  143 bits (361), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 136/522 (26%), Positives = 246/522 (47%), Gaps = 50/522 (9%)

Query: 220  ILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKAL 279
            + G R   ++ + ++K  ++  + F+D   +G +++R   D   + + +T  +   F +L
Sbjct: 1123 VAGIRASRKIFNLLLKNVLYAKLRFFDSTPIGRIMNRFSKDIESIDQELTPYMEGAFGSL 1182

Query: 280  I-CGGVGIGM-----MFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLT 333
            I C    I +      F I + +  +LF F       A  Y +  R + R    +   + 
Sbjct: 1183 IQCVSTIIVIAYITPQFLIVAAIVMLLFYFV------AYFYMSGARELKRLESMSRSPIH 1236

Query: 334  KVAEEQLSGIKTVQSFVAEGK----EVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGD 389
            +   E L GI T+++F  E +     + + ++  R  F +       N        ++G 
Sbjct: 1237 QHFSETLVGITTIRAFSDERRFLVDNMKKIDDNNRPFFYLW----VCNRWLSYRIELIGA 1292

Query: 390  FSFLLVLAYGSHLVLQGNLTIGDLTAFML--YTEYTGSAVFGLSTFYSELMKGAGAATRL 447
               L+VLA GS ++L        L    L    ++T  A++ +   YS +     +  RL
Sbjct: 1293 ---LIVLAAGSFILLNIKSIDSGLAGISLGFAIQFTDGALW-VVRLYSNVEMNMNSVERL 1348

Query: 448  --FELLDYKPT-IKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVC 504
              +  ++ +P+ + +       P NGK+E + +S  Y      ++ K++ FT++    V 
Sbjct: 1349 KEYTTIEQEPSNVGALVPPCEWPQNGKIEVKDLSLRYAA-GLPKVIKNVTFTVDSKCKVG 1407

Query: 505  IVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTI 564
            IVG +G GKSTI + L R+ +P +G I +D  DIT +  K LR+ + ++ Q+P L +GT+
Sbjct: 1408 IVGRTGAGKSTIITALFRFLDPETGYIKIDDVDITTIGLKRLRQSITIIPQDPTLFTGTL 1467

Query: 565  RENI-TYGVSRQP------------SMEEI--RSVAKKCFCH-AFISKFPNGYETIIGPR 608
            + N+  Y    +             S EE+   S +     H A ++KF +  E  +   
Sbjct: 1468 KTNLDPYNEYSEAEIFEALKRVNLVSSEELGNPSTSDSTSVHSANMNKFLD-LENEVSEG 1526

Query: 609  GALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISI 668
            G+ LS GQ+Q I +AR+LL  PK+++LDEAT+++D  S+  I  T+     +   TI++I
Sbjct: 1527 GSNLSQGQRQLICLARSLLRCPKVILLDEATASIDYNSDSKIQATIREEFSNS--TILTI 1584

Query: 669  AHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
            AHRL +I   + ++V+   G V E      L  N DS  + +
Sbjct: 1585 AHRLRSIIDYDKILVMD-AGEVKEYDHPYSLLLNRDSIFYHM 1625

 Score = 84.3 bits (207), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 112/490 (22%), Positives = 218/490 (44%), Gaps = 62/490 (12%)

Query: 235 KKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGMMFHI-- 292
           K+ +  D E      +G +++ +  DA+ VS  +   +    +A+I   V + +++ +  
Sbjct: 467 KQHVDGDEESATTANLGAIINLMAVDAFKVSE-ICAYLHSFIEAIIMTIVALFLLYRLIG 525

Query: 293 -SSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLT----KVAEEQLSGIKTVQ 347
            S+ + S + +   PL         K+ ++   LQ+ S  +T    +   E    I+ ++
Sbjct: 526 WSALVGSAMIICFLPL-------NFKLASLLGTLQKKSLAITDKRIQKLNEAFQAIRIIK 578

Query: 348 SFVAEGKEVHRYNNAVRQVFNVGKKE----AFTNATFFSSTNVLGDFSFLLVLAYGSHLV 403
            F  E        N   +  N+  K     A ++  +F + +++   SF        ++ 
Sbjct: 579 FFSWEENFEKDIQNTRDEELNMLLKRSIVWALSSLVWFITPSIVTSASF------AVYIY 632

Query: 404 LQGNLTIGDLTAFMLYTEYTGSAVFGL--------STFYSELMKGAGAATRLFELLDYKP 455
           +QG  T+    AF      T  ++F L        S   S +++   +  R+ E L+ + 
Sbjct: 633 VQGQ-TLTTPVAF------TALSLFALLRNPLDMLSDMLSFVIQSKVSLDRVQEFLNEEE 685

Query: 456 TIKSTTGKAFKPLN---GKVEFQHVSFSYPTRKTNQIFKDLNFTIE--PGSNVCIVGPSG 510
           T      K ++ L     K+  Q+ +F++   K NQ FK  N TI+   G    IVGP+G
Sbjct: 686 T------KKYEQLTVSRNKLGLQNATFTWD--KNNQDFKLKNLTIDFKIGKLNVIVGPTG 737

Query: 511 RGKSTIASLLLRYYNPTSGKILV---DGQDITKLSSKSLRRQLGVVQQEPILMSGTIREN 567
            GK+++   LL      +GK+ V   + ++   + +  +   +    Q   L++ T+R N
Sbjct: 738 SGKTSLLMGLLGEMELLNGKVFVPSLNPREELVVEADGMTNSIAYCSQAAWLLNDTVRNN 797

Query: 568 ITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALL 627
           I +      +     +V   C           G +T IG +G  LSGGQKQR+++AR+L 
Sbjct: 798 ILFNAPYNEN--RYNAVISACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARSLY 855

Query: 628 NKPKILILDEATSALDVESEGAI--NYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLG 685
           +  + L+LD+  SA+D  +   I  N   G LM+ +  T + ++H ++   ++ + +++ 
Sbjct: 856 SSSRHLLLDDCLSAVDSHTALWIYENCITGPLMEGR--TCVLVSHNVALTLKNADWVIIM 913

Query: 686 IDGSVVEMGK 695
            +G V E G+
Sbjct: 914 ENGRVKEQGE 923

>SAKL0H16016g Chr8 (1396707..1401206) [4500 bp, 1499 aa] {ON} similar
            to uniprot|P39109 Saccharomyces cerevisiae YDR135C
          Length = 1499

 Score =  143 bits (360), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 133/485 (27%), Positives = 224/485 (46%), Gaps = 33/485 (6%)

Query: 242  MEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGMMFHISSTLASVLF 301
            M F++   +G +L+R   D Y V   + +  S  F  ++   V   ++   +ST   +L 
Sbjct: 1023 MSFFETTPIGRILNRFSNDIYKVDELLGRTFSQFFVNVV--KVTFTIVVICTSTWQFILV 1080

Query: 302  LFAPPLLVGATIYGNKIRAISRELQQ----ASGNLTKVAEEQLSGIKTVQSFVAEGKEVH 357
            +   PL V    Y       SREL++        +    +E L G+ T++ +  + +  H
Sbjct: 1081 VL--PLSVLYIYYQQYYLRTSRELRRLDSVTRSPIYAHFQETLGGVSTIRGYGQQKRFAH 1138

Query: 358  ----RYNNAVRQVF---NVGKKEAFTNATFFSSTNVLGDFSFLLVLAYGSHLVLQGNLTI 410
                R +N +   +   N  +  AF    F  S  +LG  +           + QG LT 
Sbjct: 1139 INQARIDNNMSAFYPAVNANRWLAF-RLEFLGSIIILGAATL------SVFRLKQGTLTA 1191

Query: 411  GDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKP----TIKSTTGKAFK 466
            G +   + Y      ++  +     E+     +  R+ E  + KP     I+S+      
Sbjct: 1192 GMIGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYAELKPEAPAIIESSRPPKGW 1251

Query: 467  PLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNP 526
            P  G + F+H S  Y   +   I +D+N  I+    V IVG +G GKS++   L R    
Sbjct: 1252 PSQGDIRFEHYSTRYRP-ELQLILRDVNLHIKAREKVGIVGRTGAGKSSLTLALFRIIEA 1310

Query: 527  TSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAK 586
              G I +DG     +    LR +L ++ Q+  + +GT+REN+    + + + EEI    +
Sbjct: 1311 AEGHIFIDGLSTDTIGLADLRHKLSIIPQDSQVFAGTLRENV--DPTEEFTDEEIWHALE 1368

Query: 587  KCFCHAFISKFPN-GYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVE 645
                   +    N G +T++   G+ LS GQ+Q + +ARALL   KIL+LDEAT+A+DVE
Sbjct: 1369 LSHLKEHVMSMGNDGLQTMLTECGSNLSVGQRQLLCLARALLIPSKILVLDEATAAVDVE 1428

Query: 646  SEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDS 705
            ++  I  T+    K++  TI++IAHR++TI  S+ +IVL  +G V E    ++L    DS
Sbjct: 1429 TDRVIQETIRTAFKNR--TILTIAHRINTIMDSDKIIVLN-EGQVAEFDTPENLLQRPDS 1485

Query: 706  ALHKL 710
              + L
Sbjct: 1486 LFYSL 1490

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 64/232 (27%), Positives = 115/232 (49%), Gaps = 35/232 (15%)

Query: 490 FKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQ 549
            K++NF  + G   CIVG  G GKS +   +L       G   + G              
Sbjct: 638 LKNINFQAKKGELTCIVGRVGSGKSALIQSILGDLFRVKGFATIHGS------------- 684

Query: 550 LGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRG 609
           +  V Q P +M+GT++ENI +G    PS  E     K C  +  +S  P G +T++G +G
Sbjct: 685 VAYVSQIPWIMNGTVKENILFGHKYDPSFYE--KTVKACALNVDLSILPQGDQTLVGEKG 742

Query: 610 ALLSGGQKQRIAIARALLNKPKILILDEATSALDVE-SEGAINYTLG---------RLMK 659
             LSGGQK R+++ARA+ ++    +LD+  +A+D   ++  ++  LG         +++ 
Sbjct: 743 ISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVAKHLVDNVLGVTGLLHSKTKVLA 802

Query: 660 SKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLL 711
           + ++T++SIA  ++ +           +G +V+ G + ++  +  SAL KL+
Sbjct: 803 TNKITVLSIADSIALLE----------NGEIVQQGSYDEVVRDDGSALSKLI 844

>Kpol_311.3 s311 (5480..10453) [4974 bp, 1657 aa] {ON} (5480..10453)
            [4974 nt, 1658 aa]
          Length = 1657

 Score =  142 bits (359), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 140/518 (27%), Positives = 240/518 (46%), Gaps = 63/518 (12%)

Query: 228  RLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIG 287
            ++ S ++ K +H ++ F+D   +G +++R   D   V + +   +     AL C      
Sbjct: 1139 KIFSLLLNKALHANLRFFDSTPIGRIMNRFSKDMEAVDQELVPYLE---AALYC------ 1189

Query: 288  MMFHISSTLASVLFLFAPPLLVGATIYGNKIRAI-------SRELQQ----ASGNLTKVA 336
             +  ISST+  + ++  P  L+ A +      AI       SREL++        + +  
Sbjct: 1190 -IIDISSTILLITYI-TPEFLIIAILVAGLYYAIGVLYLAGSRELKRFDSITKSPIYQHF 1247

Query: 337  EEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAF----TNATFFSSTNVLGDFSF 392
             E L G+ TV+++  E     R+     ++ +   K  F    +N       +V+G    
Sbjct: 1248 SETLVGVTTVRAYGDEA----RFMRENLKMIDENNKPFFYLWVSNRWLAFRIDVVGA--- 1300

Query: 393  LLVLAYGSHLVLQGNLTIGDLTAFML--YTEYTGSAVFGLSTFYSELMKGAGAATRLFEL 450
            L++   G  ++L  +     L    L     +T SA++ L   YS L     +  RL E 
Sbjct: 1301 LVIFGSGVFVLLNIDKIDSGLAGISLSFAISFTESALW-LVRHYSNLEMNMNSVERLMEY 1359

Query: 451  LD-----YKPTIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCI 505
            ++     YK +  S    +  P  GK+E   VS  Y      ++ K+  FT++P   V I
Sbjct: 1360 MEVEQEPYKSS--SLDVPSSWPEEGKIEVNDVSLRYAP-NLPRVIKNATFTVDPKMKVGI 1416

Query: 506  VGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIR 565
            VG +G GKSTI + L R+ +P +G I +D  DI+ +  K LRR + ++ Q+P L SGTI+
Sbjct: 1417 VGRTGAGKSTIITALFRFLDPETGSIKIDNVDISTIELKKLRRSITIIPQDPTLFSGTIK 1476

Query: 566  ENIT-YG-VSRQPSMEEIRSVA-------------KKCFCHAFISKFPNGYETIIGPRGA 610
             N+  Y   S +   E ++ V              ++       +KF N     I   G+
Sbjct: 1477 SNLDPYDEYSEKQIFEALKRVNLVTEKELASGNSDQQSIASGNANKFLN-VNNEISEGGS 1535

Query: 611  LLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAH 670
             LS GQ+Q + +AR+LL  PK+++LDEAT+++D  S+  I  T+    +  + TI++IAH
Sbjct: 1536 NLSQGQRQLVCLARSLLRCPKVILLDEATASIDYASDAKIQETIRN--EFDDSTILTIAH 1593

Query: 671  RLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALH 708
            RL T+   + ++V+   G V E      L  N +S  +
Sbjct: 1594 RLRTVIDYDKILVMD-AGEVKEFDHPYSLLLNKNSIFY 1630

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 68/232 (29%), Positives = 119/232 (51%), Gaps = 11/232 (4%)

Query: 470 GKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSG 529
            K+ F++ + ++   K +   ++++   + G    I+GP+G GK+++   LL   +   G
Sbjct: 701 NKIAFKNATTTWNKEKQDFKLRNIDIDFKIGKLNVIIGPTGSGKTSLLMALLGEMDLIDG 760

Query: 530 KILV---DGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEE-IRSVA 585
           +I+V   D ++  KL +  L   +    Q   L++ T+R NI +     P  EE   +V 
Sbjct: 761 EIIVPCLDPREDLKLDANGLTNSIAYCSQAAWLLNDTVRNNILFN---SPYCEERYNAVV 817

Query: 586 KKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVE 645
           +             G  T IG RG  LSGGQKQR+++ARAL +  K L+LD+  SA+D  
Sbjct: 818 EASGLKRDFEILNAGDMTEIGERGITLSGGQKQRVSLARALYSNSKHLLLDDCLSAVDSH 877

Query: 646 SEGAI--NYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGK 695
           +   I  N   G LM+++  T I ++H ++   R+ + +V   +G +VE G+
Sbjct: 878 TATWIYDNCISGPLMENR--TCILVSHNIALTLRNADYVVKLENGKIVEHGE 927

>Smik_12.48 Chr12 (103624..108297) [4674 bp, 1557 aa] {ON} YLL015W
            (REAL)
          Length = 1557

 Score =  142 bits (358), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 145/532 (27%), Positives = 245/532 (46%), Gaps = 51/532 (9%)

Query: 211  NFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQ 270
            N   +++L     R   +L  ++ K  +   M F++   VG +++R  +D   V  S+  
Sbjct: 1036 NLRSIMMLLYCSIRGSKKLHESMAKSVIKSPMIFFETTPVGRIINRFSSDMDAVDSSLQY 1095

Query: 271  NISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIR-AISRELQQ-- 327
              S  FK+++   V + ++ +         FL     L+G  IY       +SREL++  
Sbjct: 1096 IFSFFFKSILTYLVTVILVGY-----NMPWFLVFNMFLLGIYIYYQTFYIVLSRELKRLI 1150

Query: 328  --ASGNLTKVAEEQLSGIKTV------QSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNAT 379
              +   +  +  E L+G   +      + F+    E  +YN  +  VFN      + +  
Sbjct: 1151 SISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQYN--IDFVFNFRSTNRWLSVR 1208

Query: 380  F--FSSTNVLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYT-EYTGSAVFGLSTFYSE 436
                 +T VL   + +L LA    +  +  L+ G +   M Y+ E TGS  + + T    
Sbjct: 1209 LQTIGATIVLA--TAMLTLA---TMNTKKQLSSGMVGLLMSYSLEVTGSLTWIVRT-TVM 1262

Query: 437  LMKGAGAATRLFELLDYKPTIKSTTGKAFK----PLNGKVEFQHVSFSYPTRKTNQIFKD 492
            +     +  R+ E  +     +S   +       P  G +EF+  S  Y     + + KD
Sbjct: 1263 IETNIVSVERIVEYCELPSEAQSINPEKRPDKNWPSRGSIEFKDYSTKY-RENLDPVLKD 1321

Query: 493  LNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGV 552
            +N  IEP   V IVG +G GKST++  L R   PT GKI++DG +I+ L    LR  L +
Sbjct: 1322 INVKIEPCEKVGIVGRTGAGKSTLSLALFRILEPTEGKIIIDGINISDLGLFDLRSHLAI 1381

Query: 553  VQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKF----PNGYE------ 602
            + Q+     GT++ N+      + S +E++   +       + K     P+  E      
Sbjct: 1382 IPQDAQAFEGTVKTNL--DPFNRYSEDELKKAVELAHLKPHLEKMLENEPSDSEESCDIK 1439

Query: 603  ----TIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLM 658
                  I   G+ LS GQ+Q + +ARALLN+ KIL+LDEAT+++D+E++  I  T+ R  
Sbjct: 1440 DILDVKINENGSNLSVGQRQLLCLARALLNRSKILVLDEATASIDMETDKIIQDTIRREF 1499

Query: 659  KSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
            K +  TI++IAHR+ T+  S+ +IVL  +GSV E      L +N  S  + L
Sbjct: 1500 KDR--TILTIAHRIDTVLDSDKIIVLD-EGSVKEFDSPSKLLSNKASIFYSL 1548

 Score = 91.7 bits (226), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 90/308 (29%), Positives = 148/308 (48%), Gaps = 41/308 (13%)

Query: 494 NFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSG-KILVDGQDITKLSSKSLRRQLGV 552
           +F  + G+ VCIVG  G GKST    +L      SG K  +  + I + SS      L  
Sbjct: 659 HFEAKRGNLVCIVGRVGAGKSTFLKAILGQLPCMSGSKESIPPKLIIRSSS------LAY 712

Query: 553 VQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALL 612
             QE  +M+ +++ENI +G     +  ++    K C     +   P+G ET++G +G  L
Sbjct: 713 CSQESWIMNASVKENILFGHKFDKAYYDL--TIKACQLLPDLRILPDGDETLVGEKGISL 770

Query: 613 SGGQKQRIAIARALLNKPKILILDEATSALDVE-SEGAINYTL-GRLMKSKELTIISIAH 670
           SGGQK R+++ARA+ ++  I +LD+  SA+D E S+  I Y L G+    K  TII   +
Sbjct: 771 SGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEYVLIGKKALLKNKTIILTTN 830

Query: 671 RLSTIRRSENVIVLGIDGSVVEMGKFKDLY--ANHDSALHKLLTXXXXXXXXXXXXYAPP 728
            +S ++ S+ +  L  +G +VE G +  +    N  S L KLL                 
Sbjct: 831 TVSILKHSQMIYALE-NGEIVEQGNYDSVMNRENSTSKLKKLL----------------- 872

Query: 729 AITQESEPQTEENGKDD--SGEDQNSDHEENSQDQ-NEKRLQEEVIH----QVLEDISHD 781
              +E +   ++  ++D  +G    SD +E  Q +  E   ++EVI     ++++  S  
Sbjct: 873 ---EEFDSPIDKGNENDTHTGHRSESDIDEPLQLKVVESETEDEVITDSELELIKTKSRR 929

Query: 782 QKTSTLRP 789
              +TLRP
Sbjct: 930 ASLATLRP 937

>TDEL0F04300 Chr6 complement(802866..807410) [4545 bp, 1514 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1514

 Score =  142 bits (357), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 144/515 (27%), Positives = 238/515 (46%), Gaps = 40/515 (7%)

Query: 216  VLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDG 275
            V   I G R    L S +    +   M F++   +G +L+R   D Y V   + +  +  
Sbjct: 1017 VFCTIRGSRY---LHSIMAASVLRAPMVFFETTPIGRILNRFSNDIYKVDELLGRTFAQF 1073

Query: 276  FKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKV 335
            F  +      I +   I  T    +FL  P +++        +R  SREL++   ++TK 
Sbjct: 1074 FVNVTKVSFTIIV---ICVTTWQFIFLILPMIVLYVYYQQYYLRT-SRELRRLD-SVTKS 1128

Query: 336  A-----EEQLSGIKTVQSFVAEGKEVH----RYNNAVRQVF---NVGKKEAFTNATFFSS 383
                  +E L G+ T++ +  + +  H    R +N +   +   N  +  AF    F  +
Sbjct: 1129 PVYAHFQESLGGLSTIRGYDQQDRFTHINQSRIDNNMSAFYPSVNANRWLAF-RLEFIGT 1187

Query: 384  TNVLGDFSFLLVLAYGSHLVLQ-GNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAG 442
              + G  S        S L L+ G+LT G +   + Y      ++  +     E+     
Sbjct: 1188 IIIFGAASL-------SMLRLKAGSLTPGMIGLSLSYALQITQSLNWIVRMTVEVETNIV 1240

Query: 443  AATRLFELLDYKP----TIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIE 498
            +  R+ E  + K      I+     A  P  G ++F+H S  Y     N + KD+N  ++
Sbjct: 1241 SVERIKEYSEIKSEAPLVIEDHRPPADWPSKGDIKFEHYSTRY-RENMNLVLKDINLHVK 1299

Query: 499  PGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPI 558
            P   + IVG +G GKS++   L R      G+I++DG  I ++    LR +L ++ Q+  
Sbjct: 1300 PQEKIGIVGRTGAGKSSLTLALFRIIEAAEGRIVIDGVPINEIGLHDLRHKLSIIPQDSQ 1359

Query: 559  LMSGTIRENITYGVSRQPSMEEIRSVAKKCFC-HAFISKFPNGYETIIGPRGALLSGGQK 617
            +  GT+RENI    + Q S EEI  V +     +  +S   +G  T +   GA LS GQ+
Sbjct: 1360 VFEGTVRENI--DPTNQYSDEEIWRVLELSHLKNHVLSMSKDGLMTRLTEGGANLSVGQR 1417

Query: 618  QRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRR 677
            Q + +ARALL   +ILILDEAT+A+DVE++  I  T+    K +  TI++IAHRL+TI  
Sbjct: 1418 QLMCLARALLIPSRILILDEATAAVDVETDQVIQETIRTAFKDR--TILTIAHRLNTIMD 1475

Query: 678  SENVIVLGIDGSVVEMGKFKDLYANHDSALHKLLT 712
            S+ ++VL   G V E    ++L     S  + L +
Sbjct: 1476 SDRILVLD-AGEVREFDTPENLLKQQGSIFYSLCS 1509

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 118/520 (22%), Positives = 218/520 (41%), Gaps = 71/520 (13%)

Query: 222 GERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALIC 281
           G  + + L S + KK +    E  D +  GD+++ +  D   + + +TQ     +  LI 
Sbjct: 379 GMNIKSALTSTIYKKALVLSNEAADMSSTGDIVNLMSVDVQRL-QDLTQ-----YCHLIW 432

Query: 282 GGVGIGMMFHISSTLASVLFLFAPPLLVGATIY------GNKIRAISRELQQAS----GN 331
            G      F I   L S+  L    + +G  I        + +  I ++LQ+        
Sbjct: 433 SGP-----FQILLCLVSLYKLLGRSMWIGVIILVIMMPLNSMLMRIQKKLQKVQMKNKDE 487

Query: 332 LTKVAEEQLSGIKTVQSFVAEGK-----EVHRYNNAVRQVFNVGKKEAFTNATFFSSTNV 386
            +++  E L+ IK+++ +  E       E  R +  ++ +  +G   A T+  F +    
Sbjct: 488 RSRLISEILNNIKSLKLYSWEAPYKAKLEHVRNDKELKNLTKMGVYMALTSFQF-NIVPF 546

Query: 387 LGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATR 446
           L   S   V  Y     L  +L    L  F L +         L+ F    ++ + +  R
Sbjct: 547 LVSCSTFAVFVYTEKKPLTTDLVFPALALFNLLSFPLNVVPMVLTAF----IEASVSVNR 602

Query: 447 LFELLDYKPTIKSTTG---KAFKPLNGKVEF-QHVSFSYPTRKTNQI-FKDLNFTIEPGS 501
           L+  L  +   K       KA K  +  ++     +F +  +   Q+  K++N  ++ G 
Sbjct: 603 LYSFLTNEELQKDAVHHLPKAQKAGDVAIKISDDANFLWKRKPQYQVALKNINLEVKKGE 662

Query: 502 NVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMS 561
             C+VG  G GKS +   LL       G   V G                 V Q P +M+
Sbjct: 663 LACVVGKVGSGKSALVQSLLGDLYRVKGYAAVHGST-------------AYVSQVPWIMN 709

Query: 562 GTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIA 621
           GT+++NI +G    P   ++    K C     +   P+G +T++G +G  LSGGQK R++
Sbjct: 710 GTVKDNILFGHKYDPVFYDL--TIKACALTIDLGILPDGDQTMVGEKGISLSGGQKARLS 767

Query: 622 IARALLNKPKILILDEATSALDVE-SEGAINYTLG---------RLMKSKELTIISIAHR 671
           +ARA   +    +LD+  +A+D   ++  I + LG         +L+ + ++T++SIA  
Sbjct: 768 LARATYARADTYLLDDPLAAVDEHVAQHLIEHVLGPRGLLKSKTKLLATNKITVLSIASS 827

Query: 672 LSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLL 711
           +S +            G +++ G ++D+  + DS L  L+
Sbjct: 828 ISLVE----------GGEIIQHGSYEDISKDLDSPLSNLV 857

>KLTH0H16038g Chr8 (1376941..1381890) [4950 bp, 1649 aa] {ON} similar
            to uniprot|P32386 Saccharomyces cerevisiae YLL048C
          Length = 1649

 Score =  140 bits (354), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 133/517 (25%), Positives = 244/517 (47%), Gaps = 64/517 (12%)

Query: 233  VIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGMMFHI 292
            ++KK ++  + F+D   +G +++R   D   V + +T  +   F +L+     + ++ +I
Sbjct: 1133 ILKKVLYAKLRFFDSTPIGRIMNRFSRDIEAVDQELTPFVEGAFVSLVQCLSTVILIAYI 1192

Query: 293  SSTLASVLFLFAPPLLVGATIY--GNKIRAISRELQQ----ASGNLTKVAEEQLSGIKTV 346
            +         F   + +G   Y  G    A SREL++    +   + +   E L GI T+
Sbjct: 1193 TPDF------FFVAIFIGIFYYLVGYFYMAGSRELKRYESISRSPIHQHFSETLVGITTI 1246

Query: 347  QSFVAEGK-------EVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAYG 399
            ++F  E +       ++   N     ++   +  AF         +++G     ++ A G
Sbjct: 1247 RAFGDERRFMQENLTKIDENNKPFFYLWVANRWLAF-------RIDMIGA---CVIFAAG 1296

Query: 400  SHLVLQ-----GNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYK 454
              ++L        L    LT  + +TE        L   YS +     +  RL E ++ +
Sbjct: 1297 IFVLLNIKSLDSGLAGISLTYAISFTE----GALWLVRLYSNVEMTMNSVERLKEYMEVE 1352

Query: 455  --PTIKSTTGKAFK-PLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGR 511
              P  +ST     + P  GK+E   +S  Y      ++ K++ FT++P   V IVG +G 
Sbjct: 1353 QEPHYQSTHNPPPEWPSQGKIEVNDLSLRYAP-SLPKVIKNVTFTVDPNCKVGIVGRTGA 1411

Query: 512  GKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENI--- 568
            GKSTI + L R+ +P SG I +D  DIT +  K LR+ + ++ Q+P L +GT++ N+   
Sbjct: 1412 GKSTIITALFRFLDPESGYIKIDNVDITSVELKRLRQSITIIPQDPTLFTGTVKSNLDPY 1471

Query: 569  -TYGVSRQ--PSMEEIRSVAKKCFCHA---------FISKFPNGY---ETIIGPRGALLS 613
              Y   +Q   +++ +  V ++   HA          +S+  N +   E  I   G+ LS
Sbjct: 1472 DEYS-DKQIFEALKRVNLVTQEELDHAANPSPDNASAVSENVNKFLFLENEISEGGSNLS 1530

Query: 614  GGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLS 673
             GQ+Q + +AR+LL  PK+++LDEAT+++D +S+  I  T+    +  + TI++IAHRL 
Sbjct: 1531 QGQRQLVCLARSLLRSPKVMLLDEATASIDYQSDARIQQTIRS--EFSDSTILTIAHRLR 1588

Query: 674  TIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
            +I   + ++V+   G V E      L  N +S  + +
Sbjct: 1589 SIIDYDKILVMD-AGEVKEYDHPYSLLLNKNSIFYSM 1624

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 63/237 (26%), Positives = 119/237 (50%), Gaps = 11/237 (4%)

Query: 470 GKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSG 529
            K+ F++ +FS+  +  +   K++N   + G    ++GP+G GK+++   LL   +   G
Sbjct: 687 NKIGFENATFSWDRKNPDFKLKNMNIDFKLGKLNVVIGPTGSGKTSLLMGLLGEMDLLEG 746

Query: 530 KI---LVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSME-EIRSVA 585
           K+    +D ++   + +  +   +    Q   L++ T++ NI +     P  E    +V 
Sbjct: 747 KVYAPCLDPREDMVIENDGMTNSIAYCSQAAWLLNDTVKNNILFS---SPFNEGRYNAVI 803

Query: 586 KKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVE 645
           + C           G +T IG +G  LSGGQKQR+++ARAL +  + L+LD+  SA+D  
Sbjct: 804 EACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARALYSSSRHLLLDDCLSAVDSH 863

Query: 646 SEGAI--NYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLY 700
           +   I  N   G LM+ +  T I ++H ++   ++   +V   +G V + G+  +LY
Sbjct: 864 TALWIYENCISGPLMEGR--TCILVSHNVALTLKNAEWVVFMENGRVKDQGEPLELY 918

>Skud_8.9 Chr8 complement(16026..20789) [4764 bp, 1587 aa] {ON}
            YHL035C (REAL)
          Length = 1587

 Score =  140 bits (354), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 137/533 (25%), Positives = 238/533 (44%), Gaps = 55/533 (10%)

Query: 208  TMANFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRS 267
            TMA F       + G +   ++ +N++   +H ++ F+D   VG +++R   D   V + 
Sbjct: 1061 TMATF-------LSGLQASKKIFNNMLDLVLHANIRFFDVTPVGRIMNRFAKDIEGVDQE 1113

Query: 268  MTQNISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQ 327
            +   +      LI     I ++  I+     V  +           Y +  R + R    
Sbjct: 1114 LIPYLEVTIFCLIQCLSIIFLITIITPRFLVVAVVVLVLYYFVGKCYLSAGRELKRIDSI 1173

Query: 328  ASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVL 387
                + +   E L+G+ T+++F  E + +    + + Q           N  FF  +  +
Sbjct: 1174 TKSPIFQYFSETLAGVCTIRAFGDEKRFILENMDKIDQ----------NNRAFFYLSVAV 1223

Query: 388  GDFSF-------LLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVF-----GLSTFYS 435
              F+F        +VL  GS ++L     IGD+ + +     T S +F      L   YS
Sbjct: 1224 KWFAFRVDIIGAFIVLGSGSFILLN----IGDIDSSLAGISLTYSILFTDGALWLVRLYS 1279

Query: 436  ELMKGAGAATRL-----FELLDYKPTIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIF 490
                   +  RL      E  +Y          +  P +GK+E  ++S  Y +     + 
Sbjct: 1280 TFEMNMNSVERLKEYSGIEQENYNENHIQALQNSLWPEHGKIEVDNLSLRYAS-NLPPVI 1338

Query: 491  KDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQL 550
            K+++FT++P + + IVG +G GKSTI + L R   P +G I +DG DI+K+   +LRR +
Sbjct: 1339 KNVSFTVDPQTKIGIVGRTGAGKSTIITALFRLLKPVTGCIKIDGYDISKIDLVTLRRAI 1398

Query: 551  GVVQQEPILMSGTIRENI----------TYGVSRQPSMEEIRSVAKKCFCHAFISKFPNG 600
             ++ Q+PIL +GTI+ N+           + V  Q ++   R + +        S   N 
Sbjct: 1399 TIIPQDPILFTGTIKSNLDPYDEYDERRIFKVLSQVNLISSRELEETLNREENFSGVHNR 1458

Query: 601  Y---ETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRL 657
            +    T I   G  LS G+KQ + IAR+LL +PKI++LDEATS++D +S+  I   +   
Sbjct: 1459 FLNLRTEIVEGGLNLSQGEKQLLFIARSLLREPKIILLDEATSSIDYDSDHLIQGIIRNE 1518

Query: 658  MKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
                  TI++IAHRL ++   + V+V+   G V E     +L  N  S  + +
Sbjct: 1519 FSRS--TILTIAHRLRSVIDYDKVLVMD-AGEVKEYDHPYELLKNERSIFYSM 1568

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 85/283 (30%), Positives = 128/283 (45%), Gaps = 23/283 (8%)

Query: 430 LSTFYSELMKGAGAATRLFELLDYKPTIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQI 489
           LS   S + +   +  R+ E L+ + T K        P   K++F+  +  +     N I
Sbjct: 621 LSNMLSFMNQSKVSLERIVEFLNEEDTAKYNQLTV-SPDKNKIKFKKATLVW-NENDNDI 678

Query: 490 FK----DLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQD-----ITK 540
            K    DLN     G    I+G +G GKS +   LL      SG I+V G +     I  
Sbjct: 679 NKFRLCDLNINFRIGKLNLILGSTGSGKSALLMGLLGELYLLSGSIIVPGLEPRHDMIPD 738

Query: 541 LSSKSLRRQLGVVQQEPILMSGTIRENITY-GVSRQPSMEEIRSVAKKCFCHAFISKFPN 599
           L+   L        Q   L++GT+R NI + GV  +      ++V   C     +   P 
Sbjct: 739 LNG--LTNSFAYCSQSAWLLNGTVRNNIIFNGVYDE---NRYKNVIDACGLKRDLEILPA 793

Query: 600 GYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTL---GR 656
           G  T IG +G  LSGGQKQRI++ARA+ +  K ++LD+  SA+D  +   I Y +   G 
Sbjct: 794 GDSTEIGEKGITLSGGQKQRISLARAIYSNAKHVLLDDCLSAVDSHTAIWI-YEICITGL 852

Query: 657 LMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDL 699
           LMK++  T I + H +S   R     V+  +G V   G   +L
Sbjct: 853 LMKNR--TCILVTHNISLAIRKAYFAVILENGKVKSQGTITEL 893

>KLLA0D04059g Chr4 complement(338422..343128) [4707 bp, 1568 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1568

 Score =  140 bits (354), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 138/502 (27%), Positives = 228/502 (45%), Gaps = 56/502 (11%)

Query: 242  MEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGMMFHISSTLASVLF 301
            M F++   VG +++R  +D   +       IS  F++++   + I ++     T++   F
Sbjct: 1080 MSFFETTPVGRIVNRFSSDVNSIDEDFQHIISFFFRSMLDYLITIVII-----TVSMPWF 1134

Query: 302  LFAPPLLVGATIYGNKIRAI-SRELQQASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYN 360
            L    +L+G   Y   +  + SREL++    LT ++         V S ++E    H   
Sbjct: 1135 LLFNTILLGIYYYYQTLYVVLSRELKR----LTSIS------YSPVMSLLSETLGGHVVI 1184

Query: 361  NAVRQ--VFNVGKKEAF-TNATF---FSSTN------------VLGDFSFLLVLAYGSHL 402
            NA +   +FN    E   TN  F   F STN            V+   + L+ LA    L
Sbjct: 1185 NAYKHANIFNYYNFENIQTNINFIFNFRSTNRWLSMRLQTIGAVIVLITSLMALA---SL 1241

Query: 403  VLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKP----TIK 458
                 ++ G +   M Y     S++  +      +     +  R+ E  D KP     I+
Sbjct: 1242 GTSNPISAGLIGLLMSYALQVSSSLMWIIRMAVNIETTIVSVERIIEYRDLKPEGIRVIE 1301

Query: 459  STTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIAS 518
             +      P  G++ F+H +  Y     + + KD++  I+    + +VG +G GKST+  
Sbjct: 1302 DSRPPKNWPKRGEITFEHYTTKY-RENLDPVLKDIDLRIKHQEKIGVVGRTGAGKSTLTL 1360

Query: 519  LLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSM 578
             L R   P  GKI +DG DI+ L    LRR L ++ Q+     GT+R N+    +R    
Sbjct: 1361 ALFRILEPFEGKITIDGIDISTLGLYDLRRSLSIIPQDAQAFEGTVRSNLD-PFNRHTDA 1419

Query: 579  EEIRSVA---KKCFCHAFISKFPNG-------YETIIGPRGALLSGGQKQRIAIARALLN 628
            E  +++     K      +S+ P+         +T I   G  LS GQ+Q + ++RALLN
Sbjct: 1420 EIWKALELSHLKPHIERIVSELPDDENKPTDLLDTQISDNGNNLSMGQRQLLCLSRALLN 1479

Query: 629  KPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDG 688
              KILILDEAT+A+D E++  I  T+    K +  TI++IAHR+ T+  S+ ++VL   G
Sbjct: 1480 PSKILILDEATAAVDRETDKIIQETIRTAFKDR--TILTIAHRIDTVLDSDKIMVLD-KG 1536

Query: 689  SVVEMGKFKDLYANHDSALHKL 710
             V E     +L  N +S  + L
Sbjct: 1537 EVKEFDTPDNLLKNKESLFYGL 1558

 Score = 87.8 bits (216), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 117/517 (22%), Positives = 227/517 (43%), Gaps = 66/517 (12%)

Query: 222 GERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALIC 281
           G ++   L S V +K++    E  +    GD+L+ +  D   + R            ++ 
Sbjct: 358 GLKIRGSLMSLVYQKSLRLSAEAREDKANGDVLNLMSVDVIRIQRFFEN------AQILV 411

Query: 282 GG----VGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKI-RAISRELQQASGNLTKVA 336
           G     +G+ +  ++    A++  L +  ++V    Y  ++ + + +   Q      K  
Sbjct: 412 GSPIQLIGVLISLYVLLGNATIGGLVSIVIMVPINSYMTRLYKKLFKTQMQYKDKRIKTV 471

Query: 337 EEQLSGIKTVQSFVAEGKEVHRYNNAVR---QVFNVGKKEAFTNATFFSSTNV--LGDFS 391
            E L+ +K+++ +  E   + R N+ VR   ++ N+ K    +N  FF    V  L   S
Sbjct: 472 TEILNSMKSIKLYAWEKPMLDRLNH-VRNDLELHNMKKIAIVSNFMFFCWNIVPLLVTCS 530

Query: 392 FLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRL---- 447
             ++ +Y +  VL   +    LT F +  +    A+F + T  S +++   +  RL    
Sbjct: 531 TFVLFSYLTDQVLSPQIIFPSLTLFSMLND----ALFTVPTMISNIIEIGVSLKRLKGYL 586

Query: 448 -FELLDYKPTIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDL------------- 493
             E LD    I+     A  P    VE  +  F + + K+    +D              
Sbjct: 587 LAEELD-TSFIEHARATASDP---TVEISNAVFLWKSPKSAASSEDTDEEAEISSPGVAL 642

Query: 494 ----NFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKI-LVDGQDITKLSSKSLRR 548
               NF+ +     CIVG  G GKST    +L       G++  V     + +  K + R
Sbjct: 643 KSIENFSAKKAQLTCIVGRVGSGKSTFLQAIL-------GQLPCVSSDSASGVKPKVVIR 695

Query: 549 --QLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIG 606
              L    Q+P +M+ ++++NI +G     +M   +   K C     +   P+G +T++G
Sbjct: 696 ADNLAYCPQQPWIMNASLKDNILFGYKYDEAM--YKKTIKACQLLPDLEILPDGDQTLVG 753

Query: 607 PRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVE-SEGAINYTLGR---LMKSKE 662
            +G  LSGGQK R+++ARA+ ++  + +LD+  SA+D    +  I+  L R   L+K+K 
Sbjct: 754 EKGISLSGGQKARLSLARAVYSRADLYLLDDVLSAVDSHVCKSIIDDVLDRQKGLLKNK- 812

Query: 663 LTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDL 699
            T+I   + ++ +  S+ + +L  +G +VE   ++++
Sbjct: 813 -TVILTTNAVNVLVHSDMIYLLK-NGKIVESNSYEEV 847

>CAGL0L06402g Chr12 (720723..725330) [4608 bp, 1535 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135c YCF1 or uniprot|P14772 Saccharomyces cerevisiae
            YLL015w BPT1
          Length = 1535

 Score =  140 bits (353), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 141/523 (26%), Positives = 239/523 (45%), Gaps = 60/523 (11%)

Query: 216  VLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAY----IVSRSMTQN 271
            +   I G   +  L +N + +     M F++   +G +L+R   D Y    I+ R+ +Q 
Sbjct: 1037 IFCTIHGSTYLHNLMTNAVFRA---PMSFFETTPIGRILNRFSNDIYKVDSILGRTFSQF 1093

Query: 272  ISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGN 331
              +  K L   GV       I+ T    +F+  P  +         +R  SREL++   +
Sbjct: 1094 FVNTVKVLFTIGV-------IAYTTWQFVFVIVPLGIFYIYYQQYYLRT-SRELRRLE-S 1144

Query: 332  LTKVA-----EEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNV 386
            +T+       +E L G+ T++ +  + +  H   N  R   N+        + F+ S N 
Sbjct: 1145 VTRSPIFSHFQETLGGLATIRGYGQQKRFEHI--NECRVDNNM--------SAFYPSINA 1194

Query: 387  LGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYS----------- 435
                ++ L    GS ++L        L+ F L      + + GLS  Y+           
Sbjct: 1195 NRWLAYRLEFI-GSVIILGA----ATLSIFKLRAGTMTAGMIGLSLSYALQITQTLNWIV 1249

Query: 436  ----ELMKGAGAATRLFELLDYKP----TIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTN 487
                E+     +  R+ E  + K      I+S       P+ G+++F+H    Y     +
Sbjct: 1250 RMTVEVETNIVSVERIKEYSELKSEAPLVIESNRPPKEWPVAGEIKFEHYYTRY-REDLD 1308

Query: 488  QIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLR 547
             + KD+N  I+P   + IVG +G GKS++   L R    TSG IL+DG  I ++    LR
Sbjct: 1309 YVLKDINLEIKPREKIGIVGRTGAGKSSLTLALFRIIEATSGGILIDGVHINEIGLHDLR 1368

Query: 548  RQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGP 607
              L ++ Q+  +  GTIRENI    ++    +  R++         +    +G  T++  
Sbjct: 1369 HHLSIIPQDSQVFEGTIRENID-PTNQFTDADIWRALELSHLKEHIMQMGGDGLMTMMTE 1427

Query: 608  RGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIIS 667
             G+ LS GQ+Q + +ARALL   K+L+LDEAT+A+DVE++  I  T+    K +  TI++
Sbjct: 1428 GGSNLSVGQRQLMCLARALLVPSKVLVLDEATAAVDVETDKVIQETIRTSFKDR--TILT 1485

Query: 668  IAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
            IAHR++TI  ++ +IVL   G VVE    + L  N +S  + L
Sbjct: 1486 IAHRINTIMDNDRIIVLD-KGKVVEFDTPEALLKNTNSIFYSL 1527

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 121/512 (23%), Positives = 219/512 (42%), Gaps = 55/512 (10%)

Query: 222 GERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALIC 281
           G  + + L S + +K +    E  + +  GD+++ +  D   + + +TQ I      LI 
Sbjct: 393 GMNVKSALTSIIYQKALVLSNEASNTSSTGDIVNLMSVDVQKL-QDLTQWIH-----LIW 446

Query: 282 GGVGIGMMFHISSTLASVLFLFAPPLLVGATIY------GNKIRAISRELQQASGNL--- 332
            G        I   L S+  L    + VG  I        + +  I + LQ++       
Sbjct: 447 SGP-----LQIVLCLISLYKLLGHSMWVGVLILTIMIPVNSFLMKIQKNLQKSQMKFKDE 501

Query: 333 -TKVAEEQLSGIKTVQSFVAEG--KEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNV--L 387
            T+V  E L+ +K+++ +  E   KE   Y    +++ N+ K   +   T F    V  L
Sbjct: 502 RTRVISEILNNMKSLKLYAWEQPYKEKLEYVRNEKELKNLKKLGVYMACTSFQFNIVPFL 561

Query: 388 GDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRL 447
              S   V  Y     L  +L    LT F L +      +  +    + +++ + + +RL
Sbjct: 562 VSCSTFAVFVYTEDKALTTDLVFPALTLFNLLS----FPLMVIPNVITAIIESSVSVSRL 617

Query: 448 FELLDYKPTIKSTTGKAFKPLN-GKVEFQ---HVSFSYPTRKTNQI-FKDLNFTIEPGSN 502
           F  L  +   K    +  K    G V      + +F +  +   ++  K++N+  + G  
Sbjct: 618 FNFLTNEELQKDAVQRLPKVKEIGDVAVNVGDNATFLWKRKPEYKVALKNINYQAKKGEL 677

Query: 503 VCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSG 562
            CIVG  G GKS     LL       G   + G              +  V Q   +M+G
Sbjct: 678 SCIVGKVGSGKSAFLQSLLGDLFRVKGFATIHGS-------------VAYVSQVAWIMNG 724

Query: 563 TIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAI 622
           T+R+N+ +G    P   E     K C     ++   +G +T++G +G  LSGGQK R+++
Sbjct: 725 TVRDNVLFGHKYDPEFYE--KTIKACALTIDLATLVDGDQTLVGEKGISLSGGQKARLSL 782

Query: 623 ARALLNKPKILILDEATSALDVE-SEGAINYTLGR--LMKSKELTIISIAHRLSTIRRSE 679
           ARA+  +    +LD+  +A+D   S   + + LG   L+ SK  T I   +++S +  ++
Sbjct: 783 ARAVYARADTYLLDDPLAAVDEHVSRHLVEHVLGPNGLLHSK--TRILATNKISVLSAAD 840

Query: 680 NVIVLGIDGSVVEMGKFKDLYANHDSALHKLL 711
           ++ +L  +G + + G + D   + +SAL KLL
Sbjct: 841 SITLLE-NGEITQQGTYADCRKDEESALGKLL 871

>Kwal_34.15770 s34 complement(51755..56065) [4311 bp, 1436 aa] {ON}
            YLL048C (YBT1) - bile acid transporter of ABC family
            [contig 274] PARTIAL
          Length = 1436

 Score =  140 bits (353), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 136/509 (26%), Positives = 237/509 (46%), Gaps = 48/509 (9%)

Query: 233  VIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALI-CGGVGIGMMFH 291
            ++KK ++  + F+D   +G +++R   D   V + +T  +   F +L+ C    I + + 
Sbjct: 920  ILKKVLYAKLRFFDSTPIGRIMNRFSKDIEAVDQELTPFVEGAFVSLVQCLSTVILIAYI 979

Query: 292  ISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEEQLSGIKTVQSFVA 351
                    +F+     LVG   Y    R + R    +   + +   E L GI T+++F  
Sbjct: 980  TPGFFVVAIFIAILYYLVGY-FYMAGSRELKRFESISRSPIHQHFSETLVGITTIRAF-- 1036

Query: 352  EGKEVHRYNNAVRQVFNVGKKEAF----TNATFFSSTNVLGDFSFLLVLAYGSHLVLQ-- 405
             G E  R+     +  +   K  F     N       +++G     ++ A G  ++L   
Sbjct: 1037 -GDE-RRFMQENLEKIDENNKPFFYLWVANRWLAFRIDMIGA---CVIFAAGIFVLLNIK 1091

Query: 406  ---GNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYK--PTIKST 460
                 L    LT  + +TE        L   YS +     +  RL E ++ +  P  +ST
Sbjct: 1092 SLDSGLAGISLTYAISFTE----GALWLVRLYSNVEMTMNSVERLKEYMEVEQEPHYQST 1147

Query: 461  -TGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASL 519
             T     P  GK+E   +S  Y      ++ K+++FT++P   V IVG +G GKSTI + 
Sbjct: 1148 HTPPPEWPSQGKIEVNDLSLRYAP-SLPKVIKNVSFTVDPNCKVGIVGRTGAGKSTIITA 1206

Query: 520  LLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENI----------T 569
            L R+ +P SG I +D  DIT +  K LR+ + ++ Q+P L +GT++ N+           
Sbjct: 1207 LFRFLDPESGYIKIDNVDITSVELKRLRQSITIIPQDPTLFTGTVKSNLDPYDEYSDGQI 1266

Query: 570  YGVSRQPSM---EEIRSVAKKCFCHAFI-SKFPNGY---ETIIGPRGALLSGGQKQRIAI 622
            +   ++ ++   EE+ S       ++ I S+  N +   +  I   GA LS GQ+Q + +
Sbjct: 1267 FEALKRVNLLTEEELNSAGSPAPGNSSIHSENVNKFLRLDNEITEGGANLSQGQRQLVCL 1326

Query: 623  ARALLNKPKILILDEATSALDVESEGAINYTL-GRLMKSKELTIISIAHRLSTIRRSENV 681
            AR+LL  PK+++LDEAT+++D  S+  I  T+ G    S   TI++IAHRL +I   + +
Sbjct: 1327 ARSLLRSPKVMLLDEATASIDYTSDARIQQTIRGEFSNS---TILTIAHRLRSIIDYDKI 1383

Query: 682  IVLGIDGSVVEMGKFKDLYANHDSALHKL 710
            +V+   G V E      L  N +S  + +
Sbjct: 1384 LVMD-AGEVKEYDHPYSLLLNKNSIFYSM 1411

 Score = 81.6 bits (200), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 102/468 (21%), Positives = 209/468 (44%), Gaps = 38/468 (8%)

Query: 250 VGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGMMFHI---SSTLASVLFLFAPP 306
           +G +++ +  DA+ VS  +   +    +AL+   V + +++ +   S+ +  +L +   P
Sbjct: 258 LGAIINLMAVDAFKVSE-ICAYLHSFVEALVMTIVALTLLYKLLGWSAIVGVLLIIVILP 316

Query: 307 L-LVGATIYGNKIRAISRELQQASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQ 365
           L    A + GN    + +E    +    +   E    I+ ++ F  E        N   Q
Sbjct: 317 LNFKLANLLGN----LQKETLSFTDKRIQKLNETFQAIRIIKFFSWEENFEKDIQNIRDQ 372

Query: 366 VFNVGKKE----AFTNATFFSSTNVLGDFSFLLVLAYGSHLVLQGNL--TIGDLTAFMLY 419
              +  K     A T   +F + +++   SF       +++ +QG +  T    TA  L+
Sbjct: 373 ELKMLVKRSIVWALTAFVWFVTPSIVTTVSF------ATYIYIQGEVLTTPVAFTALSLF 426

Query: 420 TEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIKSTTGKAFKPLNGKVEFQHVSF 479
           T    + +  LS   S +++   +  R+   L+   T K       +    ++ F++ +F
Sbjct: 427 T-LLRNPLDMLSDMLSYVIQSKVSLDRVQVFLEEDETEKYDQITVSRK---RIGFENATF 482

Query: 480 SYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKI---LVDGQ 536
           S+  +  +   K+++     G    ++GP+G GK+++   LL   +   GK+    +D +
Sbjct: 483 SWDRKNPDFKLKNMSIEFRLGKLNVVIGPTGSGKTSLLMGLLGEMDLLEGKVYAPCLDPR 542

Query: 537 DITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIR--SVAKKCFCHAFI 594
           +   + +  +   +    Q   L++ T++ NI +         E R  +V + C      
Sbjct: 543 EDLIVENDGMTNSIAYCSQGAWLLNDTVKNNILFS----SPFNEARYDAVVEACGLKRDF 598

Query: 595 SKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAI--NY 652
                G +T IG +G  LSGGQKQR+++ARAL +  + L+LD+  SA+D  +   I  N 
Sbjct: 599 EILSAGDQTEIGEKGITLSGGQKQRVSLARALYSSSRHLLLDDCLSAVDSHTALWIYENC 658

Query: 653 TLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLY 700
             G LM+ +  T I ++H ++   ++ + +V   +G V + G+  +L+
Sbjct: 659 ITGPLMEGR--TCILVSHNVALTLKNADWVVFMENGKVKDQGEPLELF 704

>NCAS0B03470 Chr2 complement(606008..610546) [4539 bp, 1512 aa] {ON}
            Anc_8.303
          Length = 1512

 Score =  140 bits (352), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 140/485 (28%), Positives = 226/485 (46%), Gaps = 33/485 (6%)

Query: 242  MEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGM-MFHISSTLASVL 300
            M F++   +G +L+R   D Y V   + +  S  F       V +   +  I  T    +
Sbjct: 1036 MTFFETTPIGRILNRFSNDVYKVDSVLGRTFSQFF----VNAVKVSFTIIVICFTTWQFI 1091

Query: 301  FLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVA-----EEQLSGIKTVQSFVAEGKE 355
            F+  P L V    Y       SREL++   ++TK       +E L GI T++ +    ++
Sbjct: 1092 FIIIP-LGVFYIYYQQYFLRTSRELRRLD-SITKSPIFSHFQETLGGITTIRGY----QQ 1145

Query: 356  VHRYN--NAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAYGSHLVL---QGNLTI 410
             HR+   N  R   N+       NA  + +   L     L++L   +  V    QG LT 
Sbjct: 1146 QHRFTHINQCRVDNNMSAFYPSVNANRWLAYR-LETIGSLIILGAATLSVFRLRQGTLTA 1204

Query: 411  GDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYK----PTIKSTTGKAFK 466
            G +   + Y      ++  +     E+     +  R+ E  D K      I+        
Sbjct: 1205 GMVGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSDLKSEAPAVIEDHRPAETW 1264

Query: 467  PLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNP 526
            P  G ++F+H S  Y   + + I KD+N  I+P   V IVG +G GKS++   L R    
Sbjct: 1265 PDEGDIKFEHYSTRYRP-ELDLILKDINVHIKPKEKVGIVGRTGAGKSSLTLALFRIIEA 1323

Query: 527  TSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSV-A 585
            +SG+I++D   I ++    LR +L ++ Q+  +  GT+RENI    + + + E+I +V A
Sbjct: 1324 SSGRIVIDNVPINEIGLYDLRHKLSIIPQDSQVFEGTVRENI--DPTNEYTDEQIWNVLA 1381

Query: 586  KKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVE 645
                    IS    G    +   G  LS GQ+Q + +ARALL   KIL+LDEAT+A+DVE
Sbjct: 1382 LSHLKDHIISMGDEGLNNQLTEGGNNLSVGQRQLLCLARALLVPSKILLLDEATAAVDVE 1441

Query: 646  SEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDS 705
            ++  I  T+    K +  TI++IAHR++TI  S+ +IVL  +G++ E    + L  N  S
Sbjct: 1442 TDKVIQETIRTAFKDR--TILTIAHRINTIMDSDRIIVLD-NGTIKEFDSPEKLLENPSS 1498

Query: 706  ALHKL 710
              + L
Sbjct: 1499 LFYSL 1503

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/233 (24%), Positives = 112/233 (48%), Gaps = 35/233 (15%)

Query: 490 FKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQ 549
            K++NF  + G   CIVG  G GKS +   +L       G   + G              
Sbjct: 643 LKNINFQAKKGELTCIVGKVGSGKSAMIQSILGDLFRVKGFATIHGN------------- 689

Query: 550 LGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRG 609
           +  V Q   +M+GT++ENI +G   +   +  +   K C     ++   +G +T++G +G
Sbjct: 690 VAYVSQVAWIMNGTVKENILFG--HKYDEDFYQKTIKACALTIDLAVLMDGDQTLVGEKG 747

Query: 610 ALLSGGQKQRIAIARALLNKPKILILDEATSALDVE-SEGAINYTLG---------RLMK 659
             LSGGQK R+++ARA+ ++    +LD+  +A+D   +   + + LG         +++ 
Sbjct: 748 ISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLVEHVLGPNGLLHTKTKVLA 807

Query: 660 SKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLLT 712
           + +++++SIA  +S +           +G +V+ G + ++  +  S L KL+T
Sbjct: 808 TNKVSVLSIADSVSLLE----------NGEIVQQGTYDEIMKDDSSPLSKLIT 850

>YLL048C Chr12 complement(41280..46265) [4986 bp, 1661 aa] {ON}
            YBT1Transporter of the ATP-binding cassette (ABC) family
            involved in bile acid transport; similar to mammalian
            bile transporters
          Length = 1661

 Score =  140 bits (352), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 131/542 (24%), Positives = 242/542 (44%), Gaps = 72/542 (13%)

Query: 213  GRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNI 272
            G+ +L  + G     ++ + ++ K +H  + F+D    G +++R   D   + + +T  I
Sbjct: 1121 GKTILNFVAGINASRKIFNMILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYI 1180

Query: 273  SDGFKALI-CGGVGIGMMFHISSTLA-----SVLFLFAPPLLVGATIYGNKIRAISRELQ 326
               F +LI C    I + F     L+     S+L+ F     +  +    +  +ISR   
Sbjct: 1181 QGAFYSLIECLSTVILITFITPQFLSVAIVVSILYYFVGYFYMAGSRELKRFESISR--- 1237

Query: 327  QASGNLTKVAEEQLSGIKTVQSFVAEGK----EVHRYNNAVRQVFNVGKKEAFTNATFFS 382
                 + +   E L G+ T+++F  EG+     +H+ +   +  F +       N     
Sbjct: 1238 ---SPIYQHFSETLVGVTTIRAFGDEGRFMQENLHKIDENNKPFFYLW----VANRWLAF 1290

Query: 383  STNVLGDFSFLLVLAYGSHLVLQ-GNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGA 441
              +++G    L++   G  ++    NL  G     + Y          L   YSE+    
Sbjct: 1291 RIDMIGS---LVIFGAGLFILFNINNLDSGMAGISLTYAISFTEGALWLVRLYSEVEMNM 1347

Query: 442  GAATRLFELLDYKPTIKSTTGKAFK-------PLNGKVEFQHVSFSYPTRKTNQIFKDLN 494
             +  R+ E ++    I+       K       P +GK+E   +S  Y      ++ K+++
Sbjct: 1348 NSVERVKEYME----IEQEPYNEHKEIPPPQWPQDGKIEVNDLSLRYAP-NLPRVIKNVS 1402

Query: 495  FTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQ 554
            F+++  S + IVG +G GKSTI + L R+  P +G I +D  DI+ +  + LRR + ++ 
Sbjct: 1403 FSVDAQSKIGIVGRTGAGKSTIITALFRFLEPETGHIKIDNIDISGVDLQRLRRSITIIP 1462

Query: 555  QEPILMSGTIR--------------------------ENITYGVSRQPSMEEIRSVAKKC 588
            Q+P L SGTI+                          E +  G +R+ S E   + ++  
Sbjct: 1463 QDPTLFSGTIKTNLDPYDEFSDRQIFEALKRVNLISEEQLQQGATRETSNEASSTNSEN- 1521

Query: 589  FCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEG 648
                 ++KF +   + I   G+ LS GQ+Q + +AR+LL  PKI++LDEAT+++D  S+ 
Sbjct: 1522 -----VNKFLD-LSSEISEGGSNLSQGQRQLMCLARSLLRSPKIILLDEATASIDYSSDA 1575

Query: 649  AINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALH 708
             I  T+ +  +    TI++IAHRL ++   + ++V+   G V E      L  N  SA +
Sbjct: 1576 KIQETIRKEFQGS--TILTIAHRLRSVIDYDKILVMD-AGEVKEYDHPYSLLLNKQSAFY 1632

Query: 709  KL 710
             +
Sbjct: 1633 SM 1634

 Score = 87.4 bits (215), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 108/486 (22%), Positives = 210/486 (43%), Gaps = 44/486 (9%)

Query: 235 KKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGMMFHISS 294
           +K+++ D E      +G +++ +  DA+ VS  +   +    +A +   V + +++ +  
Sbjct: 460 QKSINGDEESTSSANLGAIINLMAIDAFKVSE-ICGYLHSFLEAFVMTVVALALLYRLLG 518

Query: 295 TLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEEQLSGIKTVQSFVAEGK 354
             A V  L    +L         I  + ++    + N  +   E    I+ ++ F  E +
Sbjct: 519 FAAIVGVLIIVAMLPLNYKLAKYIGDLQKKNLAVTDNRIQKLNEAFQAIRIIKYFSWE-E 577

Query: 355 EVHRYNNAVRQ-----------VFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAYGSHLV 403
              +  N +R+           V+++     F   T  ++             ++  ++ 
Sbjct: 578 NFEKDINTIRENELSLLLMRSIVWSISSFLWFVTPTIVTAA------------SFAYYIY 625

Query: 404 LQGNL--TIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIKSTT 461
           +QG +  T    TA  L+T      +  LS   S +++   +  R+ + L+   T K   
Sbjct: 626 VQGEVLTTPVAFTALSLFT-LLRDPLDRLSDMLSFVVQSKVSLDRVQDFLNENDT-KKYD 683

Query: 462 GKAFKPLNGKVEFQHVSFSYPTRKTNQIFK--DLNFTIEPGSNVCIVGPSGRGKSTIASL 519
                P   +  F++ + S+   K NQ FK  DLN   + G    ++GP+G GK+++   
Sbjct: 684 QLTIDPNGNRFAFENSTISWD--KDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMA 741

Query: 520 LLRYYNPTSGKILVDGQDITK---LSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQP 576
           LL      +GK++V   +  +   + +      +    Q   L++ T++ NI +     P
Sbjct: 742 LLGEMYLLNGKVVVPALEPRQELIVDANGTTNSIAYCSQAAWLLNDTVKNNILFN---SP 798

Query: 577 SME-EIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILIL 635
             E   ++V + C           G  T IG +G  LSGGQKQR+++ARAL +  + ++L
Sbjct: 799 FNEARYKAVVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLL 858

Query: 636 DEATSALDVESEGAI--NYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEM 693
           D+  SA+D  +   I  N   G LM+ +  T I ++H ++   R+  ++VL  DG V + 
Sbjct: 859 DDCLSAVDSHTASWIYDNCITGPLMEDR--TCILVSHNIALTLRNAELVVLLEDGRVKDQ 916

Query: 694 GKFKDL 699
           G   D+
Sbjct: 917 GDPIDM 922

>Skud_4.395 Chr4 complement(694806..699356) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  139 bits (350), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 138/492 (28%), Positives = 229/492 (46%), Gaps = 47/492 (9%)

Query: 242  MEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGMMFHISSTLASVL- 300
            M F++   +G +L+R   D Y V   + +  S  F         + ++F I+   A+   
Sbjct: 1039 MAFFETTPIGRILNRFSNDIYKVDALLGRTFSQFFVN------AVKVIFTITVICATTWQ 1092

Query: 301  FLFAP-PLLVGATIYGNKIRAISRELQQASGNLTKVA-----EEQLSGIKTVQSFVAEGK 354
            F+F   PL V    Y       SREL++   ++T+       +E L G+ TV+ +  + +
Sbjct: 1093 FIFIIIPLGVCYIYYQQYYLRTSRELRRLD-SITRSPIYSHFQETLGGLATVRGYSQQKR 1151

Query: 355  EVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAYGSHLVL---------- 404
              H   N  R   N+        + F+ S N     ++ L L  GS ++L          
Sbjct: 1152 FSHI--NQCRIDNNM--------SAFYPSINANRWLAYRLELI-GSIIILGAATLSVFRL 1200

Query: 405  -QGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKP----TIKS 459
             QG LT G     + Y       +  +     E+     +  R+ E  D K     TI+ 
Sbjct: 1201 KQGTLTAGMAGISLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYADLKSEAPLTIEG 1260

Query: 460  TTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASL 519
                   P  G ++F + S  Y   + + + K +N  I+P   + IVG +G GKS++   
Sbjct: 1261 HMPPKEWPSQGDIKFNNYSTRYRP-ELDLVLKHINIHIKPNEKIGIVGRTGAGKSSLTLA 1319

Query: 520  LLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSME 579
            L R    ++G I++DG  I ++    LR +L ++ Q+  +  G++RENI    + Q + E
Sbjct: 1320 LFRMIEASAGNIVIDGIAINEIGLYDLRHRLSIIPQDSQVFEGSLRENI--DPTNQYTDE 1377

Query: 580  EI-RSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEA 638
             I R++         +S   +G +  +   G  LS GQ+Q + +ARA+L   KILILDEA
Sbjct: 1378 AIWRALELSHLKEHVLSMSNDGLDAQLTEGGGNLSVGQRQLLCLARAMLVPSKILILDEA 1437

Query: 639  TSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKD 698
            T+A+DVE++  +  T+    K +  TI++IAHRL+TI  S+ +IVL  +G+V E      
Sbjct: 1438 TAAVDVETDKVVQETIRTAFKDR--TILTIAHRLNTIMDSDRIIVLD-NGTVAEFDSPSQ 1494

Query: 699  LYANHDSALHKL 710
            L +N +S  H L
Sbjct: 1495 LLSNSESLFHSL 1506

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 106/452 (23%), Positives = 194/452 (42%), Gaps = 60/452 (13%)

Query: 290 FHISSTLASVLFLFAPPLLVGATIY------GNKIRAISRELQQASGNL----TKVAEEQ 339
           F I   L S+  L    + VG  I        + +  I ++LQ++        T+V  E 
Sbjct: 432 FQIIICLYSLYKLLGNSMWVGVIILVIMMPLNSFLMRIQKKLQKSQMKYKDERTRVISEI 491

Query: 340 LSGIKTVQSFVAEGK-----EVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLL 394
           L+ IK+++ +  E       E  R N  ++ +  +G   A T+  F     ++   +F  
Sbjct: 492 LNNIKSLKLYAWEKPYREKLEDIRNNKELKNLTRLGCYMAVTSFQFNIVPFLVSCCTFA- 550

Query: 395 VLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYK 454
           V  Y     L  +L    LT F L +         L++F    ++ + +  RLF     +
Sbjct: 551 VFVYTEDRALTTDLVFPALTLFNLLSFPLMIIPMVLNSF----IEASVSIGRLFTFFTNE 606

Query: 455 PTIKSTTGKAFKPLN-GKVEFQ---HVSFSYPTRKTNQI-FKDLNFTIEPGSNVCIVGPS 509
                +  +  K  N G V        +F +  +   ++  K++NF  + G   C+VG  
Sbjct: 607 ELQPDSVQRLPKVENFGDVAINVGDDATFLWQRKPEYKVALKNINFQAKKGELTCVVGKV 666

Query: 510 GRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENIT 569
           G GK+ + S +L       G   V G              +  V Q P +M+GT+ ENI 
Sbjct: 667 GSGKTALLSCMLGDLFRVKGFATVHGS-------------VAYVSQVPWIMNGTVMENIL 713

Query: 570 YGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNK 629
           +G   +  +E      K C     ++   +G +T++G +G  LSGGQK R+++ARA+ ++
Sbjct: 714 FG--HKYDVEFYEKTIKACALTIDLAILMDGDKTLVGEKGISLSGGQKARLSLARAVYSR 771

Query: 630 PKILILDEATSALDVE-SEGAINYTLG---------RLMKSKELTIISIAHRLSTIRRSE 679
               +LD+  +A+D   +   I + LG         RL+ + +++ +SIA  ++ +    
Sbjct: 772 ADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTKTRLLATNKVSALSIADSVALLD--- 828

Query: 680 NVIVLGIDGSVVEMGKFKDLYANHDSALHKLL 711
                  +G +++ G + ++  + DS L KLL
Sbjct: 829 -------NGEIIQKGTYDEITKDADSPLWKLL 853

>SAKL0H26026g Chr8 (2287664..2292625) [4962 bp, 1653 aa] {ON} similar
            to uniprot|P32386 Saccharomyces cerevisiae YLL048C
          Length = 1653

 Score =  139 bits (350), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 134/507 (26%), Positives = 235/507 (46%), Gaps = 45/507 (8%)

Query: 233  VIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALI-CGGVGIGMMFH 291
            V+KK ++  + F+D   +G +++R   D   V + +T  +   F +L+ C    I + + 
Sbjct: 1138 VLKKVLYAKLRFFDSTPIGRIMNRFSKDIEAVDQELTPFVEGAFVSLVQCLSTVILIAYI 1197

Query: 292  ISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEEQLSGIKTVQSFVA 351
                L   +F+     LVG   Y    R + R    +   + +   E L GI T+++F  
Sbjct: 1198 TPGFLVVAIFIGFLYYLVG-YFYMAGSRELKRFESVSRSPIHQHFSETLVGITTIRAF-- 1254

Query: 352  EGKEVHRYNNAVRQVFNVGKKEAF----TNATFFSSTNVLGDFSFLLVLAYGSHLVLQ-- 405
             G E  R+     Q  +   K  F     N       +++G     +V A G  ++L   
Sbjct: 1255 -GDE-RRFMLENLQKIDENNKPFFYLWVANRWLAFRIDMIGA---CVVFAAGVFILLNIK 1309

Query: 406  ---GNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRL--FELLDYKPTIKST 460
                 L    LT  + +TE        L   YS +     +  RL  + +++ +P+    
Sbjct: 1310 KLDSGLAGISLTYAISFTE----GALWLVRLYSNVEMTMNSVERLKEYMVIEQEPSNDGA 1365

Query: 461  TGKAFK-PLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASL 519
                 + P  GK+E   +S  Y T    ++ K+++FT++P   V IVG +G GKSTI + 
Sbjct: 1366 FNPPIEWPDQGKIEVNDLSLRYAT-NLPRVIKNVSFTVDPKCKVGIVGRTGAGKSTIITA 1424

Query: 520  LLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENI----------T 569
            L R+ +P +G I +D  DIT +  K LR+ + ++ Q+P L SGT++ N+           
Sbjct: 1425 LFRFLDPETGHIKIDNVDITSIGLKRLRQSITIIPQDPTLFSGTVKSNLDPYDEYTDEQI 1484

Query: 570  YGVSRQPSM---EEIRSVAKKCFCHAFISKFPNGYETI---IGPRGALLSGGQKQRIAIA 623
            +   ++ ++   +E+  V       +  S+  N +  +   I   GA LS GQ+Q + +A
Sbjct: 1485 FKALKRVNLVTADELDHVPDSADNASVNSENVNKFLDLRNEITEGGANLSQGQRQLVCLA 1544

Query: 624  RALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIV 683
            R+LL  PKI++LDEAT+++D  S+  I  T+    +  + TI++IAHRL +I   + ++V
Sbjct: 1545 RSLLRSPKIILLDEATASIDYSSDAKIQQTIRE--EFGDSTILTIAHRLRSIIDYDKILV 1602

Query: 684  LGIDGSVVEMGKFKDLYANHDSALHKL 710
            +   G V E      L  N  S  + +
Sbjct: 1603 MD-AGEVREYDHPYSLLLNKSSIFYSM 1628

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 83/313 (26%), Positives = 156/313 (49%), Gaps = 19/313 (6%)

Query: 396 LAYGSHLVLQGNL--TIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDY 453
           +++  ++ +QG +  T    TA  L+T    + +  LS   S +++   +  R+ E LD 
Sbjct: 618 VSFAFYIYVQGEVLTTPIAFTALSLFT-LLRNPLDQLSDMLSFVIQSKVSLDRVQEFLDE 676

Query: 454 KPTIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGK 513
           + T K       +    K+ F++ +F++  +  +   K+LN   + G    ++G +G GK
Sbjct: 677 EETEKYNQLTISR---NKIAFENATFAWDKKNPSFKLKNLNVEFKLGKLNVVIGSTGSGK 733

Query: 514 STIASLLLRYYNPTSGKILV---DGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITY 570
           +++   LL   +   GK+ V   D ++   + S  +   +    Q   L++ T+R NI +
Sbjct: 734 TSLLMGLLGEMDLIEGKVYVPSLDPREELVIESDGMTNSIAYCSQAAWLLNDTVRNNILF 793

Query: 571 GVSRQPSME-EIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNK 629
                P  E   ++V + C           G +T IG +G  LSGGQKQR+++ARAL + 
Sbjct: 794 N---SPYNETRYKAVVEACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARALYSS 850

Query: 630 PKILILDEATSALDVESEGAI--NYTLGRLMKSKELTIISIAHRLS-TIRRSENVIVLGI 686
            + ++LD+  SA+D  +   I  N   G LM+ +  T I ++H ++ T++ +E V+VL  
Sbjct: 851 SRHVLLDDCLSAVDSHTALWIYENCITGPLMQGR--TCILVSHNVALTLKNAEWVVVLD- 907

Query: 687 DGSVVEMGKFKDL 699
           +G + + G+  DL
Sbjct: 908 NGRIKDQGEPLDL 920

>KNAG0I00990 Chr9 (188695..193302) [4608 bp, 1535 aa] {ON} Anc_8.303
            YDR135C
          Length = 1535

 Score =  139 bits (349), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 139/521 (26%), Positives = 235/521 (45%), Gaps = 56/521 (10%)

Query: 216  VLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAY----IVSRSMTQN 271
            V   I G + +  + +N + +     M F++   +G +L+R   D Y    ++ R+ +Q 
Sbjct: 1020 VFCTIHGSKYLHTVMTNAVFRA---PMSFFETTPIGRILNRFSNDIYKVDSLLGRTFSQF 1076

Query: 272  ISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGN 331
            + +  K +         M  I  T    +F+  P L V    Y       SREL++   +
Sbjct: 1077 LVNAVKVVFT-------MIVICWTTWQFIFIIGP-LGVLYIYYQQYYLRTSRELRRLD-S 1127

Query: 332  LTKVA-----EEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTN-ATFFSSTN 385
            +T+       +E L G+ T++ +           N  R+  ++       N + F+ S N
Sbjct: 1128 ITRSPIYSHFQETLGGMSTIRGY-----------NQQRRFDHINHCRIDNNMSAFYPSIN 1176

Query: 386  VLGDFSFLLVLAYGSHLVL-----------QGNLTIGDLTAFMLYTEYTGSAVFGLSTFY 434
                 +F L  + GS ++L           QG LT G +   + Y       +  +    
Sbjct: 1177 ANRWLAFRLE-SIGSVIILGAATLSIYRLGQGTLTAGMVGLSLSYALQITQTLNWIVRMT 1235

Query: 435  SELMKGAGAATRLFELLDYKP----TIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIF 490
             E+     +  R+ E  + K      I+     A  P +G + F H S  Y   + + + 
Sbjct: 1236 VEVETNIVSVERIKEYSELKSEAPLVIEEKRPAAHWPDSGDIRFDHYSTRYRP-ELDLVL 1294

Query: 491  KDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQL 550
            +D+N  I+P   + IVG +G GKS++   L R    +SG I++DG  I ++    LR  L
Sbjct: 1295 RDVNLHIKPREKIGIVGRTGAGKSSLTLALFRIVEASSGGIVIDGVRIDEIGLHDLRHNL 1354

Query: 551  GVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKF-PNGYETIIGPRG 609
             ++ Q+  +  GTIREN+    +   + +EI  V +    +  +    P G    +   G
Sbjct: 1355 SIIPQDSQVFQGTIRENV--DPTETYTDDEIWRVLELSHLNRHVESMGPRGLLNEVNEGG 1412

Query: 610  ALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIA 669
            + LS GQ+Q + +ARALL   KILILDEAT+A+DVE++  I  T+    + +  TI++IA
Sbjct: 1413 SNLSVGQRQLMCLARALLVPSKILILDEATAAVDVETDQVIQETIRSAFRDR--TILTIA 1470

Query: 670  HRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
            HR++TI  S+ ++VL   G V E     +L  N  S  H L
Sbjct: 1471 HRINTIMDSDRIVVLD-GGRVTEFDTPTNLLRNEGSQFHSL 1510

 Score =  102 bits (255), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 112/454 (24%), Positives = 200/454 (44%), Gaps = 64/454 (14%)

Query: 290 FHISSTLASVLFLFAPPLLVGATIY------GNKIRAISRELQQASGNL----TKVAEEQ 339
           F +   L S+  L  P + +G  I          +  I + LQ++        T V  E 
Sbjct: 430 FQVVICLVSLYKLLGPSMWIGVVILLVMTPLNTFLAKIQKRLQKSQMGFKDERTSVISEI 489

Query: 340 LSGIKTVQSFVAE---GKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNV--LGDFSFLL 394
           L+ IK+++ +  E    K++    N  +++ N+ K   F   T F    V  L       
Sbjct: 490 LNNIKSLKLYAWEEPYKKKLEHVRND-KELKNLTKLGCFMAITSFQFNVVPFLVSCCTFA 548

Query: 395 VLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYK 454
           V  Y     L  +L    LT F L +      +F +    +  ++ + + TRLF  L  +
Sbjct: 549 VFVYTEDRALTVDLVFPALTLFNLLS----FPLFVIPNVMTSFIEASVSVTRLFNFLTNE 604

Query: 455 PTIKSTTGKAFKPLN-GKVEFQ---HVSFSYPTRKTNQI-FKDLNFTIEPGSNVCIVGPS 509
              K +  +  K  N G V  +     +F +  +   ++  K++NF  + G   C+VG  
Sbjct: 605 ELQKDSVQRLPKVTNVGDVAVKVGDDATFLWRRKPEYKVALKNINFEAKKGQLTCVVGRV 664

Query: 510 GRGKSTIASLLLRYYNPTSGKIL-VDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENI 568
           G GKS +   L       SG +  V G         ++   +  V Q   +M+GT++ENI
Sbjct: 665 GSGKSALIQSL-------SGDLFRVKG-------FATVHGSVAYVSQVAWIMNGTVKENI 710

Query: 569 TYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLN 628
            +G    P   +     K C     ++   +G ET++G +G  LSGGQK R+++ARA+  
Sbjct: 711 LFGHRYDPEFYD--KTIKACALTIDLAVLVDGDETLVGEKGISLSGGQKARLSLARAVYA 768

Query: 629 KPKILILDEATSALDVESEGA--INYTLG---------RLMKSKELTIISIAHRLSTIRR 677
           +    +LD+  +A+D E  G   + + LG         +++ + +++++SIA R++ +  
Sbjct: 769 RADTYLLDDPLAAVD-EHVGKHLLEHVLGPTGLLRTKTKILATNKISVLSIADRIALLE- 826

Query: 678 SENVIVLGIDGSVVEMGKFKDLYANHDSALHKLL 711
                    +G +VE G + ++ A+ DSAL KL+
Sbjct: 827 ---------NGEIVEQGSYDEVTADGDSALSKLI 851

>Suva_10.23 Chr10 complement(44719..49704) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  139 bits (349), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 135/533 (25%), Positives = 241/533 (45%), Gaps = 54/533 (10%)

Query: 213  GRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNI 272
            G+ +L  + G     ++ + ++ K +H  + F+D    G +++R   D   + + +T  I
Sbjct: 1121 GKTILNFVAGINASRKIFNMILNKVLHSKLRFFDATPTGRIMNRFSKDIEAIDQELTPYI 1180

Query: 273  SDGFKALI-CGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGN 331
               F +LI C    I + F I+    SV  + +         Y    R + R    +   
Sbjct: 1181 QGAFYSLIECLSTVILITF-ITPQFLSVAIVVSIMYYFIGYFYMAGSRELKRYESISRSP 1239

Query: 332  LTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAF----TNATFFSSTNVL 387
            + +   E L G+ T+++F  EG    R+     Q  +   K  F     N       +++
Sbjct: 1240 IYQHFSETLVGVTTIRAFGDEG----RFMQENLQKIDENNKPFFYLWVANRWLAFRIDMI 1295

Query: 388  GDFSFLLVLAYGSHLVLQGNLTIGD-------LTAFMLYTEYTGSAVFGLSTFYSELMKG 440
            G      ++ +G+ L +  N+   D       LT  + +TE        L   YSE+   
Sbjct: 1296 GS-----LVIFGAGLFILSNIDHLDSGMAGISLTYAISFTE----GALWLVRLYSEVEMN 1346

Query: 441  AGAATRLFELLDYKPTIKSTTGKA---FKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTI 497
              +  R+ E ++ +    +   +      P +GK+E   +S  Y      ++ K+++F++
Sbjct: 1347 MNSVERVKEYMEIEQEPYNQHKEVPPPQWPQDGKIEVNDLSLRYAP-NLPRVIKNVSFSV 1405

Query: 498  EPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEP 557
            +  S V IVG +G GKSTI + L R+  P +G I +D  DI+ +  + LRR + ++ Q+P
Sbjct: 1406 DAQSKVGIVGRTGAGKSTIITALFRFLEPDTGHIKIDNIDISNVDLQRLRRSITIIPQDP 1465

Query: 558  ILMSGTIRENIT-YG-VSRQPSMEE----------------IRSVAKKCFC--HAFISKF 597
             L SGTI+ N+  Y   S Q   E                 +R VA          ++KF
Sbjct: 1466 TLFSGTIKTNLDPYNEFSNQKIFEALKRVNLVSEEQLQQGTVREVATDTSSADSENVNKF 1525

Query: 598  PNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRL 657
             +  E+ +   G+ LS GQ+Q + +AR+LL  PKI++LDEAT+++D  S+  I  T+ + 
Sbjct: 1526 LD-LESEVSEGGSNLSQGQRQLMCLARSLLRSPKIILLDEATASIDYSSDAKIQETIRKE 1584

Query: 658  MKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
             +    TI++IAHRL ++   + ++V+   G V E      L  N  S  + +
Sbjct: 1585 FQGS--TILTIAHRLRSVIDYDKILVMD-AGEVKEYDHPYSLLLNKQSIFYSM 1634

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 71/239 (29%), Positives = 121/239 (50%), Gaps = 14/239 (5%)

Query: 469 NGK-VEFQHVSFSYPTRKTNQIFK--DLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYN 525
           NGK   F++ + S+   K NQ FK  DLN   + G    ++GP+G GK+++   LL    
Sbjct: 690 NGKRFAFENSTISWD--KDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMY 747

Query: 526 PTSGKILVDGQDITK---LSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIR 582
             +GK++V   D  +   + +      +    Q   L++ T++ NI +  + Q +    +
Sbjct: 748 LLNGKVVVPALDPRQELVVEANGTTNSIAYCSQAAWLLNDTVKNNILF--NSQFNETRYK 805

Query: 583 SVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSAL 642
           +V + C           G  T IG +G  LSGGQKQR+++ARAL +  + ++LD+  SA+
Sbjct: 806 AVVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSAV 865

Query: 643 DVESEGAI--NYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDL 699
           D  +   I  N   G LM+ +  T I ++H ++   R+  ++VL  DG V + G   D+
Sbjct: 866 DSHTASWIYDNCITGPLMEDR--TCILVSHNIALTLRNAELVVLLEDGRVKDQGDPIDM 922

>Kwal_56.22747 s56 (262824..267440) [4617 bp, 1538 aa] {ON} YLL015W
            (BPT1) - ABC-type transmembrane transporter; highly
            homologous to human MRP1 and to C. elegans mrp-1 [contig
            184] FULL
          Length = 1538

 Score =  138 bits (348), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 136/534 (25%), Positives = 231/534 (43%), Gaps = 55/534 (10%)

Query: 209  MANFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADA------- 261
            ++N   +VLL +   +   +L   +    +   M F++   VG +++R  +D        
Sbjct: 1021 LSNARTIVLLLVCSIKASRKLHDTMALAVIRSPMSFFETTPVGRIINRFSSDMNSLDDSV 1080

Query: 262  -YIVSRSMTQNISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRA 320
             Y++S  +  +I D    +I  G  + +   +++ L  + F +          Y    R 
Sbjct: 1081 QYVMSFFLV-SILDYLVVVIIIGYQVPLFLIVNAVLLVIYFYYQ-------VYYVTLSRE 1132

Query: 321  ISRELQQASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATF 380
            + R +  +   +  +  E L+G   + +F     +   Y N     FN+       N  F
Sbjct: 1133 LKRLMSTSFSPIMSMLSETLAGHMIIDAF--RHSDRFDYLNVENVQFNI-------NCLF 1183

Query: 381  -FSSTNV-----LGDFSFLLVLAYGSHLVLQGN----LTIGDLTAFMLYTEYTGSAVFGL 430
             F STN      L     L++L      +   N    L+ G +   M Y     + +  +
Sbjct: 1184 NFRSTNRWLSIRLESIGALMILTTALLSLATKNGGHALSTGMVGLLMSYALQVTNKLMWI 1243

Query: 431  STFYSELMKGAGAATRLFELLDYKP----TIKSTTGKAFKPLNGKVEFQHVSFSYPTRKT 486
                 +L     +  R+ E  D  P     I+ +      P  G + F++ S  Y     
Sbjct: 1244 VRMSVQLETNIVSVERIVEYCDLPPEAPPVIEDSRPPKNWPSQGLIRFKNYSTRYRA-NL 1302

Query: 487  NQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSL 546
            + + + L+  I+P   + IVG +G GKST++  L R   P+ G I +DG DI+K+  K L
Sbjct: 1303 DPVLRHLDLEIKPQEKIGIVGRTGAGKSTLSLALFRILEPSEGTIDIDGVDISKIGLKDL 1362

Query: 547  RRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNG------ 600
            R  L ++ Q+     GT+R N+      Q S EEI    +       I K          
Sbjct: 1363 RSNLSIIPQDAQAFEGTVRTNL--DPFEQYSDEEIWKALELSHLKPHILKMAKDDADPEK 1420

Query: 601  ----YETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGR 656
                 +T I   G+ LS GQ+Q + ++RALLN+ +IL+LDEAT+A+D E++  I  T+  
Sbjct: 1421 KEDLLQTKISENGSNLSVGQRQLLCLSRALLNRSRILVLDEATAAVDSETDRLIQETIRA 1480

Query: 657  LMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
              K +  TI++IAHR+ T+  S+ ++VL   G V E     +L A  DS  + L
Sbjct: 1481 EFKDR--TILTIAHRIDTVMDSDKIMVLD-KGEVKEFDSPSNLLAQKDSIFYNL 1531

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 115/511 (22%), Positives = 226/511 (44%), Gaps = 53/511 (10%)

Query: 229 LRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSR--SMTQNISDGFKALICGGVGI 286
           L + + +K+++  +E  +    GD+++ +  D   + R    +Q +     ALI   + +
Sbjct: 364 LMTMLYRKSLNLSLEAKESKTAGDIMNLMSVDVLRIQRFFETSQELIGSPIALITTLISL 423

Query: 287 GMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEEQLSGIKTV 346
              F  +ST   +L +    +    +    K++ + ++         K   E L+ +KTV
Sbjct: 424 -YTFLGNSTAGGILVMAV--MFPINSYLSRKVKTLIQQQMTYKDARIKTITELLNSVKTV 480

Query: 347 QSFVAEGKEVHRYNNAVR---QVFNVGKKEAFTNATFFS--STNVLGDFSFLLVLAYGSH 401
           + +  E   + R ++ VR   ++ N  K    TN   F+     +L   S  L+ A    
Sbjct: 481 KLYAWEEPMLKRLDH-VRNDLELQNFKKISIITNLILFAWNCVPILVASSTFLIYALTMD 539

Query: 402 LVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIKSTT 461
           + L   +    L+ F    +     ++ +    +  ++   +  RL + L  K   KS  
Sbjct: 540 VPLTPQIVFPSLSLF----DILNDCIYTIPRTITNFIETGVSLGRLKDFLLAKEIDKSFI 595

Query: 462 GKAFKPLNGKV---EFQHVSF------------SYPTR---KTNQI-FKDLN-FTIEPGS 501
                P +GKV   E  + +F            SY      +++Q+  K+++ F +  G 
Sbjct: 596 EFESLPSDGKVPVIEVHNATFLRKIPNDSTDDESYDEEAAVESSQVALKNIDGFQVFKGQ 655

Query: 502 NVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRR--QLGVVQQEPIL 559
            VC+VG  G GKST    LL       G++       +  S     R   + +  Q+  +
Sbjct: 656 LVCVVGRVGAGKSTFLQALL-------GQLPCISNSPSHASPTVHFRANSVALCSQQSWI 708

Query: 560 MSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQR 619
           M+ ++++N+ +G   +      ++  + C     +    +G ET++G +G  LSGGQK R
Sbjct: 709 MNASVKDNVLFG--HRFDEATYKATLEACQLVPDLEILADGDETLVGEKGISLSGGQKAR 766

Query: 620 IAIARALLNKPKILILDEATSALDVE-SEGAINYTLGR---LMKSKELTIISIAHRLSTI 675
           +++ARA+ ++  + +LD+  SA+D E  +  I   L +   L+K+K  T+I   + +S +
Sbjct: 767 LSLARAVYSRSDVYLLDDILSAVDAEVCKRIIEQVLSKKTGLLKNK--TVILTTNSISVL 824

Query: 676 RRSENVIVLGIDGSVVEMGKFKDLYANHDSA 706
           + S+++  L  DG +VE G F D+    DS+
Sbjct: 825 KHSQSIYALE-DGEIVESGSFNDIMRRDDSS 854

>KAFR0B05630 Chr2 complement(1156621..1161168) [4548 bp, 1515 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1515

 Score =  138 bits (347), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 143/520 (27%), Positives = 238/520 (45%), Gaps = 54/520 (10%)

Query: 216  VLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAY----IVSRSMTQN 271
            V   I G R +  L ++ + K     M F++   +G +L+R   D Y    I+ R+ +Q 
Sbjct: 1014 VFCTIRGSRYLHDLMTDAVLKA---PMSFFETTPIGRILNRFSNDIYKIDSILGRTFSQF 1070

Query: 272  ISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGN 331
              +  K +    V       I +T    +F+  P L V    Y       SREL++   +
Sbjct: 1071 FVNAVKVVFVMAV-------ICATTWQFIFVIIP-LGVFYIYYQQYYLRTSRELRRLD-S 1121

Query: 332  LTKVA-----EEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNV 386
            +T+       +E L GI T++ +  E +  H   N  R   N+        + F+ S N 
Sbjct: 1122 ITRSPVYSHFQETLGGITTIRGYNQEKRFGHI--NQCRVDNNM--------SAFYPSINA 1171

Query: 387  LGDFSFLLVLAYGSHLVL-----------QGNLTIGDLTAFMLYTEYTGSAVFGLSTFYS 435
                +F L L  GS ++L           +G LT G +   + Y       +  +     
Sbjct: 1172 NRWLAFRLELI-GSIIILGAATLSIFRLKEGTLTPGMVGLSLSYALQITQTLNWIVRMTV 1230

Query: 436  ELMKGAGAATRLFELLDYKP----TIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFK 491
            E+     +  R+ E    +      ++        P  G ++F++ S  Y   + + + K
Sbjct: 1231 EVETNIVSVERVKEYAQLESEAPRIVEEKRPDEMWPTEGDIKFENYSTRYRP-ELDLVLK 1289

Query: 492  DLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLG 551
            ++N  I P   V IVG +G GKS++   L R    T+G I++DG  I ++    LR +L 
Sbjct: 1290 NINVHIRPTEKVGIVGRTGAGKSSLTLALFRIIEATAGNIIIDGIPINEIGLYDLRHKLS 1349

Query: 552  VVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFI-SKFPNGYETIIGPRGA 610
            ++ Q+  +  GT+RENI    +   + EEI  V +       + S   +G +  +   G+
Sbjct: 1350 IIPQDSQVFEGTLRENI--DPTNLFTDEEIWRVLELSHLKEHVLSMGADGLDVQLTEGGS 1407

Query: 611  LLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAH 670
             LS GQ+Q + +ARALL   KIL+LDEAT+A+DVE++  +  T+    K +  TI++IAH
Sbjct: 1408 NLSVGQRQLMCLARALLIPSKILVLDEATAAVDVETDKIVQETIRTAFKDR--TILTIAH 1465

Query: 671  RLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
            RL+TI  S+ +IVL   G +VE     +L A  +S  + L
Sbjct: 1466 RLNTIMDSDRIIVLD-KGEIVEFDTPDELLAKPESLFYSL 1504

 Score = 94.7 bits (234), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 120/509 (23%), Positives = 227/509 (44%), Gaps = 49/509 (9%)

Query: 222 GERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMT-QNI--SDGFKA 278
           G  + + L S + +K++    E   ++  GD+++ +  D   +   M   NI  S  F+ 
Sbjct: 371 GMNIKSALTSLIYQKSLVLSNEASAQSSTGDIVNLMSVDVQKLQDLMQFLNILWSGPFQI 430

Query: 279 LICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQ----QASGNLTK 334
            IC       +F +   L   +++    +LV      + +  I R+LQ    Q     T 
Sbjct: 431 FIC-------LFSLYKLLGHSMWV-GFIILVFMIFLNSYLVRIQRKLQKQQMQFKDERTG 482

Query: 335 VAEEQLSGIKTVQSFVAEGKEVHRYNNAV--RQVFNVGKKEAFTNATFFSSTNV--LGDF 390
           V  E L+ IK+++ +  E     + N+    +++ N+ K   +   T F    V  L   
Sbjct: 483 VISEILNNIKSLKLYAWEVPYQTKLNHVRNDKELHNLTKLGCYMAVTSFQFNIVPFLVSC 542

Query: 391 SFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFEL 450
           +   V  Y  +  L  +L    LT F L +      +  +    +  ++ + +  RLF  
Sbjct: 543 ATFAVFVYTENKPLTTDLVFPALTLFNLLS----FPLMVVPNVITSFVEASVSVNRLFSF 598

Query: 451 LDYKPTIKSTTGKAFKPLN-GKVEFQ---HVSFSYPTRKTNQI-FKDLNFTIEPGSNVCI 505
           L  +   K +  +  K  N G V      + +F +  +   ++  K++NF  + G   CI
Sbjct: 599 LTNEELQKDSIQRLPKVENKGDVAINLGDNATFLWKRKPEYKVALKNINFQAKKGDLTCI 658

Query: 506 VGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIR 565
           VG  G GKS +   +L       G   V G              +  V Q P +M+GT++
Sbjct: 659 VGKVGSGKSALIQSILGDLFRVKGFATVHGN-------------VAYVSQVPWIMNGTVK 705

Query: 566 ENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARA 625
           ENI +G   +   E      K C     +    +G +T++G +G  LSGGQK R+++ARA
Sbjct: 706 ENILFG--HKYDQEFYEKTIKACALTIDLGILVDGDQTLVGEKGISLSGGQKARLSLARA 763

Query: 626 LLNKPKILILDEATSALDVE-SEGAINYTLGR--LMKSKELTIISIAHRLSTIRRSENVI 682
           + ++    +LD+  +A+D   S+  + + LG   L+ SK  T +   +++S +  ++++ 
Sbjct: 764 VYSRADTYLLDDPLAAVDEHVSKHLVEHVLGPTGLLHSK--TKVLCTNKISVLSIADSIT 821

Query: 683 VLGIDGSVVEMGKFKDLYANHDSALHKLL 711
           +L  +G +V+ G ++++ ++ DS L KL+
Sbjct: 822 LLE-NGEIVQQGSYEEVNSDEDSPLFKLI 849

>KLTH0C09240g Chr3 complement(766620..771260) [4641 bp, 1546 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1546

 Score =  138 bits (347), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 135/529 (25%), Positives = 230/529 (43%), Gaps = 54/529 (10%)

Query: 215  VVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADA--------YIVSR 266
            +VLL +   R   +L  ++    +   M F++   VG +++R  +D         Y++S 
Sbjct: 1036 IVLLLVCSIRASRKLHDSMAVAVLRSPMSFFETTPVGRIINRFSSDMNSVDDNVQYVISF 1095

Query: 267  SMTQNISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQ 326
             +  +I D    ++  G  + +   +++ L  +   +          Y    R + R + 
Sbjct: 1096 FLI-SILDYVVVVVIIGYQVPLFLLVNAALLGIYLYYQ-------VFYVTLSRELKRLMS 1147

Query: 327  QASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATF-FSSTN 385
             +   +  +  E L+G   + +F        R++       N+   +   N  F F STN
Sbjct: 1148 TSFSPIMSMLSETLAGHMVINAF----NHFSRFD-----YLNIEAVQFNINCVFNFRSTN 1198

Query: 386  V-----LGDFSFLLVL--AYGSHLVLQGN--LTIGDLTAFMLYTEYTGSAVFGLSTFYSE 436
                  L     L++L  A  S     G+  L+ G +   M Y     + +  +     +
Sbjct: 1199 RWLSIRLESIGALMILTTALLSLATTTGDKALSTGMVGLLMSYALQVTNKLMWIVRMSVQ 1258

Query: 437  LMKGAGAATRLFELLDYKP----TIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKD 492
            L     +  R+ E  D  P     I+    +   P  G V F+  S  Y     + + K 
Sbjct: 1259 LETNVVSVERIVEYCDLPPEAPPVIEDCRPEKNWPAQGHVVFKDYSARY-RENLDPVLKK 1317

Query: 493  LNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGV 552
            LN  I P   + IVG +G GKST++  L R   P  G I++DG DITK+    LR  L +
Sbjct: 1318 LNVEINPQEKIGIVGRTGAGKSTLSLALFRILEPCGGTIVIDGVDITKIGLADLRSHLSI 1377

Query: 553  VQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNG---------YET 603
            + Q+     G++R N+      Q S +EI    +       I K  N           ET
Sbjct: 1378 IPQDAQAFEGSVRSNL--DPFEQYSDDEIWRALELSHLKPHILKMANEEGPEKTKNLLET 1435

Query: 604  IIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKEL 663
             I   G+ LS GQ+Q + ++RALLN+ +IL+LDEAT+A+D E++  I  T+    K +  
Sbjct: 1436 KISENGSNLSVGQRQLLCLSRALLNRSRILVLDEATAAVDSETDRLIQETIRAEFKDR-- 1493

Query: 664  TIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLLT 712
            TI++IAHR+ T+  S+ ++VL   G V E     +L A+ ++  + L +
Sbjct: 1494 TILTIAHRIDTVMDSDKIMVLD-QGEVKEFDSPSNLLADKNTIFYNLCS 1541

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 119/553 (21%), Positives = 231/553 (41%), Gaps = 51/553 (9%)

Query: 229 LRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSR--SMTQNISDGFKALICGGVGI 286
           L + + +K++    E  +    GD+++ +  D   + R    +Q +     AL+   V +
Sbjct: 373 LMTMLYQKSLKLSSEAREGKTAGDIMNMMAVDVLRIQRFFETSQELVGSPIALLTTLVSL 432

Query: 287 GMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEEQLSGIKTV 346
                 S+    V+     P+    +    KI+ + ++  +      K   E L+ +KTV
Sbjct: 433 YTFLGYSTAGGVVIMAVMFPI---NSYLSRKIKVLIKKQMEYKDARIKTVTEILNSVKTV 489

Query: 347 QSFVAEGKEVHRYNNAVR---QVFNVGKKEAFTNATFFSSTNV--LGDFSFLLVLAYGSH 401
           + +  E   + R ++ VR   ++ +  K     N T F+   V  L   S  L+ A    
Sbjct: 490 KLYAWEEPMLKRLDH-VRNELELESFKKIAVMNNLTLFAWNCVPILVASSTFLIYALVMD 548

Query: 402 LVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIKSTT 461
           + L   +    L+ F    +     ++ +       ++   +  RL + L  K   KS  
Sbjct: 549 VPLTPQIVFPSLSLF----DILNDCIYTIPRTIINFIETGVSMGRLKDFLLAKELDKSFI 604

Query: 462 GKAFKPLNGKV---EFQHVSF--SYPTRKTNQIFKDLNFTIEP---------------GS 501
                P +  V   E  + +F  + PT+ T++   D    IE                G 
Sbjct: 605 EFESLPDDPNVPVIEVHNATFLRNLPTKATSEENYDEEAMIESSRVALKNIDGFQALKGQ 664

Query: 502 NVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMS 561
            VC+VG  G GKST    LL      S       Q   K+  +     + +  Q+  +++
Sbjct: 665 LVCVVGRVGAGKSTFLHALLGQLPCISSS---HDQATPKMHFRC--DSVALCSQQAWILN 719

Query: 562 GTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIA 621
            +++ N+ +G   +      ++  + C     +    +G ET++G +G  LSGGQK RI+
Sbjct: 720 ASVKYNVLFG--HKYDEASYKATIEACQLLPDLGILADGDETLVGEKGISLSGGQKARIS 777

Query: 622 IARALLNKPKILILDEATSALDVE-SEGAINYTLGR---LMKSKELTIISIAHRLSTIRR 677
           +ARA+ ++  + +LD+  SA+D E  +  I++ L R   L+K+K  T+I   + +S ++ 
Sbjct: 778 LARAVYSRSDVYLLDDILSAVDAEVCKRIIDHVLSRKTGLLKNK--TVILTTNSISVLKH 835

Query: 678 SENVIVLGIDGSVVEMGKFKDLYANHDSALHKLLTXXXXXXXXXXXXYAPPAITQESEPQ 737
           S+++  L  +G +VE G F ++ +    +  K L               P  I ++  P 
Sbjct: 836 SQSIYALE-NGEIVERGSFDEIMSKDAESKLKTLIAEFGSDSSAVKDDEP--IPEQKPPV 892

Query: 738 TEENGKDDSGEDQ 750
             +  +DD+ E++
Sbjct: 893 DLQEVEDDALEEE 905

>Smik_8.6 Chr8 complement(11717..16474) [4758 bp, 1585 aa] {ON}
            YHL035C (REAL)
          Length = 1585

 Score =  138 bits (347), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 134/535 (25%), Positives = 249/535 (46%), Gaps = 78/535 (14%)

Query: 222  GERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALI- 280
            G +   ++ ++++   +H  + F+D   VG +++R   D   + + +   +      LI 
Sbjct: 1067 GMQASKKIFNSMLDLVLHAKIRFFDVTPVGRIMNRFSKDIEGIDQELIPYLEVTVFCLIQ 1126

Query: 281  CGGVGIGMM-----FHISSTLASVLFLFAPPLLVGATIYGNKIRAISRE--LQQASGNLT 333
            C  + + ++     F   + +  +L+ F     + A+    +I +I++    Q  S    
Sbjct: 1127 CSSILLLIVVITPRFFSVAVIVFILYYFVGKWYLKASRDLKRIDSITKSPIFQHFS---- 1182

Query: 334  KVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSF- 392
                E L G+ T+++F  E + +      + Q           N  FF  +  +  F+F 
Sbjct: 1183 ----ETLVGVCTIRAFGDEKRFILENMEKIDQ----------NNKAFFYLSVAVKWFAFR 1228

Query: 393  ------LLVLAYGSHLVLQ-GNLTIG----DLTAFMLYTEYTGSAVFGLSTFYSELMKGA 441
                   +VL  GS ++    N+  G     LT  +L+T+    +   L   YS      
Sbjct: 1229 VDMIGAFIVLGSGSFILFNIDNIDSGLAGISLTYAILFTD----SALWLVQLYSRFEMNM 1284

Query: 442  GAATRLFEL--------LDYKPTIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDL 493
             +  RL E         L Y          +  P +GK+E +++S  Y +     + K++
Sbjct: 1285 NSVERLKEYSSIVQEKYLGYDEDHIQALNDSSWPKHGKIEVENLSLRYAS-NLPLVLKNV 1343

Query: 494  NFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVV 553
             F ++P S V IVG +G GKSTI + L R   P +G I +D QDI+K+   +LRR + ++
Sbjct: 1344 CFKVDPQSKVGIVGRTGAGKSTIIAALFRLLEPVTGCIKIDDQDISKIDLITLRRSITII 1403

Query: 554  QQEPILMSGTIRENI----------TYGVSRQPSM------EEIRSVAKKCFCHAFISKF 597
             Q+P+L +GTI+ NI           + V  Q ++      +++ ++ +    H   +KF
Sbjct: 1404 PQDPVLFAGTIKSNIDPHDEYDERRIFKVLLQVNLISSLEFKQVFNLKENFNIH---NKF 1460

Query: 598  PNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRL 657
             N    I+   G  LS G++Q + IAR+LL + KI++LDEATS++D +S+  I      +
Sbjct: 1461 LNLQSEIV-EGGLNLSQGERQLLFIARSLLRESKIILLDEATSSIDYDSDHLIQ----SI 1515

Query: 658  MKSK--ELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
            ++SK  + TI++IAHRL ++   + ++V+   G + E G   +L  N  S  +++
Sbjct: 1516 IRSKFNKSTILTIAHRLRSVIYYDKILVMD-AGEIKEYGHPYELLKNERSTFYRM 1569

 Score = 88.6 bits (218), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 75/243 (30%), Positives = 114/243 (46%), Gaps = 16/243 (6%)

Query: 467 PLNGKVEFQHVSFSYPTRKTNQIFK----DLNFTIEPGSNVCIVGPSGRGKSTIASLLLR 522
           P   K+EF+  +  +     N I K    DLN     G    ++G +G GKS +   LL 
Sbjct: 659 PDRNKIEFKKANLVW-NENDNDINKFKLCDLNIIFSIGKLNLVLGSTGSGKSALLMSLLG 717

Query: 523 YYNPTSGKILVDG----QDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSM 578
             +  SG I++ G     D+       L        Q   L+S TI+ NI +  S   S 
Sbjct: 718 ELDLVSGFIIIPGLEPRHDLIP-DHDGLTNSFAYCSQSAWLVSDTIKNNIVFNGSYDKS- 775

Query: 579 EEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEA 638
              + V   C  +  ++  P G  T IG +G  LSGGQKQRI++ARA+ +  K ++LD+ 
Sbjct: 776 -RYKKVIDACGLNRDLNILPAGDLTEIGEKGITLSGGQKQRISLARAVYSHAKHVLLDDC 834

Query: 639 TSALDVESEGAI--NYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKF 696
            SA+D  +   I  N   G+LMK++  T I + H +    R+ +  ++  DG V   G  
Sbjct: 835 LSAVDSHTAVWIYENCITGQLMKNR--TCILVTHNVPLAIRNAHFAIILEDGKVKNQGTI 892

Query: 697 KDL 699
           K+L
Sbjct: 893 KEL 895

>TDEL0G01850 Chr7 (369839..374767) [4929 bp, 1642 aa] {ON} Anc_4.6
            YHL035C
          Length = 1642

 Score =  137 bits (346), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 124/489 (25%), Positives = 224/489 (45%), Gaps = 61/489 (12%)

Query: 233  VIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALI-CGGVGIGM--- 288
            ++ K MH  + F+D   +G +++R   D     + +T  I   F +L+ C    + +   
Sbjct: 1128 LLSKVMHAKLRFFDSTPIGRIMNRFSKDMEAADQELTPFIEGAFYSLVQCVSTVVLITFI 1187

Query: 289  --MFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEEQLSGIKTV 346
               F   + L +VL+ F     +  +    ++ +ISR        + +   E L G+ T+
Sbjct: 1188 TPQFLFVAILVAVLYYFVGYFYLTGSRELKRLESISR------SPIYQHFSETLVGVTTI 1241

Query: 347  QSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLL-----VLAYGSH 401
            ++F  E + +           N+ K +   N  FF         SF +     ++ +G+ 
Sbjct: 1242 RAFGDESRFMRE---------NLQKIDE-NNRPFFYLWVANRWLSFRIDMIGALVIFGAG 1291

Query: 402  LVLQGNLTIGD-------LTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYK 454
            + +  N+   D       LT  + +TE        L   YS +     +  RL E +D +
Sbjct: 1292 IFVLLNIDHIDSGKAGISLTYAITFTE----GALWLVRLYSNVEMNMNSVERLKEYMDVE 1347

Query: 455  --PTIKST-TGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGR 511
              P  +S  T     P  G++E   +S  Y      ++ K+++FT++P S V IVG +G 
Sbjct: 1348 QEPYDQSILTPPVEWPQQGRIEVNDLSLRYAP-NLPKVIKNVSFTVDPRSKVGIVGRTGA 1406

Query: 512  GKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENIT-- 569
            GKSTI + L R+ +P +G I +D  DIT +  + LRR + ++ Q+P L +GTI+ N+   
Sbjct: 1407 GKSTIITALFRFLDPETGNIKIDNVDITSIDLQRLRRSITIIPQDPTLFTGTIKSNLDPY 1466

Query: 570  --------------YGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGG 615
                            +  Q  ++   +          I+KF +   + I   G  +S G
Sbjct: 1467 DEYTDQQIFEALKRVNLVTQEELDRRPTSESSSVSSENINKFLD-LSSEISEGGGNISQG 1525

Query: 616  QKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTI 675
            Q+Q + +AR+LL  PKI++LDEAT+++D  S+  I  T+ +       TI++IAHRL ++
Sbjct: 1526 QRQLVCLARSLLRSPKIILLDEATASIDYASDAKIQETIRKEFGGN--TILTIAHRLRSV 1583

Query: 676  RRSENVIVL 684
               + ++V+
Sbjct: 1584 IDYDKILVM 1592

 Score = 93.6 bits (231), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 105/459 (22%), Positives = 208/459 (45%), Gaps = 28/459 (6%)

Query: 250 VGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGMMFHI---SSTLASVLFLFAPP 306
           +G +++ +  DA+ VS  +   +    +A++   V   +++H+   ++ + + L +   P
Sbjct: 477 LGAIINLMAVDAFKVSE-ICAYLHAFVEAVVMALVAFVLLYHLLGFAAIVGAALIVAMMP 535

Query: 307 L-LVGATIYGNKIRAISRELQQASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQ 365
           L    AT  G+    + +E    +    +   E    I+ ++ F  E    + +   +R 
Sbjct: 536 LNFKLATWLGH----LQKETLSVTDKRIQKLNEAFQAIRIIKFFSWE----NNFEKDIRD 587

Query: 366 VFNVGKKEAFTNATFFSSTNVLGDFSFLLV--LAYGSHLVLQGNL--TIGDLTAFMLYTE 421
           V     K     +  ++ ++ +   +  +V   A+  ++ +QG +  T    TA  L++ 
Sbjct: 588 VRETELKFLMKRSLVWAGSSFVWYITPTIVTSCAFWFYIYIQGEVLTTPIAFTALSLFS- 646

Query: 422 YTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIKSTTGKAFKPLNGKVEFQHVSFSY 481
              + +  LS   S +++   +  R+ E L+ K T K       K    K+ F++ + ++
Sbjct: 647 LLRTPLDQLSDMLSFVIQSKVSLDRVQEFLEEKDTEKYNQLSTAKD-KKKIGFENATITW 705

Query: 482 PTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITK- 540
              + +   K+LN   + G    I+GP+G GK+++   LL   +  SGKI+V   D  + 
Sbjct: 706 DAERPDFKLKNLNIDFKVGKLNVIIGPTGSGKTSLLMALLGEMHLVSGKIIVPSLDPRQE 765

Query: 541 --LSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFP 598
             + +  +   +    Q   L++ T++ NI +         E  +V + C      S   
Sbjct: 766 LPIEADGMTNSMAYCSQAAWLLNDTVKNNILFNSPYNEGRYE--AVVEACGLKRDFSILS 823

Query: 599 NGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAI--NYTLGR 656
            G  T IG RG  LSGGQKQRI++AR+L +  + ++LD+  SA+D  +   I  N   G 
Sbjct: 824 AGDLTEIGERGITLSGGQKQRISLARSLYSNARHVLLDDCLSAVDSHTASWIYDNCITGP 883

Query: 657 LMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGK 695
           LM+ +  T I ++H  +   R+  ++V   +G V   G+
Sbjct: 884 LMEGR--TCILVSHNTALTLRNAELVVTMENGQVKNQGE 920

>KAFR0C06510 Chr3 (1306097..1310470) [4374 bp, 1457 aa] {ON} Anc_5.10
            YGR281W
          Length = 1457

 Score =  137 bits (346), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 136/526 (25%), Positives = 238/526 (45%), Gaps = 74/526 (14%)

Query: 229  LRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGM 288
            L  N + + +H  M + D   +G +L+R   D   +   +T+++               M
Sbjct: 947  LNLNAVHRVLHAPMSYLDTTPLGRILNRFTKDTDSLDNELTESVR-------------LM 993

Query: 289  MFHISSTLASVLF------LFA---PPLLVGATIYGNKIRAISRELQQASG--------N 331
            +F + + +A ++        FA   P L     +  +  ++ SRE+++           N
Sbjct: 994  LFQVGNIVAVIVMCIVYLPWFAIAVPFLFFMFVLIADHYQSTSREIKRLDAIQRSFVYNN 1053

Query: 332  LTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGD-- 389
            L +V    L G+ T++S+    K   R+      + N   +  +   +     ++  D  
Sbjct: 1054 LNEV----LGGMDTIKSY----KGQKRFQAKSDYLINKMNEAGYLLVSVQRWVSIFLDMV 1105

Query: 390  ---FSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGA----G 442
               F+ ++ L   + +      ++G L  ++L      ++V    T     M  A     
Sbjct: 1106 AIIFALIIALLSVTGVFSLSASSVGVLLTYVLQLPGLLNSVLRALTQTENDMNSAERLVN 1165

Query: 443  AATRL-FELLDYKPTIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGS 501
             AT+L  E    KP +         P  G++ F  V F+Y +     + K LN  I+ G 
Sbjct: 1166 YATKLPLEAAYKKPELSPPESW---PSKGEIRFLDVDFAYRS-GLPVVLKGLNLDIKSGE 1221

Query: 502  NVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMS 561
             + I G +G GKSTI S L R    TSGKIL+D  DI+ L    LRR+L ++ Q+P+L  
Sbjct: 1222 KIGICGRTGAGKSTIMSALYRLNELTSGKILIDDVDISTLGLYDLRRKLSIIPQDPVLFK 1281

Query: 562  GTIREN----------------ITYGVSRQPSMEEIRS-VAKKCFCHAFISKFPNGYETI 604
            GTIR+N                I  G   + S+E+++S +  +   H  + KF    + +
Sbjct: 1282 GTIRKNLDPFSNYDDSLLWDALIRSGAIEKESVEKVKSEMVNEEGTHTDMHKF--HLDQL 1339

Query: 605  IGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELT 664
            +   G+  S G++Q +A+ RAL+ + KILILDEATS++D E++G I   +  + +    T
Sbjct: 1340 VEEEGSNFSLGERQVLALTRALVRQSKILILDEATSSVDYETDGKIQKRI--VEEFDNCT 1397

Query: 665  IISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
            I+ IAHRL TI + + ++VL   G + E  +   L+++ DS    +
Sbjct: 1398 ILCIAHRLKTILQYDRILVLE-KGVIAEFDQPFKLFSDKDSIFRSM 1442

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 69/202 (34%), Positives = 106/202 (52%), Gaps = 21/202 (10%)

Query: 490 FKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQ 549
           F +L+F I  G  + I GP G GKS++ +    + N T G+I V+G D+           
Sbjct: 588 FSNLDFEIRKGEFIMITGPIGTGKSSLLNAFAGFMNKTEGRIQVNG-DL----------- 635

Query: 550 LGVVQQEPILMSGTIRENITYGVSRQPSMEE-IRSVAKKCFCHAFISKFPNGYETIIGPR 608
             +    P + + T+++NI +G    P ++E   +V + C   A +   P G +T IG R
Sbjct: 636 --LFCGYPWIQNATVKDNILFG---SPFIKEKYENVLRVCSLDADLKVLPAGDKTEIGER 690

Query: 609 GALLSGGQKQRIAIARALLNKPKILILDEATSALDVE-SEGAINYTLGRLMKSKELTIIS 667
           G  LSGGQK RI +ARA+     I + D+  SA+D    +  ++  L  L++ K  T I 
Sbjct: 691 GINLSGGQKARINLARAVYKTKDIFLFDDVLSAVDSRVGKHIMDECLLDLLEGK--TRIL 748

Query: 668 IAHRLSTIRRSENVIVLGIDGS 689
             H+LS I +++ VIVLG DGS
Sbjct: 749 ATHQLSLIEKADRVIVLGTDGS 770

>TPHA0F00410 Chr6 (98503..103215) [4713 bp, 1570 aa] {ON} Anc_4.52
            YLL015W
          Length = 1570

 Score =  137 bits (344), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 135/549 (24%), Positives = 238/549 (43%), Gaps = 75/549 (13%)

Query: 211  NFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQ 270
            N   V++L     R   +L   +    M   M F++   +G +++R  +D   +   +  
Sbjct: 1039 NIRTVIMLLYCSIRGSKKLHDGMALSVMRSPMSFFETTPIGRIVNRFSSDLEAIDSGLQY 1098

Query: 271  NISDGFKA-------LICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISR 323
              S  F++       LI  G  +     +++ L  + F +    ++           +SR
Sbjct: 1099 IFSFFFRSVLIYVVSLILVGYNLPWFIALNAVLIMIYFYYQAYYIM-----------LSR 1147

Query: 324  ELQQAS----GNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNAT 379
            EL++ +      +  +  E L G   + +F        R+N      FN    +   +  
Sbjct: 1148 ELKRLTTISYSPIMSLISETLGGFSVINAF----DHTSRFN-----FFNFETVQYNIDCV 1198

Query: 380  F-FSSTNV-----LGDFSFLLVLAYG----SHLVLQGNLTIGDLTAFMLYTEYTGSAVFG 429
            F F STN      L     L++LA G    + L  +  L+ G +   M Y+    S++  
Sbjct: 1199 FQFRSTNRWLSVRLQTIGNLIILATGLLSFATLGTKKQLSSGMVGLLMSYSLQVTSSLMW 1258

Query: 430  LSTFYSELMKGAGAATRLFELLDYKP----TIKSTTGKAFKPLNGKVEFQHVSFSYPTRK 485
            +     ++     +  R  E  + KP     I+++      P  G +EF + +  Y    
Sbjct: 1259 IVRMTVQIETRIVSVERTLEYCELKPEALEIIENSRPPEGWPREGAIEFNNYTTKY-REN 1317

Query: 486  TNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKS 545
             + + KD+N +I+P   + IVG +G GKST+   L R    T G I +DG DI+K+  + 
Sbjct: 1318 LDPVLKDINVSIKPKEKIGIVGRTGAGKSTLTLALFRLIEATGGSISIDGIDISKIGLED 1377

Query: 546  LRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKF-------- 597
            LR  L ++ Q+     GTIR N+      Q S EE+    +       I +         
Sbjct: 1378 LRSNLAIIPQDAQAFEGTIRSNL--DPFDQHSDEELWRAVELSHLKQHILRMNEEANDRE 1435

Query: 598  ----------PNGYE------TIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSA 641
                      P+ +       T I   G+ +S GQ+Q + ++RALLN  K+LILDEAT+A
Sbjct: 1436 SDSSRTDITTPDSHNIKELLATPISKNGSNVSVGQRQLLCLSRALLNPSKVLILDEATAA 1495

Query: 642  LDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYA 701
            +D+E++  +  T+    + KE TI++IAHR+ T+   + ++VL   G V E     +L +
Sbjct: 1496 IDMETDKIVQDTIKN--EFKERTILTIAHRIDTVMNYDKILVLD-KGEVAEFDTVSNLLS 1552

Query: 702  NHDSALHKL 710
            + ++  +KL
Sbjct: 1553 DKNTMFYKL 1561

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 100/408 (24%), Positives = 195/408 (47%), Gaps = 57/408 (13%)

Query: 335 VAEEQLSGIKTVQSFVAEG----KEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNV--LG 388
           +  E L+ IK+++ +  E     K +H  N+   ++ N  K   F+N  FF+   V  + 
Sbjct: 471 ILTEILNSIKSIKLYSWEKPMLKKLLHVRNDL--ELENFKKIGIFSNLIFFAWNCVPLMV 528

Query: 389 DFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLF 448
             S  L+ +  S + L  ++    LT F +  +    A++ + +  +++++   +  RL 
Sbjct: 529 TCSTFLIFSMISDVPLSPDIIFPSLTLFNILND----AIYVVPSTINDVIQANISMKRLR 584

Query: 449 ELL------DYKPTIKSTTGKAFKPLNGKVEFQHVSFSYPTRK----------------T 486
           + L      D     KS +     P+   +E  + +F + ++K                +
Sbjct: 585 DFLLAEELDDSFIEYKSPSETDDAPV---IEINNATFLWQSKKIINENSSTDEESNIETS 641

Query: 487 NQIFKDL-NFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKI-LVDGQDITKLSSK 544
               K++ NFT++ GS  CIVG  G GKSTI   +L       G++  +   D T+    
Sbjct: 642 KAALKNIDNFTVKKGSLTCIVGKVGSGKSTILHAIL-------GQLPCISALDQTRAPKV 694

Query: 545 SLR-RQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYET 603
           ++R   +    QE  +M+ +++ENI +G     +   +  V + C   + +S  P+G ET
Sbjct: 695 TIRATSIAYCPQEAWIMNSSVKENIVFGHKHDENYYNL--VIQACQLASDLSILPDGDET 752

Query: 604 IIGPRGALLSGG-QKQRIAIARALLNKPKILILDEATSALDVE-SEGAINYTLGR---LM 658
           I+G +G  L GG QK RI++ARA+  +  + +LD+  SA+D   S+  I Y L +   L+
Sbjct: 753 IVGEKGISLVGGVQKARISLARAVYARADVYLLDDILSAVDAHVSKNIIKYVLSKETGLL 812

Query: 659 KSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSA 706
           ++K  TII   + ++ ++ S+ +  +   G +VE   ++++  + D++
Sbjct: 813 RNK--TIILSTNNVNVLKNSQKIYAIE-KGEIVEESDYENVMNSSDAS 857

>Skud_7.614 Chr7 (1027230..1031663) [4434 bp, 1477 aa] {ON} YGR281W
            (REAL)
          Length = 1477

 Score =  136 bits (343), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 140/534 (26%), Positives = 244/534 (45%), Gaps = 54/534 (10%)

Query: 213  GRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNI 272
            G+  +L ++G      L    +K+ +H  M + D   +G +L+R   D   +   +T+++
Sbjct: 951  GQYTILCVMGIMASKWLNLKAVKRILHTPMSYIDTTPLGRILNRFTKDTDSLDNELTESL 1010

Query: 273  ---SDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISR-ELQQA 328
               +  F  ++  GV +  + ++     ++ FL    +L+ A  Y +  R I R E  Q 
Sbjct: 1011 RLLTSQFANIV--GVCVMCIVYLPWFAIAIPFLLVIFVLI-ADHYQSSGREIKRLEAVQR 1067

Query: 329  S---GNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTN---ATFFS 382
            S    NL +V    L G+ T++++ ++ + + + +  + ++   G            F  
Sbjct: 1068 SFVYNNLNEV----LGGMDTIKAYRSQERFLAKSDFLINKMNEAGYLVVVLQRWVGVFLD 1123

Query: 383  STNVLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGA- 441
               ++  F+ ++ L   +        ++G L  ++L      + +    T     M  A 
Sbjct: 1124 MVAIV--FALIVTLLCVTRAFPISAASVGVLLTYVLQLPGLLNTILRAMTQTENDMNSAE 1181

Query: 442  ---GAATRLFELLDY-KPTIKSTTGKAFKPLNGKVEFQHVSFSY-PTRKTNQIFKDLNFT 496
                 AT L    DY KP +   T     P  G++  ++V FSY P      + K+LN  
Sbjct: 1182 RLVSYATELPLEADYRKPEM---TPPESWPSKGEIVLENVCFSYRPGLPV--VLKNLNLN 1236

Query: 497  IEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQE 556
            IE G  + I G +G GKSTI S L R    ++GKIL+D  DI+KL    LRR+L ++ Q+
Sbjct: 1237 IESGEKIGICGRTGAGKSTIMSALYRLNELSAGKILIDDVDISKLGLFDLRRKLAIIPQD 1296

Query: 557  PILMSGTIRENITY-----------------GVSRQPSMEEIRSVAKKCFCHAFISKFPN 599
            P+L  GTIR+N+                    +++    E       K   H  + KF  
Sbjct: 1297 PVLFRGTIRKNLDPFDERTDDELWDALVRGGAIAKNDLSEAKLQKPDKNGTHGRMHKF-- 1354

Query: 600  GYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMK 659
              +  +   G+  S G++Q +A+ RAL+ + KILILDEATS++D E++G I     R+++
Sbjct: 1355 HLDQAVEEEGSNFSLGERQLLALTRALVRQSKILILDEATSSVDYETDGKIQ---ARIVE 1411

Query: 660  S-KELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLLT 712
               + TI+ IAHRL TI   + ++VL   G V E      L+   +S    + +
Sbjct: 1412 EFGDCTILCIAHRLQTIVNYDRILVLE-KGEVAEFDTPWTLFTQENSIFRNMCS 1464

 Score =  100 bits (248), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 78/224 (34%), Positives = 118/224 (52%), Gaps = 23/224 (10%)

Query: 490 FKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQ 549
           FKDLNF I+ G  + I GP G GKS++ + +      T GKI V+G D+           
Sbjct: 604 FKDLNFEIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKIEVNG-DL----------- 651

Query: 550 LGVVQQEPILMSGTIRENITYGVSRQPSMEE-IRSVAKKCFCHAFISKFPNGYETIIGPR 608
             ++   P + +  +R+NI +G    P ++E    V + C   A +   P G  T IG R
Sbjct: 652 --LMCGYPWIQNAPVRDNIIFG---SPFIKEKYNEVIRVCSLKADLDILPAGDMTEIGER 706

Query: 609 GALLSGGQKQRIAIARALLNKPKILILDEATSALDVE-SEGAINYTLGRLMKSKELTIIS 667
           G  LSGGQK RI +AR++  + +I + D+  SA+D    +  ++  L  ++ +K  T I 
Sbjct: 707 GITLSGGQKARINLARSVYKRKEIYLFDDVLSAVDSRVGKHIMDECLTGMLANK--TRIL 764

Query: 668 IAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLL 711
             H+LS I R+  VIVLG DG  V++G   +L A + + L KLL
Sbjct: 765 ATHQLSLIERASRVIVLGTDGQ-VDIGTVDELKARNQT-LIKLL 806

>KLTH0B00396g Chr2 complement(38234..42757) [4524 bp, 1507 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1507

 Score =  136 bits (343), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 146/527 (27%), Positives = 249/527 (47%), Gaps = 55/527 (10%)

Query: 210  ANFGRVVLLKIL--GERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRS 267
            A+   +++LK L  G    +++ + ++ + +H  M F+D    G +L+R+  D  I+ + 
Sbjct: 974  ASVTTLIMLKFLCIGLEASSKVFAEILNRVLHAKMTFFDFTPAGRILNRITRDFEILEQE 1033

Query: 268  MTQNISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPL-LVGATIYGNKIRAISRELQ 326
            +   +     A+      +G +  + S +A+   +FA  L ++ A +  + I A  R+L+
Sbjct: 1034 LMVLLLQLLFAI----TSLGAILLLISVIATKFLIFAFLLGIIYAVMITSYIPAF-RDLK 1088

Query: 327  QASGNLTKVAEEQ----LSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFS 382
            +  G       EQ    LSG  T++ F   GKE        R++ ++  + A+       
Sbjct: 1089 RYEGITRSPIFEQFSELLSGFVTIRGF---GKEKSCMGQLFRKL-DLNNRPAYY------ 1138

Query: 383  STNVLGDFSFLLVLAYGSHLVLQGNLTIGDLTA----------FMLYTEYTGSAVFGLST 432
              +V+  +  L V   GS LVL    T+  L A           + Y      +    +T
Sbjct: 1139 -VSVVQLWLCLRVEVLGS-LVLGATATLSLLNAKELGAGLAGLALTYAMPFSQSALWTAT 1196

Query: 433  FYSELMKGAGAATRLFELLDYKPTIKSTTGKAFKPLN------GKVEFQHVSFSYPTRKT 486
              S +     +  R+ E  +    I     KA   +N       ++ F HV   Y     
Sbjct: 1197 VSSNVEIKMTSVERIKEYTE----IDCEDTKAGALINTQWSGGAEISFDHVYVRYAPHLP 1252

Query: 487  NQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSL 546
            + + K+++FT+ P S V IVG +G GKST+   L R    T+G I + G DI  L+ ++L
Sbjct: 1253 D-VLKNVSFTLLPNSKVAIVGRTGSGKSTVMMSLFRLIELTNGTIRIGGIDIASLNLQTL 1311

Query: 547  RRQLGVVQQEPILMSGTIRENI-TYGVSRQPSMEEIRSVAKKC--FCHAFISKFPNGYET 603
            RR+L V+ Q+P L SGTI+ NI  +G   + S +E+   A++   F      +  N   +
Sbjct: 1312 RRELTVIPQDPSLFSGTIKSNIDPFG---RYSDQELTHFARRIGLFSGTDDVRTFNSLGS 1368

Query: 604  IIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKEL 663
            ++   G  +S GQ+Q + +ARALL K KILILDEAT+++D E++  I   +     S   
Sbjct: 1369 LVSEGGENMSQGQRQLLCLARALLQKSKILILDEATASIDHETDATIQQVVRDF--SSGG 1426

Query: 664  TIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
             +I++AHR+STI   + VIVL  D  +V+      L    + A H++
Sbjct: 1427 IVITVAHRMSTIIDYDQVIVL--DSGIVKENNHPYLLLKQNGAFHQM 1471

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 81/293 (27%), Positives = 136/293 (46%), Gaps = 35/293 (11%)

Query: 474 FQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILV 533
           F++ S ++    T  + K+L    E      I+GPSG GKS++   LL   +   G I V
Sbjct: 637 FRNASLTWNRFDTGFMLKNLTIDFELHKLNVIIGPSGSGKSSVLLALLGELDLIEGSIRV 696

Query: 534 DGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAF 593
                 +      R       Q P + + T++ENI +  S Q + +  + V   C     
Sbjct: 697 P-----RGYMHDDRCSFAFCSQTPWITNATVKENIVF--SSQFNTKRYQEVLHACGLEED 749

Query: 594 ISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAI--N 651
           I +   G ET++G +G  LSGGQ+QR+A+ARA+ +  + L+LD+  SA+D      I   
Sbjct: 750 ILEMQEGDETVVGDKGMTLSGGQRQRLALARAVYSGAEHLLLDDCLSAVDPGMAVWIFQK 809

Query: 652 YTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLL 711
             +G LMK K  T I   H ++ +++  ++I+L  +G V ++GK +D   N DS      
Sbjct: 810 CIMGPLMKGK--TCILATHNIALVQKHADMIILLDNGRVSKIGKARDF--NFDSEFD--- 862

Query: 712 TXXXXXXXXXXXXYAPPAITQESE------PQTEENGKDDSGEDQNSDHEENS 758
                        Y+ P+  +++E      P+ E   + D+G  +    E+ S
Sbjct: 863 -------------YSKPSKLEKAEMKPNKKPKKEMILQPDTGFSREEHKEDGS 902

>Skud_12.52 Chr12 (107860..112545) [4686 bp, 1561 aa] {ON} YLL015W
            (REAL)
          Length = 1561

 Score =  135 bits (341), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 144/536 (26%), Positives = 245/536 (45%), Gaps = 55/536 (10%)

Query: 211  NFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQ 270
            N   +V+L     R   +L  N+ K  +   M F++   VG +++R  +D   V  S+  
Sbjct: 1036 NLRSIVMLLYCSIRGSKKLHENMAKSVIRSPMVFFETTPVGRIINRFSSDMDAVDSSLQY 1095

Query: 271  NISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQ--- 327
              S  FK+++   V + ++ +         F+F   LLV    Y      +SREL++   
Sbjct: 1096 IFSFFFKSILTYLVTVILVGYN----MPWFFVFNMFLLVIYIYYQTFYIVLSRELKRLIS 1151

Query: 328  -ASGNLTKVAEEQLSGIKTV------QSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATF 380
             +   +  +  E L+G   +      + F+    E  +YN  +  VFN      + +   
Sbjct: 1152 ISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQYN--IDFVFNFRSTNRWLSVRL 1209

Query: 381  --FSSTNVLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYT-EYTGSAVFGLSTFYSEL 437
                +T VL   + +L L   + +  +  L+ G +   M Y+ E TGS  + + T    +
Sbjct: 1210 QTIGATIVLA--TAMLAL---TTMNTKKQLSSGMVGLLMSYSLEVTGSLTWIVRT-TVMI 1263

Query: 438  MKGAGAATRLFELLDYKPTIKSTTGK----AFKPLNGKVEFQHVSFSYPTRKTNQIFKDL 493
                 +  R+ E  +     +S   +       P  G +EF++ S  Y     + + KD+
Sbjct: 1264 ETNIVSVERIVEYCELPSEARSINPENRPDESWPSKGSIEFKNYSTKY-RENLDPVLKDI 1322

Query: 494  NFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVV 553
            N  I+P   + IVG +G GKST++  L R   PT G I++D  +I+ L    LR  L ++
Sbjct: 1323 NVRIKPCEKIGIVGRTGAGKSTLSLALFRILEPTEGSIVIDDINISDLGLFDLRSHLAII 1382

Query: 554  QQEPILMSGTIRENI------TYGVSRQ--------PSME-----EIRSVAKKCFCHAFI 594
             Q+     GT+R N+      + G  ++        P +E     EIR        +  +
Sbjct: 1383 PQDAQAFEGTVRTNLDPFNRYSEGELKKAVDLAHLGPHLEKMLDNEIRGADGAAEENGNV 1442

Query: 595  SKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTL 654
            S   N     I   G  LS GQ+Q + +ARALLN+ KIL+LDEAT+++D+E++  I  T+
Sbjct: 1443 SDVLN---VKINENGTNLSVGQRQLLCLARALLNRSKILVLDEATASVDMETDKIIQDTI 1499

Query: 655  GRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
             R  K +  TI++IAHR+ T+  S+ +IVL  +G+V E      L ++  S  + L
Sbjct: 1500 RREFKDR--TILTIAHRIDTVLDSDKIIVLD-EGTVKEFDSPSKLLSDKASIFYSL 1552

 Score = 91.7 bits (226), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 87/301 (28%), Positives = 146/301 (48%), Gaps = 27/301 (8%)

Query: 494 NFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSG-KILVDGQDITKLSSKSLRRQLGV 552
           +F  + G  VC+VG  G GKST    +L      SG K  +  + I + SS      L  
Sbjct: 659 HFEAKRGDLVCVVGRVGAGKSTFLKGILGQLPCMSGSKGSIPPKLIIRASS------LAY 712

Query: 553 VQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALL 612
             QE  +M+ ++RENI +G     +  ++    K C     +   P+G ET++G +G  L
Sbjct: 713 CSQESWIMNSSVRENILFGHKFDKAYYDL--TIKACQLLPDLKILPDGDETLVGEKGISL 770

Query: 613 SGGQKQRIAIARALLNKPKILILDEATSALDVE-SEGAINYTL-GRLMKSKELTIISIAH 670
           SGGQK R+++ARA+ ++  I +LD+  SA+D E S+  + Y L G+    K  TII   +
Sbjct: 771 SGGQKARLSLARAVYSRADIYLLDDVLSAVDAEVSKNIVEYVLIGKAALLKNKTIILATN 830

Query: 671 RLSTIRRSENVIVLGIDGSVVEMGKFKDLY--ANHDSALHKLLTXXXXXXXXXXXXYAPP 728
            +  ++ S+ +  L  +G ++E G ++ +    N +S L KLL              +P 
Sbjct: 831 TVPILKHSQMIYALE-NGEIIEQGNYEGVMNRENTNSKLKKLLEEFD----------SPI 879

Query: 729 AITQESEPQTEENGKDDSGEDQNSDHEENSQDQNEKRLQEEVIHQVLEDISHDQKTSTLR 788
               +S+ QTE   + D  E       E S+ ++E   + E+  ++++  S     +TLR
Sbjct: 880 DNGSKSDIQTEHRSESDMDEPLQLKVVE-SETEDEIATEGEL--ELIKANSRRASLATLR 936

Query: 789 P 789
           P
Sbjct: 937 P 937

>KAFR0L00190 Chr12 complement(21836..26797) [4962 bp, 1653 aa] {ON}
            Anc_4.6 YHL035C
          Length = 1653

 Score =  135 bits (340), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 139/525 (26%), Positives = 240/525 (45%), Gaps = 77/525 (14%)

Query: 233  VIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGMMFHI 292
            ++ K +H  + F+D   +G +++R   D       + Q+++  F+       G    F  
Sbjct: 1134 LLDKVLHAKLRFFDSTPIGRIMNRFSKDM----EGIDQDLAPYFQ-------GAFYSFIE 1182

Query: 293  SSTLASVLFLFAPPLLVGATIYGNKIRAI-------SRELQQASGNLTKVA-----EEQL 340
              T   ++    P  L  A I G     I       SREL++   ++TK        E L
Sbjct: 1183 CITTIILITFITPQFLSVAIIVGMLYYMIGYFYLTGSRELKRLD-SITKSPIYQHFSETL 1241

Query: 341  SGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLL-----V 395
             G+ T+++F  E + +           N+ K +   N  FF         SF +     +
Sbjct: 1242 VGVTTIRAFGDESRFLRE---------NLLKIDE-NNRPFFYLWVANRWLSFRIDVIGAL 1291

Query: 396  LAYGSHLVLQGNLTIGD-------LTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLF 448
            + +GS + +  N+   D       LT  + +TE        L  FYSE+     +  R+ 
Sbjct: 1292 VVFGSGIFILTNINTIDSGMAGISLTYAISFTE----GALWLVRFYSEVEMNMNSVERVH 1347

Query: 449  ELL--DYKP----TIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSN 502
            E +  + +P     +  +   A  P  G++E   +S  Y      ++ K++ F ++P + 
Sbjct: 1348 EYMTIEQEPYDEVQVSDSKVPADWPEEGRIEVSDLSLRYAAH-LPKVIKNVTFNVDPRAK 1406

Query: 503  VCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSG 562
            V +VG +G GKSTI + L R+    +G I +DG DIT ++   LRR + ++ Q+P L SG
Sbjct: 1407 VGVVGRTGAGKSTIITALFRFLEAETGYIKIDGLDITSVNLTRLRRSITIIPQDPTLFSG 1466

Query: 563  TIRENI----------TYGVSRQPSM---EEIRSVAKKCFCHAFI-SKFPNGY---ETII 605
            TI+ N+           +   R+ ++   EE+ S  +     A + SK  N +   E+ I
Sbjct: 1467 TIKSNLDPYDEYKDEEVFEALRRVNLVTEEELSSRTENNNDEASVSSKNINRFLDLESEI 1526

Query: 606  GPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTI 665
               G   S GQ+Q I +AR+LL  PKIL+LDEAT+++D +S+  +  T+    +  E TI
Sbjct: 1527 AEGGTNFSQGQRQLICLARSLLRSPKILLLDEATASIDYDSDAKVQETIR--TEFSESTI 1584

Query: 666  ISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
            ++IAHRL ++   + ++V+G  G V E      L  N +S  + +
Sbjct: 1585 LTIAHRLRSVIDYDKILVMGA-GEVKEYDHPYSLLLNKNSIFYSM 1628

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 63/231 (27%), Positives = 114/231 (49%), Gaps = 11/231 (4%)

Query: 470 GKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSG 529
            ++ F++ + ++   + +   ++LN   + G    I+GP+G GK+++   LL   N   G
Sbjct: 699 NQIAFKNTTVAWDNSRDSFKLRNLNIDFKVGKLNVIIGPTGSGKTSLLMALLGEMNLLEG 758

Query: 530 KILVDGQDITK---LSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSME-EIRSVA 585
           +I+V   +      + S      +    Q   L++ T+R NI +     P  E    +V 
Sbjct: 759 QIVVPALNARHDLIVESDGTTNSIAYCSQAAWLLNDTVRNNILFN---SPYNETRYHNVV 815

Query: 586 KKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVE 645
           + C           G  T IG +G  LSGGQKQRI++ARAL +  + ++LD+  SA+D  
Sbjct: 816 EACGLRRDFEILKAGDMTEIGEKGIALSGGQKQRISLARALYSNSRHVLLDDCLSAVDAH 875

Query: 646 SEGAI--NYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMG 694
           +   +  N   G LM+ +  T I ++H ++   R+ +++V+  DG V + G
Sbjct: 876 TALWVYDNCITGPLMEGR--TCILVSHNIALTLRNADLVVMLEDGQVKDQG 924

>Suva_10.60 Chr10 (123173..126145) [2973 bp, 990 aa] {ON} YLL015W
           (REAL)
          Length = 990

 Score =  134 bits (336), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 139/540 (25%), Positives = 250/540 (46%), Gaps = 63/540 (11%)

Query: 211 NFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQ 270
           N   +++L     R   +L  N+ K  +   M F++   VG +++R  +D   V  S+  
Sbjct: 465 NLRSIIMLLYCSIRGSKKLHENMAKSVIRSPMVFFETTPVGRIINRFSSDMDAVDSSLQY 524

Query: 271 NISDGFKALICGGVGIGMM-FHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQ-- 327
             S  FK+++   V I ++ +++   L   +FL     LV    Y      +SREL++  
Sbjct: 525 VFSFFFKSILTYLVTIVLVGYNMPWFLVFNMFL-----LVIYIYYQTFYIVLSRELKRLI 579

Query: 328 --ASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVF-NVGKKEAFTNATF-FSS 383
             +   +  +  E L+G   + +          YN+  R ++ N  K ++  +  F F S
Sbjct: 580 SISYSPIMSLMSESLNGYSIIDA----------YNHYERFIYLNYDKIQSNIDLVFNFRS 629

Query: 384 TNVLGDFSFLLVLAYGSHLVL------------QGNLTIGDLTAFMLYT-EYTGSAVFGL 430
            N         +   G+ +VL            +  L+ G +   M Y+ E T S  + +
Sbjct: 630 INRWLSVRLQTI---GATIVLATALLALATINTKNQLSSGMVGLLMAYSFEVTSSLTWIV 686

Query: 431 STFYSELMKGAGAATRLFELLDYKPTIKSTTGKAFK----PLNGKVEFQHVSFSYPTRKT 486
            T    +     +  R+ E  +  P  +S   +       P  G++EF++ S  Y     
Sbjct: 687 RTTVM-IETNIVSVERIVEYCELPPEAQSINPEKRPDENWPSEGRIEFKNYSTKY-RENL 744

Query: 487 NQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSL 546
           + + KD+N +I+P   + IVG +G GKST++  L R   P+ G+I++D  +I++L    L
Sbjct: 745 DPVLKDINVSIQPCEKIGIVGRTGAGKSTLSLALFRILEPSEGEIIIDDVNISELGLFDL 804

Query: 547 RRQLGVVQQEPILMSGTIRENIT----YG---VSRQPSMEEIRSVAKKCFCHAF------ 593
           R  L ++ Q+     GT+R N+     Y    + R   +  ++S  +K   +        
Sbjct: 805 RSNLAIIPQDAQAFEGTVRTNLDPFNRYSEDELKRAIELAHLKSHLEKMLGNEAENNDIN 864

Query: 594 ISKFPNGYETI---IGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAI 650
           + +  N  + +   I   G+ LS GQ+Q + +ARALL+  KIL+LDEAT+++D+E++  I
Sbjct: 865 VEERGNAKDILDVKINENGSNLSVGQRQLLCLARALLSHSKILVLDEATASVDMETDKII 924

Query: 651 NYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
             T+ R  K +  TI++IAHR+ T+  S+ +IVL   G+V E      L ++  S  + L
Sbjct: 925 QDTIRREFKDR--TILTIAHRIDTVLDSDKIIVLD-KGNVKEFDSPSKLLSDKGSIFYSL 981

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 72/223 (32%), Positives = 116/223 (52%), Gaps = 14/223 (6%)

Query: 494 NFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSG-KILVDGQDITKLSSKSLRRQLGV 552
           +F  + G  +C+VG  G GKST    +L      SG K  +  + I + SS      L  
Sbjct: 88  HFEAKRGDLICVVGRVGAGKSTFLKAILGQLPCMSGSKESLAPKLIIRASS------LAY 141

Query: 553 VQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALL 612
             QE  +M+ ++RENI +G     +  ++    K C     +   P+G ET++G +G  L
Sbjct: 142 CSQESWIMNASVRENILFGHKFDKAYYDL--TIKACQLLPDLKILPDGDETLVGEKGISL 199

Query: 613 SGGQKQRIAIARALLNKPKILILDEATSALDVE-SEGAINYTL-GRLMKSKELTIISIAH 670
           SGGQK R+++ARA+ ++  I +LD+  SA+D E S+  I + L G+    K  TII   +
Sbjct: 200 SGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEHVLIGKTALLKNKTIILTTN 259

Query: 671 RLSTIRRSENVIVLGIDGSVVEMGKFKDLY--ANHDSALHKLL 711
            +S ++ S+ +  L  +G +VE G ++ +    N  S L KLL
Sbjct: 260 TVSILKHSQMIYALE-NGEIVEQGNYESVMKRENDSSKLKKLL 301

>Suva_10.59 Chr10 (121460..126142) [4683 bp, 1561 aa] {ON} YLL015W
            (REAL)
          Length = 1561

 Score =  133 bits (334), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 136/539 (25%), Positives = 248/539 (46%), Gaps = 61/539 (11%)

Query: 211  NFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQ 270
            N   +++L     R   +L  N+ K  +   M F++   VG +++R  +D   V  S+  
Sbjct: 1036 NLRSIIMLLYCSIRGSKKLHENMAKSVIRSPMVFFETTPVGRIINRFSSDMDAVDSSLQY 1095

Query: 271  NISDGFKALICGGVGIGMM-FHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQ-- 327
              S  FK+++   V I ++ +++   L   +FL     LV    Y      +SREL++  
Sbjct: 1096 VFSFFFKSILTYLVTIVLVGYNMPWFLVFNMFL-----LVIYIYYQTFYIVLSRELKRLI 1150

Query: 328  --ASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVF-NVGKKEAFTNATF-FSS 383
              +   +  +  E L+G   + +          YN+  R ++ N  K ++  +  F F S
Sbjct: 1151 SISYSPIMSLMSESLNGYSIIDA----------YNHYERFIYLNYDKIQSNIDLVFNFRS 1200

Query: 384  TNVLGDFSFLLVLAYGSHLVL------------QGNLTIGDLTAFMLYTEYTGSAVFGLS 431
             N         +   G+ +VL            +  L+ G +   M Y+    S++  + 
Sbjct: 1201 INRWLSVRLQTI---GATIVLATALLALATINTKNQLSSGMVGLLMAYSFEVTSSLTWIV 1257

Query: 432  TFYSELMKGAGAATRLFELLDYKPTIKSTTGKAFK----PLNGKVEFQHVSFSYPTRKTN 487
                 +     +  R+ E  +  P  +S   +       P  G++EF++ S  Y     +
Sbjct: 1258 RTTVMIETNIVSVERIVEYCELPPEAQSINPEKRPDENWPSEGRIEFKNYSTKY-RENLD 1316

Query: 488  QIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLR 547
             + KD+N +I+P   + IVG +G GKST++  L R   P+ G+I++D  +I++L    LR
Sbjct: 1317 PVLKDINVSIQPCEKIGIVGRTGAGKSTLSLALFRILEPSEGEIIIDDVNISELGLFDLR 1376

Query: 548  RQLGVVQQEPILMSGTIRENIT----YG---VSRQPSMEEIRSVAKKCFCHAF------I 594
              L ++ Q+     GT+R N+     Y    + R   +  ++S  +K   +        +
Sbjct: 1377 SNLAIIPQDAQAFEGTVRTNLDPFNRYSEDELKRAIELAHLKSHLEKMLGNEAENNDINV 1436

Query: 595  SKFPNGYETI---IGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAIN 651
             +  N  + +   I   G+ LS GQ+Q + +ARALL+  KIL+LDEAT+++D+E++  I 
Sbjct: 1437 EERGNAKDILDVKINENGSNLSVGQRQLLCLARALLSHSKILVLDEATASVDMETDKIIQ 1496

Query: 652  YTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
             T+ R  K +  TI++IAHR+ T+  S+ +IVL   G+V E      L ++  S  + L
Sbjct: 1497 DTIRREFKDR--TILTIAHRIDTVLDSDKIIVLD-KGNVKEFDSPSKLLSDKGSIFYSL 1552

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 81/290 (27%), Positives = 136/290 (46%), Gaps = 42/290 (14%)

Query: 494 NFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRR--QLG 551
           +F  + G  +C+VG  G GKST    +L       G++         L+ K + R   L 
Sbjct: 659 HFEAKRGDLICVVGRVGAGKSTFLKAIL-------GQLPCMSGSKESLAPKLIIRASSLA 711

Query: 552 VVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGAL 611
              QE  +M+ ++RENI +G     +  ++    K C     +   P+G ET++G +G  
Sbjct: 712 YCSQESWIMNASVRENILFGHKFDKAYYDL--TIKACQLLPDLKILPDGDETLVGEKGIS 769

Query: 612 LSGGQKQRIAIARALLNKPKILILDEATSALDVE-SEGAINYTL-GRLMKSKELTIISIA 669
           LSGGQK R+++ARA+ ++  I +LD+  SA+D E S+  I + L G+    K  TII   
Sbjct: 770 LSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEHVLIGKTALLKNKTIILTT 829

Query: 670 HRLSTIRRSENVIVLGIDGSVVEMGKFKDLY--ANHDSALHKLLTXXXXXXXXXXXXYAP 727
           + +S ++ S+ +  L  +G +VE G ++ +    N  S L KLL                
Sbjct: 830 NTVSILKHSQMIYALE-NGEIVEQGNYESVMKRENDSSKLKKLL---------------- 872

Query: 728 PAITQESEPQTEENGKDDSGEDQNSDHEENSQDQNEKRLQEEVIHQVLED 777
               +E +   +   + D   DQ+ + +E      E+ LQ +V+    ED
Sbjct: 873 ----EEFDTPIDNMNESDRRTDQSPERDE------EETLQLKVVESEAED 912

>Kwal_56.23844 s56 complement(733654..738138) [4485 bp, 1494 aa] {ON}
            YDR135C (YCF1) - metal resistance protein, similar to
            multidrug resistance proteins and cystic fibrosis protein
            CFTR [contig 171] FULL
          Length = 1494

 Score =  132 bits (333), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 133/511 (26%), Positives = 232/511 (45%), Gaps = 36/511 (7%)

Query: 216  VLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDG 275
            V   I G + +  + ++ I K     M F++   +G +L+R   D Y V   + +  S  
Sbjct: 995  VYCTIHGSKYLHDIMADAIFKA---PMTFFETTPIGRVLNRFSNDIYKVDELLGRTFSQF 1051

Query: 276  FKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQ----ASGN 331
            F   +   V   ++   SST   V  +   PL      Y       SREL++        
Sbjct: 1052 FVNAV--KVSFTIIVICSSTWQFVFVII--PLGTLYIYYQQYYLRTSRELRRLDSVTRSP 1107

Query: 332  LTKVAEEQLSGIKTVQSFVAEGKEVH----RYNNAVRQVF---NVGKKEAFTNATFFSST 384
            +    +E L GI T++ +  +G+ +H    R +N +   +   N  +  AF    F  S 
Sbjct: 1108 IYAHFQETLGGISTIRGYQQQGRFLHINQARVDNNMSAFYPSVNANRWLAF-RLEFIGSI 1166

Query: 385  NVLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAA 444
             +LG  +           + QG LT G +   + Y      ++  +     E+     + 
Sbjct: 1167 IILGAATL------SVFRLKQGALTPGMIGLSVSYALQITQSLNWIVRMTVEVETNIVSV 1220

Query: 445  TRLFELLDYKP----TIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPG 500
             R+ E  +  P     I+S       P +G ++F++ S  Y   + +   +++N  I+P 
Sbjct: 1221 ERIKEYANITPEAPAVIESNRPAEDWPTHGAIKFENYSARYRP-ELDLSLRNINIDIKPQ 1279

Query: 501  SNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILM 560
              + IVG +G GKS++   L R      G+I++DG     +  + LR  L ++ Q+  + 
Sbjct: 1280 ERIGIVGRTGAGKSSLTLALFRIIEAAEGRIIIDGVPTDSIGLRDLRHHLSIIPQDSQVF 1339

Query: 561  SGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKF-PNGYETIIGPRGALLSGGQKQR 619
             GT+RENI    + + + EEI    +       I     +  E+++   G  LS GQ+Q 
Sbjct: 1340 EGTVRENI--DPTNEYTDEEIWHALELAHLKDHIKSLGKDELESMLTEGGGNLSVGQRQL 1397

Query: 620  IAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSE 679
            + +ARALL   +IL+LDEAT+A+DVE++  I  T+    K++  TI++IAHR++TI  S+
Sbjct: 1398 MCLARALLIPTRILVLDEATAAVDVETDQVIQETIRTAFKNR--TILTIAHRINTILDSD 1455

Query: 680  NVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
             ++VL   G + E    + L  N +S  + L
Sbjct: 1456 RILVLD-SGKIAEFDSPEALLKNRESLFYSL 1485

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 66/256 (25%), Positives = 121/256 (47%), Gaps = 35/256 (13%)

Query: 490 FKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQ 549
            K++NF  + G   CIVG  G GKS +   +L       G   V G              
Sbjct: 631 LKNINFQAKKGELTCIVGKVGSGKSALIQGILGDLFRVKGFASVHGS------------- 677

Query: 550 LGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRG 609
           +  V Q P +M+GT++ENI +G        +  +  + C     +S  P G ET++G +G
Sbjct: 678 IAYVSQVPWIMNGTVKENILFGHKYDADFYD--TTLRACALAVDLSILPKGDETLVGEKG 735

Query: 610 ALLSGGQKQRIAIARALLNKPKILILDEATSALDVE-SEGAINYTLG---------RLMK 659
             LSGGQK RI++ARA+  +    +LD+  +A+D   ++  I + LG         +++ 
Sbjct: 736 ISLSGGQKARISLARAVYARADTYLLDDPLAAVDEHVAKHLIEHVLGSQGLLSSKVKVLA 795

Query: 660 SKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLLTXXXXXXX 719
           + +++++SIA  +S +           +G +++ G ++++ ++  SAL K++        
Sbjct: 796 TNKISVLSIADHISLLE----------NGEIIQQGSYEEVTSDKSSALSKIIANYGKKQT 845

Query: 720 XXXXXYAPPAITQESE 735
                 +P + T +SE
Sbjct: 846 KGKGDESPESSTPDSE 861

>Kpol_1033.28 s1033 complement(69924..74519) [4596 bp, 1531 aa] {ON}
            complement(69924..74519) [4596 nt, 1532 aa]
          Length = 1531

 Score =  132 bits (332), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 132/503 (26%), Positives = 225/503 (44%), Gaps = 35/503 (6%)

Query: 229  LRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGM 288
            L S+++   +   M F++   +G +L+R   D Y +   + ++ S  F       V +  
Sbjct: 1033 LHSSMVSSILRAPMTFFETTPIGRILNRFSNDVYKIDEVLGRSFSQFF----VNAVKVSF 1088

Query: 289  MFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVA-----EEQLSGI 343
               +         L   P+ V    Y       SREL++   ++TK       +E L G+
Sbjct: 1089 TILVICWNTWQFILLVIPMGVLYLYYQQYYLRTSRELRRLD-SITKSPIYAHFQESLGGL 1147

Query: 344  KTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAYGSHLV 403
             T++ +  + + +H     V    +       +N         LG    L++    S  +
Sbjct: 1148 ATIRGYEQQKRFIHINQARVDNNMSAYYPSINSNRWLAYRLEFLGS---LIIFGAASLSI 1204

Query: 404  LQ---GNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKP----T 456
            L+   G LT G +   + Y      ++  +     E+     +  R+ E  + K      
Sbjct: 1205 LKLRDGTLTAGMIGLSLSYALQVTQSLNWIVRMTVEVETNIVSVERIKEYAELKSEAPLI 1264

Query: 457  IKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTI 516
            I+        P  G ++F++ S  Y     + + K+++  I+P   V IVG +G GKS++
Sbjct: 1265 IEEKRPSENWPERGAIKFENYSTRYRP-DLDLVLKNISLDIKPQEKVGIVGRTGAGKSSL 1323

Query: 517  ASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQP 576
               L R      G I+VDG +I+++    LR +L ++ Q+  +  GTIRENI    +   
Sbjct: 1324 TLALFRIIEAAEGSIIVDGLNISEIGLYDLRHKLSIIPQDSQVFEGTIRENI--DPTNIY 1381

Query: 577  SMEEIRSVAKKCFCHAFISKF----PNGYE-----TIIGPRGALLSGGQKQRIAIARALL 627
            + E+I +  +       I +      NG E     T +   G  LS GQ+Q + +ARALL
Sbjct: 1382 TDEQIWNALELSHLKQHILRMNEESVNGSENNALYTRVTEGGNNLSVGQRQLMCLARALL 1441

Query: 628  NKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGID 687
               KILILDEAT+A+DVE++  I  T+    K +  TI++IAHRL+TI  S+ ++VL   
Sbjct: 1442 VPSKILILDEATAAVDVETDSLIQETIRTAFKDR--TILTIAHRLNTIMDSDKIVVLD-K 1498

Query: 688  GSVVEMGKFKDLYANHDSALHKL 710
            G V E    ++L  N +S  + L
Sbjct: 1499 GEVAEFDTPQNLLKNTESLFYSL 1521

 Score = 97.1 bits (240), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 117/513 (22%), Positives = 232/513 (45%), Gaps = 55/513 (10%)

Query: 222 GERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQ--NI--SDGFK 277
           G  + + + S + +K +    E  D +  GD+++ +  D   + + +TQ  NI  S  F+
Sbjct: 375 GMNIRSAMTSVLYQKALVLSNEASDLSSTGDVVNLMSVDVQRL-QDLTQWCNIIWSGPFQ 433

Query: 278 ALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNL----T 333
            ++C       +F +   L   +++    L+V   +    +R I ++LQ+         T
Sbjct: 434 IILC-------LFSLYKLLGHSMWVGVIVLIVMIPLNSYLMR-IQKQLQKVQMKYKDERT 485

Query: 334 KVAEEQLSGIKTVQSFVAEGK-----EVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLG 388
           +V  E L+ IK+++ +  E       E  R    ++ +  +G   A TN  F +    L 
Sbjct: 486 RVINEILNNIKSLKLYAWEQPYKEKLEHVRNEKELKNLTRIGVFNAMTNFQF-NLVPFLV 544

Query: 389 DFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLF 448
             S   V  Y     L  +L    LT F L T    +    ++ F    ++ + + +RLF
Sbjct: 545 SCSTFAVFVYIEDKPLTTDLVFPALTLFNLLTFPLAALPIVITAF----IEASVSMSRLF 600

Query: 449 ELLDYKPTIKSTTGKAFKPLNGKVEF-----QHVSFSYPTRKTNQI-FKDLNFTIEPGSN 502
             +     +++   +   P+  + +       + +F +  +   ++  K++ F  + G  
Sbjct: 601 SFMT-NEELQTDAIQRLPPVKKQGDIAVNIGDNATFLWKRKPEYKVALKNIEFQAKKGEL 659

Query: 503 VCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSG 562
            CIVG  G GKS     +L       G   + G              +  V Q P +M+G
Sbjct: 660 ACIVGKVGSGKSAFIQSILGDLFRVKGFATIHGN-------------VAYVSQLPWIMNG 706

Query: 563 TIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAI 622
           T+++NI +G   + + E      + C     +S  P+G +T++G +G  LSGGQK R+++
Sbjct: 707 TVKDNILFG--HKYNQEFYEKTLRACALTIDLSILPDGDQTLVGEKGISLSGGQKARLSL 764

Query: 623 ARALLNKPKILILDEATSALDVE-SEGAINYTLGR--LMKSKELTIISIAHRLSTIRRSE 679
           ARA+  +  + +LD+  +A+D   S+  I + +G   L+ +K  T +   +++S +  ++
Sbjct: 765 ARAVYARADVYLLDDPLAAVDEHVSKHLIQHVIGPNGLLHTK--TRVLATNKISVLSIAD 822

Query: 680 NVIVLGIDGSVVEMGKFKDLYANHDSALHKLLT 712
           N+ +L  DG +V+ G + ++  N +S L KL++
Sbjct: 823 NITLLD-DGEIVQQGTYNEVTDNINSPLCKLIS 854

>ZYRO0D06160g Chr4 (524435..529012) [4578 bp, 1525 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1525

 Score =  132 bits (331), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 131/493 (26%), Positives = 223/493 (45%), Gaps = 49/493 (9%)

Query: 242  MEFYDRNKVGDLLSRLGADAY----IVSRSMTQNISDGFKALICGGVGIGMMFHISSTLA 297
            M F++   +G +L+R   D +    ++ R+ +Q +++  K              +S T+ 
Sbjct: 1045 MRFFETTPIGRILNRFSNDIFKVDELLGRTFSQFVNNVIK--------------VSFTII 1090

Query: 298  SVLF------LFAPPLLVGATIYGNKIRAISRELQQASGN----LTKVAEEQLSGIKTVQ 347
             + F      LF  PL +    Y       SREL++        +    +E L G+ T++
Sbjct: 1091 VICFTTWQFTLFVIPLGILYVYYQQYYLRTSRELRRLDSTTRSPIYAHFQESLGGLSTIR 1150

Query: 348  SFVAEGKEVH----RYNNAVRQVF-NVGKKEAFTNATFFSSTNVLGDFSFLLVLAYGSHL 402
             +  + + +H    R +N +   + +V           F  T ++   S L +L   S  
Sbjct: 1151 GYNQQRRFIHINQSRMDNNMSAYYPSVNANRWLAYRLEFIGTIIIFGASSLSILRLKS-- 1208

Query: 403  VLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPT----IK 458
               G+LT G +   + Y      ++  +     E+     +  R+ E  +        I+
Sbjct: 1209 ---GSLTPGMIGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSEIPSEAPYLIE 1265

Query: 459  STTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIAS 518
                    P +G ++FQH S  Y     + I KD+N  I+P   + IVG +G GKS++  
Sbjct: 1266 DRRPSPNWPTDGAIQFQHYSTRYRP-GLDLILKDINLDIKPKEKIGIVGRTGAGKSSLTL 1324

Query: 519  LLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSM 578
             L R      G+I++DG  I ++    LR +L ++ Q+  +  G++RENI    + Q S 
Sbjct: 1325 ALFRLIEAAEGRIVIDGVPIDQMGLYDLRHKLSIIPQDSQVFEGSVRENI--DPTEQYSD 1382

Query: 579  EEIRSVAKKCFCHAFISKFPN-GYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDE 637
            EEI  V         +    N G  T +   G  LS GQ+Q + +ARALL   KIL+LDE
Sbjct: 1383 EEIWRVLDLSHLKNHVLNMGNDGLLTQLSEGGGNLSVGQRQLMCLARALLVPTKILVLDE 1442

Query: 638  ATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFK 697
            AT+A+DVE++  +  T+      +  TI++IAHRL+TI  S+ ++VL   G V E    +
Sbjct: 1443 ATAAVDVETDKVLQETIRTAFADR--TILTIAHRLNTIMDSDRILVLD-AGRVAEFDTPE 1499

Query: 698  DLYANHDSALHKL 710
            +L  N  +  + L
Sbjct: 1500 NLLKNPGTMFYGL 1512

 Score =  100 bits (250), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 125/516 (24%), Positives = 226/516 (43%), Gaps = 63/516 (12%)

Query: 222 GERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALIC 281
           G  L + L S + KK++    E  D +  GD+++ +  D         Q + D   A  C
Sbjct: 378 GMNLKSALTSVIYKKSLVLSSEAADMSSTGDIVNLMSVDV--------QRLQD--LAQWC 427

Query: 282 GGVGIGMMFHISSTLASVLFLFAPPLLVGATIY------GNKIRAISRELQQAS----GN 331
             +  G  F I   L S+  L    + VG  I        + +  + + LQ+        
Sbjct: 428 HLIWSGP-FQIILCLTSLYKLLGKSMWVGVIILIVMMPLNSSLMRVQKNLQKGQMKNKDQ 486

Query: 332 LTKVAEEQLSGIKTVQSFVAEGK-----EVHRYNNAVRQVFNVGKKEAFTNATFFSSTNV 386
            T++  E L+ +K+++ +  E       E  R    ++ +  +G   A  N  F    N+
Sbjct: 487 RTRLINEILNNMKSLKLYAWEKPYKEKLEYVRNEKELKNLTKIGVYNAIINFQF----NI 542

Query: 387 LGDF---SFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGA 443
           +  F   S   V  Y     L  +L    LT F L +         L+++    ++ + +
Sbjct: 543 VPFFVSCSTFAVFVYTEDRPLTTDLVFPALTLFGLLSFPLAVVPLVLNSY----IEASVS 598

Query: 444 ATRLFELLDYKPTIKSTTGKAFKPLN-GKVEFQ---HVSFSYPTRKTNQI-FKDLNFTIE 498
             RL+  L  +   + +  +  +  N G V  +   + +F +  +   ++  K++NF  +
Sbjct: 599 IGRLYSFLTNEELQRDSVQRLPRVKNIGDVAMKLGDNATFLWKRKPEYKVALKNVNFQAK 658

Query: 499 PGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPI 558
            G   C+VG  G GKS +   LL       G   V G              +  V Q   
Sbjct: 659 KGELNCVVGRVGSGKSALIQSLLGDLFRVKGFATVHGN-------------IAYVSQVAW 705

Query: 559 LMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQ 618
           +M+GT+++NI +G    P   E     K C     ++  P+G +TI+G +G  LSGGQK 
Sbjct: 706 IMNGTVKDNILFGHKYDPEFYE--KTIKACALTIDLAILPDGDKTIVGEKGISLSGGQKA 763

Query: 619 RIAIARALLNKPKILILDEATSALDVE-SEGAINYTLGR--LMKSKELTIISIAHRLSTI 675
           R+++ARA+ ++  I +LD+  +A+D   S   I++ LG   L+K+K  T I   +++S +
Sbjct: 764 RLSLARAVYSRADIFLLDDPLAAVDEHVSTHLIDHVLGPNGLLKTK--TKILATNKISAL 821

Query: 676 RRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLL 711
             +++V +L  +G +++ G F ++    DS L KL+
Sbjct: 822 SIADSVTLLE-NGEIIQQGTFCEITKAADSPLSKLI 856

>Smik_4.380 Chr4 complement(684148..688698) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  132 bits (331), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 137/490 (27%), Positives = 223/490 (45%), Gaps = 47/490 (9%)

Query: 242  MEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGMMFHISSTLASVL- 300
            M F++   +G +L+R   D Y V   + +  S  F         + + F I+   A+   
Sbjct: 1039 MTFFETTPIGRILNRFSNDIYKVDALLGRTFSQFFVN------AVKVTFTITVICATTWQ 1092

Query: 301  FLFAP-PLLVGATIYGNKIRAISRELQQASGNLTKVA-----EEQLSGIKTVQSFVAEGK 354
            F+F   PL V    Y       SREL++   ++T+       +E L G+ TV+ +  + +
Sbjct: 1093 FIFIIIPLGVFYIYYQQYYLRTSRELRRLD-SITRSPIYSHFQETLGGLATVRGYSQQKR 1151

Query: 355  EVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAYGSHLVL---------- 404
              H   N  R   N+        + F+ S N     ++ L L  GS ++L          
Sbjct: 1152 FSHI--NQCRIDNNM--------SAFYPSINANRWLAYRLELI-GSIIILGAATLSVFRL 1200

Query: 405  -QGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKP----TIKS 459
             QG LT G +   + Y       +  +     E+     +  R+ E  D K      I+ 
Sbjct: 1201 KQGTLTSGMVGLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYADLKSEAPLIIEG 1260

Query: 460  TTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASL 519
                   P  G + F + S  Y   + + + K +N  I+P   V IVG +G GKS++   
Sbjct: 1261 HRPPKQWPAQGDIRFNNYSTRYRP-ELDLVLKQINIHIKPNEKVGIVGRTGAGKSSLTLA 1319

Query: 520  LLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSME 579
            L R    + G I++DG  I ++    LR +L ++ Q+  +  GT+RENI      Q S E
Sbjct: 1320 LFRMIEASEGNIVIDGVSINEIGLYDLRHKLSIIPQDSQVFEGTVRENI--DPINQYSDE 1377

Query: 580  EI-RSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEA 638
             I R++         +S   +G +  +   G+ LS GQ+Q + +ARA+L   KIL+LDEA
Sbjct: 1378 AIWRALELSHLKEHVLSMSNDGLDAQLSEGGSNLSVGQRQLLCLARAMLVPSKILVLDEA 1437

Query: 639  TSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKD 698
            T+A+DVE++  +  T+    K +  TI++IAHRL+TI  S+ +IVL  +G V E      
Sbjct: 1438 TAAVDVETDKVVQETIRTAFKDR--TILTIAHRLNTIMDSDRIIVLD-NGKVAEFDTPGQ 1494

Query: 699  LYANHDSALH 708
            L +N  S  +
Sbjct: 1495 LLSNSKSLFY 1504

 Score = 87.8 bits (216), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 64/225 (28%), Positives = 115/225 (51%), Gaps = 21/225 (9%)

Query: 490 FKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQ 549
            K+++F    G+  CIVG  G GK+ + S +L       G   V G              
Sbjct: 647 LKNIDFQATKGNLTCIVGKVGSGKTALLSCMLGDLFRVKGFATVHGC------------- 693

Query: 550 LGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRG 609
           +  V Q P +M+GT++ENI +G   +   E      K C     ++   +G +T++G +G
Sbjct: 694 IAYVSQVPWIMNGTVKENILFG--HKYDAEFYEKTIKACALTIDLAILMDGDKTLVGEKG 751

Query: 610 ALLSGGQKQRIAIARALLNKPKILILDEATSALDVE-SEGAINYTLGR--LMKSKELTII 666
             LSGGQK R+++ARA+ ++    +LD+  +A+D   +   I + LG   L+ +K  T I
Sbjct: 752 ISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTK--TRI 809

Query: 667 SIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLL 711
              +++S +  ++++ +L  +G +++ G + D+  + DS L KLL
Sbjct: 810 LATNKVSALSIADSIALLD-NGEIIQQGAYSDITKDADSPLWKLL 853

>KAFR0I01300 Chr9 complement(262852..267462) [4611 bp, 1536 aa] {ON}
            Anc_4.52 YLL015W
          Length = 1536

 Score =  132 bits (331), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 126/520 (24%), Positives = 242/520 (46%), Gaps = 34/520 (6%)

Query: 212  FGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQN 271
            F  +++L     R    L  ++ K  +   ++F++   +G +++R  +D   V  ++   
Sbjct: 1021 FRTIIMLLYCSIRGSKTLHDSMAKAIIRSPVQFFETTPIGRVINRFSSDIDSVDVNLQNV 1080

Query: 272  ISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAI-SRELQQ--- 327
             S  F++++   + + ++     ++A   FL    L++    Y  K+  + SREL++   
Sbjct: 1081 FSIFFRSILDYILTVILV-----SVAMPWFLLFNALIMIIYFYYEKLYIVQSRELKRLTS 1135

Query: 328  -ASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNV 386
             A   +  +  E L G   + ++     ++ ++ N  R  +N+     F +   + S  +
Sbjct: 1136 IAYSPIISLMSETLGGQMVISAY--NHSKMFKFMNIERVQYNLNVLFTFRSTNRWLSIRL 1193

Query: 387  --LGDFSFLLV-LAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGA 443
              +G F  L   L   + L     +  G +   M Y     SA+  +     ++     +
Sbjct: 1194 QSIGAFIILCTGLLALTTLRTSSPIGSGLIGLLMSYVLQVTSALTWIVRSTVQIETNIVS 1253

Query: 444  ATRLFELLDYKP----TIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEP 499
              R+ E     P     I S   +   P  G +EF++ + +Y     + + K+++ TI P
Sbjct: 1254 VERILEYCHLPPEAEDIIDSNRVERDWPQRGSIEFKNYTTTYRA-NLSPVLKNISVTINP 1312

Query: 500  GSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPIL 559
               V IVG +G GKST++  L R      G I +DG DI+++    LR  + ++ Q+   
Sbjct: 1313 SEKVGIVGRTGAGKSTLSLALFRILEAAEGTIFIDGVDISRIGLTDLRGNMAIIPQDAQA 1372

Query: 560  MSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFP---------NGYETIIGPRGA 610
              GT+R N+     ++ +  E+ +V +       + +           +G +  I   G+
Sbjct: 1373 FEGTVRSNL--DPFQKHTDVELWNVIELSHLKPHVLRMAEDDNLSGNLSGLDAKINENGS 1430

Query: 611  LLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAH 670
             LS GQ+Q + +ARALLN+ K+L+LDEAT+A+DVE++  I  T+    K +  TI++IAH
Sbjct: 1431 NLSVGQRQLLCLARALLNQSKVLVLDEATAAVDVETDKIIQETIRTQFKDR--TILTIAH 1488

Query: 671  RLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
            RL TI  ++ ++VL   G V E    K+L ++  +  ++L
Sbjct: 1489 RLDTIMDNDKILVLD-AGGVKEFDSPKNLLSDESTLFYQL 1527

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 109/462 (23%), Positives = 206/462 (44%), Gaps = 60/462 (12%)

Query: 286 IGMMFHISSTLASVLFLFAPPLLVGATIY----------GNKIRAISRELQQASGNLTKV 335
           IG    I   L S+ FL    ++ G  +             K++ +++   +      K 
Sbjct: 408 IGAPIQIVVVLFSLYFLLGNAIIAGLVMMVIMLPVNSYLSKKVKTLTKTQMKYKDARIKT 467

Query: 336 AEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAF---TNATFFSSTNV--LGDF 390
             E L+ +K+++ +  E   + + ++ VR    +G  +     +N  +F+   V  L   
Sbjct: 468 ITEILNSMKSIKLYAWEKPMMQKLDH-VRNDLEIGNLKKIGIASNLIYFAWNCVPLLVTC 526

Query: 391 SFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFEL 450
           S   +    S   L   L    L+ F +  E    A++ + +  + +++   +  RL + 
Sbjct: 527 STFGIFTLISDEPLTPELVFPALSLFNILNE----AIYAIPSTINTMIEVTVSLNRLKKF 582

Query: 451 LDYKPTIKSTTGKAFKPLN---GKVEFQHVSFSYPTR---------------KTNQI-FK 491
           L  +   +S   +  KP N     VE ++ +F + ++               +T Q+  K
Sbjct: 583 LLSEELDRSFIEQTGKPANEYIPAVEIENATFLWKSQAQLINSENDDSEANIETTQVALK 642

Query: 492 DLN-FTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDIT-KLSSKSLRRQ 549
           +++ FT  P S  C++G  G GK+T+   +L      SG      + I+ KLS +     
Sbjct: 643 NIDHFTASPKSLTCVIGKVGSGKTTLLKAILGQLPCISGS----KESISPKLSIRG--ES 696

Query: 550 LGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRG 609
           +    QE  +M+ TI+ENI +G     +   +   A  C   A     P+G +T++G +G
Sbjct: 697 IAYCPQEAWIMNDTIKENILFGHKFDETYYTLTVAA--CELLADFDILPDGDQTLVGEKG 754

Query: 610 ALLSGGQKQRIAIARALLNKPKILILDEATSALDVE-----SEGAINYTLGRLMKSKELT 664
             LSGGQK R+++ARA+ ++  I +LD+  SA+D        E  ++   G L+++K  T
Sbjct: 755 ISLSGGQKARVSLARAVYSRADIYLLDDILSAVDAGVSKKIVENVLDSNSG-LLRNK--T 811

Query: 665 IISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLY--ANHD 704
           +I   + +S ++ S+ +  L  +G +VE G + D+   AN D
Sbjct: 812 VILSTNTVSVLKHSQLIYALE-NGIIVERGNYNDIIESANSD 852

>YGR281W Chr7 (1052824..1057257) [4434 bp, 1477 aa] {ON}  YOR1Plasma
            membrane ATP-binding cassette (ABC) transporter,
            multidrug transporter mediates export of many different
            organic anions including oligomycin; similar to human
            cystic fibrosis transmembrane receptor (CFTR)
          Length = 1477

 Score =  131 bits (330), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 138/535 (25%), Positives = 245/535 (45%), Gaps = 56/535 (10%)

Query: 213  GRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNI 272
            G+  +L  +G      L    +K+ +H  M + D   +G +L+R   D   +   +T+++
Sbjct: 951  GQFTILCAMGIMASKWLNLRAVKRILHTPMSYIDTTPLGRILNRFTKDTDSLDNELTESL 1010

Query: 273  ---SDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISR-ELQQA 328
               +  F  ++  GV +  + ++     ++ FL    +L+ A  Y +  R I R E  Q 
Sbjct: 1011 RLMTSQFANIV--GVCVMCIVYLPWFAIAIPFLLVIFVLI-ADHYQSSGREIKRLEAVQR 1067

Query: 329  S---GNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTN 385
            S    NL +V    L G+ T++++ ++ + + + +  + ++   G    +          
Sbjct: 1068 SFVYNNLNEV----LGGMDTIKAYRSQERFLAKSDFLINKMNEAG----YLVVVLQRWVG 1119

Query: 386  VLGD-----FSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKG 440
            +  D     F+ ++ L   +        ++G L  ++L      + +    T     M  
Sbjct: 1120 IFLDMVAIAFALIITLLCVTRAFPISAASVGVLLTYVLQLPGLLNTILRAMTQTENDMNS 1179

Query: 441  A----GAATRL-FELLDYKPTIKSTTGKAFKPLNGKVEFQHVSFSY-PTRKTNQIFKDLN 494
            A      AT L  E    KP +   T     P  G++ F++V F+Y P      + K+LN
Sbjct: 1180 AERLVTYATELPLEASYRKPEM---TPPESWPSMGEIIFENVDFAYRPGLPI--VLKNLN 1234

Query: 495  FTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQ 554
              I+ G  + I G +G GKSTI S L R    T+GKIL+D  DI++L    LRR+L ++ 
Sbjct: 1235 LNIKSGEKIGICGRTGAGKSTIMSALYRLNELTAGKILIDNVDISQLGLFDLRRKLAIIP 1294

Query: 555  QEPILMSGTIREN----------------ITYGVSRQPSMEEIR-SVAKKCFCHAFISKF 597
            Q+P+L  GTIR+N                +  G   +  + E++     +   H  + KF
Sbjct: 1295 QDPVLFRGTIRKNLDPFNERTDDELWDALVRGGAIAKDDLPEVKLQKPDENGTHGKMHKF 1354

Query: 598  PNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRL 657
                +  +   G+  S G++Q +A+ RAL+ + KILILDEATS++D E++G I   +  +
Sbjct: 1355 --HLDQAVEEEGSNFSLGERQLLALTRALVRQSKILILDEATSSVDYETDGKIQTRI--V 1410

Query: 658  MKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLLT 712
             +  + TI+ IAHRL TI   + ++VL   G V E      L++  DS    + +
Sbjct: 1411 EEFGDCTILCIAHRLKTIVNYDRILVLE-KGEVAEFDTPWTLFSQEDSIFRSMCS 1464

 Score =  101 bits (251), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 75/223 (33%), Positives = 117/223 (52%), Gaps = 22/223 (9%)

Query: 490 FKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQ 549
           FKDLNF I+ G  + I GP G GKS++ + +      T GK+ V+G D+           
Sbjct: 604 FKDLNFDIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKVEVNG-DL----------- 651

Query: 550 LGVVQQEPILMSGTIRENITYGVSRQP-SMEEIRSVAKKCFCHAFISKFPNGYETIIGPR 608
             ++   P + + ++R+NI +G    P + E+   V + C   A +   P G  T IG R
Sbjct: 652 --LMCGYPWIQNASVRDNIIFG---SPFNKEKYDEVVRVCSLKADLDILPAGDMTEIGER 706

Query: 609 GALLSGGQKQRIAIARALLNKPKILILDEATSALDVE-SEGAINYTLGRLMKSKELTIIS 667
           G  LSGGQK RI +AR++  K  I + D+  SA+D    +  ++  L  ++ +K  T I 
Sbjct: 707 GITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLTGMLANK--TRIL 764

Query: 668 IAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
             H+LS I R+  VIVLG DG  V++G   +L A + + ++ L
Sbjct: 765 ATHQLSLIERASRVIVLGTDGQ-VDIGTVDELKARNQTLINLL 806

>Suva_2.297 Chr2 complement(518369..522919) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  131 bits (330), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 132/489 (26%), Positives = 223/489 (45%), Gaps = 41/489 (8%)

Query: 242  MEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGMMFHISSTLASVLF 301
            M F++   +G +L+R   D Y V   + +  S  F   +     I +   I  T    +F
Sbjct: 1039 MTFFETTPIGRILNRFSNDIYKVDALLGRTFSQFFVNAVKVTFTITV---ICVTTWQFIF 1095

Query: 302  LFAPPLLVGATIYGNKIRAISRELQQASGNLTKVA-----EEQLSGIKTVQSFVAEGKEV 356
            +  P L V    Y       SREL++   ++T+       +E L G+ TV+ +  + +  
Sbjct: 1096 IIVP-LGVFYIYYQQYYLRTSRELRRLD-SITRSPIYSHFQETLGGLATVRGYSQQKRFS 1153

Query: 357  HRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAYGSHLVL-----------Q 405
            H   N  R   N+        + F+ S N     ++ L L  GS ++L           Q
Sbjct: 1154 HI--NQCRIDNNM--------SAFYPSVNANRWLAYRLELI-GSVIILGAATLSVFRLKQ 1202

Query: 406  GNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKP----TIKSTT 461
            G LT G +   + Y       +  +     E+     +  R+ E  D K      I+   
Sbjct: 1203 GTLTAGMVGLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYADIKSEAPLVIEGHR 1262

Query: 462  GKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLL 521
                 P  G ++F   S  Y   + + + K ++  I+P   + IVG +G GKS++   L 
Sbjct: 1263 PPKEWPGQGDIKFNQYSTRYRP-ELDLVLKQIDIHIKPKEKIGIVGRTGAGKSSLTLALF 1321

Query: 522  RYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEI 581
            R    ++G I++DG  I ++    LR +L ++ Q+  +  GT+RENI   +++       
Sbjct: 1322 RIIEASAGNIVIDGIPINEIGLYDLRHKLSIIPQDSQVFEGTVRENID-PINQYTDEAMW 1380

Query: 582  RSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSA 641
            R++         +S   +G ++ +   G+ LS GQ+Q + +ARA+L + KIL+LDEAT+A
Sbjct: 1381 RALELSHLKEHILSMSNDGLDSQLTEGGSNLSVGQRQLLCLARAMLVQSKILVLDEATAA 1440

Query: 642  LDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYA 701
            +DVE++  I  T+    K +  TI++IAHRL+TI  S+ +IVL  +G V E      L  
Sbjct: 1441 VDVETDKVIQETIRTAFKDR--TILTIAHRLNTIMDSDRIIVLD-NGKVAEFDSPAQLLT 1497

Query: 702  NHDSALHKL 710
            N  S  + L
Sbjct: 1498 NTKSLFYSL 1506

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 62/226 (27%), Positives = 117/226 (51%), Gaps = 23/226 (10%)

Query: 490 FKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKIL-VDGQDITKLSSKSLRR 548
            K++NF  + G   C+VG  G GK+ + S        T G +  V G         S+  
Sbjct: 647 LKNINFQAKKGELTCVVGKVGSGKTALLS-------STLGDLFRVKG-------FASVHG 692

Query: 549 QLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPR 608
            +  V Q P +M+GT++ENI +G   +   E      K C     ++   +G +T++G +
Sbjct: 693 SVAYVSQVPWIMNGTVKENILFG--HKYDAEFYEKTIKACALTIDLAILMDGDQTLVGEK 750

Query: 609 GALLSGGQKQRIAIARALLNKPKILILDEATSALDVE-SEGAINYTLGR--LMKSKELTI 665
           G  LSGGQK R+++ARA+ ++    +LD+  +A+D   +   + + LG   L+ +K  T 
Sbjct: 751 GISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLVEHVLGSNGLLHTK--TK 808

Query: 666 ISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLL 711
           +   +++S +  ++++ +L  +G +++ G + D+  + DS L KL+
Sbjct: 809 LLATNKVSALSVADSIALLD-NGEIIQQGTYDDITKDADSPLWKLI 853

>Skud_12.22 Chr12 complement(31933..36918) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  130 bits (328), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 132/526 (25%), Positives = 234/526 (44%), Gaps = 80/526 (15%)

Query: 233  VIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALI-CGGVGIGMMFH 291
            ++ K +H  + F+D    G +++R   D   + + +T  I   F +LI C    I + F 
Sbjct: 1141 ILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILITFI 1200

Query: 292  ISSTLA-----SVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEEQLSGIKTV 346
                L+     S+L+ F     +  +    +  +ISR        + +   E L G+ T+
Sbjct: 1201 TPQFLSIAIVVSILYYFVGYFYMAGSRELKRFESISR------SPIYQHFSETLVGVTTI 1254

Query: 347  QSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLV----LAYGSHL 402
            ++F  EG+ +           N+ K +   N  FF          +L V    LA+   +
Sbjct: 1255 RAFGDEGRFMQE---------NLQKIDE-NNKPFF----------YLWVANRWLAFRIDM 1294

Query: 403  VLQGNLTIGDLTAFMLYT-EYTGSAVFGLSTFYS-ELMKGAGAATRLFELLDYKPTIKST 460
            +  G+L I     F+L+  ++  S + G+S  Y+    +GA    RL+  ++        
Sbjct: 1295 I--GSLVIFGAGLFILFNIDHIDSGMAGISLTYAISFTEGALWLVRLYSEVEMNMNSVER 1352

Query: 461  TGKAFK-----------------PLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNV 503
              +  K                 P +GK+E   +S  Y      ++  +++F+++  S +
Sbjct: 1353 VKEYMKIEQEPYNQHKEVPPSQWPQDGKIEVNDLSLRYAP-NLPRVINNVSFSVDAQSKI 1411

Query: 504  CIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGT 563
             IVG +G GKSTI + L R+  P +G I +D  DI+ +  + LRR + ++ Q+P L SGT
Sbjct: 1412 GIVGRTGAGKSTIITALFRFLEPETGHIKIDNIDISGVDLQRLRRSITIIPQDPTLFSGT 1471

Query: 564  IRENIT-YG-VSRQPSMEEIRSV--------AKKCFCHAFISKFPNGYETI--------- 604
            I+ N+  Y   S +   E ++ V         +     A      N  E I         
Sbjct: 1472 IKTNLDPYDEFSDKKIFEALKRVNLISEEQSHQGAVREADNDTSSNSSENINKFLDLSSE 1531

Query: 605  IGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELT 664
            +   G+ LS GQ+Q + +AR+LL  PKI++LDEAT+++D  S+  I  T+ +  +    T
Sbjct: 1532 VSEGGSNLSQGQRQLMCLARSLLRSPKIILLDEATASIDYSSDAKIQETIRKEFQGS--T 1589

Query: 665  IISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
            I++IAHRL ++   + ++V+   G V E      L  N  S  + +
Sbjct: 1590 ILTIAHRLRSVIDYDKILVMD-AGEVKEYDHPYSLLLNKQSIFYSM 1634

 Score = 90.5 bits (223), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 114/480 (23%), Positives = 215/480 (44%), Gaps = 32/480 (6%)

Query: 235 KKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGMMFHISS 294
           +K+++ D E      +G +++ +  DA+ VS  +   +    +A +   V + +++H+  
Sbjct: 460 QKSINGDEESTSSANLGAIINLMAIDAFKVSE-ICGYLHSFLEAFVMTVVALALLYHLLG 518

Query: 295 TLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEEQLSGIKTVQSFVAEG- 353
             A V  L    +L         I  + ++    + N  +   E    I+ ++ F  E  
Sbjct: 519 FAAIVGVLIIVAMLPLNYKLAKYIGDLQKKNLAVTDNRIQKLNEAFQAIRIIKYFSWEEN 578

Query: 354 --KEVHRY-NNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAYGSHLVLQGNL-- 408
             KE++    N +  +       + ++  +F +  ++   SF    AY  ++ +QG +  
Sbjct: 579 FEKEINTIRENELSLLLMRSIIWSISSFVWFVTPTIVTAASF----AY--YIYVQGEVLT 632

Query: 409 TIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIKSTTGKAFKPL 468
           T    TA  L+T      +  LS   S +++   +  R+ + L+ K T K        P 
Sbjct: 633 TPVAFTALSLFT-LLRDPLDRLSDMLSFVVQSKVSLDRVQDFLNEKDT-KKYDQLTIDPN 690

Query: 469 NGKVEFQHVSFSYPTRKTNQIFK--DLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNP 526
             +   ++ + S+   K NQ FK  DLN   + G    ++GP+G GK+++   LL     
Sbjct: 691 GKRFALENSTISWD--KDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYL 748

Query: 527 TSGKILVDG----QDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSME-EI 581
            +GKI+V      Q++  + +      +    Q   L++ TI+ NI +     P  E   
Sbjct: 749 LNGKIVVPALEPRQELV-VDANGTTNSIAYCSQGAWLLNDTIKHNILFN---SPFNEARY 804

Query: 582 RSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSA 641
           ++V + C           G  T IG +G  LSGGQKQR+++ARAL +  + ++LD+  SA
Sbjct: 805 KAVVEACGLKRDFEILKAGDLTEIGEKGIALSGGQKQRVSLARALYSNARHVLLDDCLSA 864

Query: 642 LDVESEGAI--NYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDL 699
           +D  +   I  N   G LM+ +  T I ++H ++   R+  ++VL  DG + + G   D+
Sbjct: 865 VDSHTASWIYDNCITGPLMEDR--TCILVSHNIALTLRNAELVVLLEDGRIKDQGDPIDM 922

>Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  130 bits (328), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 128/544 (23%), Positives = 243/544 (44%), Gaps = 76/544 (13%)

Query: 213  GRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNI 272
            G+ +L  + G     ++ + ++ K +H  + F+D    G +++R   D   + + +T  I
Sbjct: 1121 GKTILNFVAGINASRKIFNMILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYI 1180

Query: 273  SDGFKALI-CGGVGIGMMFHISSTLA-----SVLFLFAPPLLVGATIYGNKIRAISRELQ 326
               F +LI C    I + F     L+     S+L+ F     +  +    +  +ISR   
Sbjct: 1181 QGAFYSLIECLSTVILITFITPQFLSVAIVVSILYYFVGYFYMAGSRELKRFESISR--- 1237

Query: 327  QASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAF----TNATFFS 382
                 + +   E L G+ T+++F  EG    R+     Q  +   K  F     N     
Sbjct: 1238 ---SPIYQHFSETLVGVTTIRAFGDEG----RFMQENLQKIDENNKPFFYLWVANRWLAF 1290

Query: 383  STNVLGDFSFLLVLAYGSHLVLQGNLTIGD-------LTAFMLYTEYTGSAVFGLSTFYS 435
              +++G      ++ +G+ L +  N+   D       LT  + +TE        L   Y+
Sbjct: 1291 RIDMIGS-----LVIFGAGLFILFNINHLDSGMAGISLTYAISFTE----GALWLVRLYA 1341

Query: 436  ELMKGAGAATRLFELLDYKPTIKSTTGKA---FKPLNGKVEFQHVSFSYPTRKTNQIFKD 492
            E+     +  R+ E ++ +    +   +      P +GK+E   +S  Y      ++ K+
Sbjct: 1342 EVEMNMNSVERVKEYMEIEQEPYNQHKEVPPPQWPQDGKIEVNDLSLRYAP-NLPRVIKN 1400

Query: 493  LNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGV 552
            ++F+++  S + IVG +G GKSTI + L R+  P +G I +D  DI+ +  + LRR + +
Sbjct: 1401 VSFSVDAQSKIGIVGRTGAGKSTIITALFRFLEPETGHIKIDNIDISGVDLQRLRRSITI 1460

Query: 553  VQQEPILMSGTIRENI--------------------------TYGVSRQPSMEEIRSVAK 586
            + Q+P L SGTI+ N+                            G +R+   +   + ++
Sbjct: 1461 IPQDPTLFSGTIKTNLDPYDEFSDRKIFEALKRVNLISEEQSQQGTTREADNDNSSTNSE 1520

Query: 587  KCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVES 646
                   ++KF +   + +   G+ LS GQ+Q + +AR+LL  PKI++LDEAT+++D  S
Sbjct: 1521 N------VNKFLD-LSSEVSEGGSNLSQGQRQLMCLARSLLRSPKIILLDEATASIDYGS 1573

Query: 647  EGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSA 706
            +  I  T+ +  +    TI++IAHRL ++   + ++V+   G V E      L  N  S 
Sbjct: 1574 DAKIQETIRKEFQGS--TILTIAHRLRSVIDYDKILVMD-AGEVKEYDHPYSLLLNKQSI 1630

Query: 707  LHKL 710
             + +
Sbjct: 1631 FYSM 1634

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 112/487 (22%), Positives = 213/487 (43%), Gaps = 46/487 (9%)

Query: 235 KKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGMMFHISS 294
           +K+++ D E      +G +++ +  DA+ VS  +   +    +A +   V + +++ +  
Sbjct: 460 QKSINGDEESTSSANLGAIINLMAIDAFKVSE-ICGYLHSFLEAFVMTVVALVLLYRLLG 518

Query: 295 TLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEEQLSGIKTVQSFVAEGK 354
             A V  L    +L         I  + ++    + N  +   E    I+ ++ F  E +
Sbjct: 519 FAAIVGVLIIVAMLPLNYKLAKYIGDLQKKNLAVTDNRIQKLNEAFQAIRIIKYFSWE-E 577

Query: 355 EVHRYNNAVRQ-----------VFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAYGSHLV 403
              +  NA+R+           V+++     F   T  ++             ++  ++ 
Sbjct: 578 NFEKDINAIRENELSLLLMRSIVWSISSFVWFVTPTIVTAA------------SFAYYIY 625

Query: 404 LQGNL--TIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIKSTT 461
           +QG +  T    TA  L+T      +  LS   S +++   +  R+ + L+ K T K   
Sbjct: 626 VQGEVLTTPVAFTALSLFT-LLRDPLDRLSDMLSFVVQSKVSLDRVQDFLNEKDT-KKYD 683

Query: 462 GKAFKPLNGKVEFQHVSFSYPTRKTNQIFK--DLNFTIEPGSNVCIVGPSGRGKSTIASL 519
                P   +  F++ + S+   K NQ FK  DLN   + G    ++GP+G GK+++   
Sbjct: 684 QLTIDPNGKRFAFENSTISWD--KDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMA 741

Query: 520 LLRYYNPTSGKILVDG----QDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQ 575
           LL      SGK++V      Q++  + +      +    Q   L++ T++ NI +     
Sbjct: 742 LLGEMYLLSGKVVVPALEPRQELV-VDANGTTNAIAYCSQGAWLLNDTVKNNILFN---S 797

Query: 576 PSME-EIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILI 634
           P  E   ++V + C           G  T IG +G  LSGGQKQR+++ARAL +  + ++
Sbjct: 798 PFNEARYKAVVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVL 857

Query: 635 LDEATSALDVESEGAI--NYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVE 692
           LD+  SA+D  +   I  N   G LM+ +  T I ++H ++   R+  ++VL  DG V +
Sbjct: 858 LDDCLSAVDSHTASWIYDNCITGPLMEDR--TCILVSHNIALTLRNAELVVLLEDGRVKD 915

Query: 693 MGKFKDL 699
            G   D+
Sbjct: 916 QGDPIDM 922

>Smik_16.27 Chr16 complement(40287..44720) [4434 bp, 1477 aa] {ON}
            YGR281W (REAL)
          Length = 1477

 Score =  130 bits (327), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 136/535 (25%), Positives = 245/535 (45%), Gaps = 56/535 (10%)

Query: 213  GRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNI 272
            G+  +L  +G      L    +++ +H  M + D   +G +L+R   D   +   +T+++
Sbjct: 951  GQFTILCAMGIMASKCLNLRAVRRILHTPMSYIDTTPLGRILNRFTKDTDSLDNELTESL 1010

Query: 273  ---SDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISR-ELQQA 328
               +  F  ++  GV +  + ++     ++ FL    +L+ A  Y +  R I R E  Q 
Sbjct: 1011 RLMTSQFANIV--GVCVMCIVYLPWFAIAIPFLLVVFVLI-ADHYQSSGREIKRLEAVQR 1067

Query: 329  S---GNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTN 385
            S    NL +V    L G+ T++++ ++ + + + +  + ++   G    +          
Sbjct: 1068 SFVYNNLNEV----LGGMDTIKAYRSQERFLAKSDFLINKMNEAG----YLVVVLQRWVG 1119

Query: 386  VLGD-----FSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKG 440
            +  D     F+ ++ L   +        ++G L  ++L      + +    T     M  
Sbjct: 1120 IFLDMVAIAFALIITLLCVTRAFPISAASVGVLLTYVLQLPGLLNTILRAMTQTENDMNS 1179

Query: 441  A----GAATRLFELLDY-KPTIKSTTGKAFKPLNGKVEFQHVSFSY-PTRKTNQIFKDLN 494
            A      AT+L    DY KP +   T     P  GK+ F++V F+Y P      + K+ N
Sbjct: 1180 AERLVSYATKLPLEADYRKPEM---TPPESWPSKGKIVFENVDFAYRPGLPI--VLKNFN 1234

Query: 495  FTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQ 554
              I+ G  + I G +G GKSTI S L R    T+G+I +D  DI++L    LR++L ++ 
Sbjct: 1235 LDIKSGEKIGICGRTGAGKSTIMSALYRLNELTAGQIFIDDVDISQLGLFDLRKKLAIIP 1294

Query: 555  QEPILMSGTIREN----------------ITYGVSRQPSMEEIR-SVAKKCFCHAFISKF 597
            Q+P+L  GTIR+N                +  G   +  + E+R     +   H  + KF
Sbjct: 1295 QDPVLFRGTIRKNLDPFDERTDDELWDALVRGGAIAKNDLPEVRLQKPDENGTHGRMHKF 1354

Query: 598  PNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRL 657
                +  +   G+  S G++Q +A+ RAL+ + KILILDEATS++D E++G I   +  +
Sbjct: 1355 --HLDQAVEEEGSNFSLGERQLLALTRALVRQSKILILDEATSSVDYETDGKIQTRI--V 1410

Query: 658  MKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLLT 712
             +  + TI+ IAHRL TI   + ++VL   G V E      L++  DS    + +
Sbjct: 1411 EEFGDCTILCIAHRLKTIVNYDRILVLE-KGEVAEYDTPWALFSQEDSIFKSMCS 1464

 Score =  100 bits (249), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 76/223 (34%), Positives = 116/223 (52%), Gaps = 22/223 (9%)

Query: 490 FKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQ 549
           FKDLNF I+ G  + I GP G GKS++ + +        GKI V+G D+           
Sbjct: 604 FKDLNFDIQKGEFIMITGPIGTGKSSLLNAMAGSMRKVDGKIEVNG-DL----------- 651

Query: 550 LGVVQQEPILMSGTIRENITYGVSRQP-SMEEIRSVAKKCFCHAFISKFPNGYETIIGPR 608
             ++   P + + T+R+NI +G    P + E+   V   C   A +   P G  T IG R
Sbjct: 652 --LMCGYPWIQNATVRDNIIFG---SPFNKEKYDEVIHVCSLKADLDILPAGDMTEIGER 706

Query: 609 GALLSGGQKQRIAIARALLNKPKILILDEATSALDVE-SEGAINYTLGRLMKSKELTIIS 667
           G  LSGGQK RI +AR++  K  I + D+  SA+D    +  ++  L  ++ +K  T I 
Sbjct: 707 GITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLTGMLSNK--TRIL 764

Query: 668 IAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
             H+LS I R+  VIVLG DG  V++G  ++L A + + ++ L
Sbjct: 765 ATHQLSLIERASRVIVLGTDGK-VDIGTVEELKARNKTLINLL 806

>TPHA0K02310 Chr11 (497267..502216) [4950 bp, 1649 aa] {ON} Anc_4.6
            YHL035C
          Length = 1649

 Score =  130 bits (327), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 116/483 (24%), Positives = 222/483 (45%), Gaps = 49/483 (10%)

Query: 233  VIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGMMFHI 292
            ++ + ++  + F+D   +G +++R   D  ++   +   +   F   I     + ++  I
Sbjct: 1139 LLYRVVNSKLTFFDNTPIGRIMNRFSKDIQVLDSELAPFLDGVFSCFIQAVTALMLIVFI 1198

Query: 293  S-STLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEEQLSGIKTVQSFVA 351
            +   L   +F+    + +G  +Y    R + R    +   + +   E LSG+ T+++F  
Sbjct: 1199 TPKFLIIAIFIICSSITIGY-LYLCCSRELKRFESSSKSPVYQHFTETLSGLVTIRAFGN 1257

Query: 352  EGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSF-------LLVLAYGSHLVL 404
            E K +    + + +           N  FF   +V    SF       + V   G+ ++L
Sbjct: 1258 EIKFLKENLDFIDE----------NNKFFFYMWSVNSWLSFRIDLLGAITVFGSGAFILL 1307

Query: 405  QGN-----LTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIKS 459
              +     L    LT  + +TE+       +  FYS +     +  RL E ++ +    +
Sbjct: 1308 NADKIDAGLAGISLTYAVTFTEFC----LWMVKFYSTVEMSMNSVERLKEYMEIEEEALA 1363

Query: 460  TTGKAF----KPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKST 515
              G        P+ G + F + S  Y   K   + K LN  I+ GS + +VG +G GKST
Sbjct: 1364 DPGAITPSENWPVQGAITFANYSLRYAP-KLPDVLKQLNLKIDGGSKIGVVGRTGAGKST 1422

Query: 516  IASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQ 575
            I S L R+ + +SGKIL+D  DI++++ + LR  L ++ Q+P L  GTIR N+      +
Sbjct: 1423 IISALFRFLDCSSGKILIDDLDISEINLRRLRSCLTIIPQDPSLFVGTIRSNLDPNEEYE 1482

Query: 576  -----PSMEEIRSVAKKCFCH---------AFISKFPNGYETIIGPRGALLSGGQKQRIA 621
                  ++ ++  + +    +         A+        ++ I   G  LS GQ+Q I 
Sbjct: 1483 NKDIYDALVKVHLLTEDYLANLNYDANADVAYDENIFLNLDSPISEGGINLSQGQRQLIC 1542

Query: 622  IARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENV 681
            +AR++L+  KI++LDEAT+++D +S+  +  T+      K  TI++IAHR+ ++   + +
Sbjct: 1543 LARSILHCSKIVLLDEATASIDYKSDFKVQETIRNEFSQK--TILTIAHRIKSVIDYDKI 1600

Query: 682  IVL 684
            +VL
Sbjct: 1601 LVL 1603

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 119/474 (25%), Positives = 212/474 (44%), Gaps = 52/474 (10%)

Query: 251 GDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGMMFHISSTLA----SVLFLFAPP 306
           G +++ +  DA  V   +   +    +ALI   V + +++ I  T A    +V+  F P 
Sbjct: 496 GGIINLMATDAIKVGE-LCNYLHSSIEALIMAVVAVILLYRILGTAAFIGTAVIIFFIP- 553

Query: 307 LLVGATIYGNKIRA-ISRELQQASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQ 365
                 ++  K+ A   RE    +    +   E    I+ ++SF  E       NN +++
Sbjct: 554 ----FNVFLTKLIARFQRETLTFTDQRIQNLNETFQSIRIIKSFGWE-------NNIIQK 602

Query: 366 VFNVGKKE--AFTNATFFSSTNVLGDF---SFLLVLAYGSHLVLQGNLTIGDLTAFMLYT 420
           +  +  KE       +   S N L  +   + +  L++  ++++       DLT      
Sbjct: 603 ILGLRNKEISVLKRNSITWSINALVWYLSPTIITTLSFSYYILVDKQ----DLTT---PV 655

Query: 421 EYTGSAVFGL--------STFYSELMKGAGAATRLFELLDYKPTIKSTTGKAFKPLNGKV 472
            +T  A+F L        S   + L +   +  R+ + L  K T K          N ++
Sbjct: 656 AFTALALFNLLKAPLDQLSNTINFLTQSKVSLDRIEKFLSVKETTKFENLSVDSSQN-RL 714

Query: 473 EFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKIL 532
            F   +  +   K +   +++N   E G    ++GP+G GK+++   LL   +  SGK+ 
Sbjct: 715 AFSGATLGWCGNKKSFQLRNINAEFEMGKLNLVIGPTGSGKTSLLMALLGELHLFSGKVF 774

Query: 533 VDGQDITKLS----SKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKC 588
           V   + +K +    S +L   +    Q P + + TIR NI + +       E  +V   C
Sbjct: 775 VPNLE-SKFNLIPESDNLLNSIAYCSQLPWIFNDTIRNNIIFDMGYDKDRYE--NVVIAC 831

Query: 589 FCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEG 648
                      G +TI+G +G+ LSGGQKQRI++ARAL +K + LILD+  SA+D  S  
Sbjct: 832 GLERDFQILNLGDKTIVGDKGSCLSGGQKQRISLARALYSKSRHLILDDCLSAVDSHSAK 891

Query: 649 AI-NYTL-GRLMKSKELTIISIAHRLS-TIRRSENVIVLGIDGSVVEMGKFKDL 699
            I N  + G LM+ +  T I ++H +S TI+++  V ++  +G +V  G+  DL
Sbjct: 892 WIYNVCITGPLMQGR--TCILVSHNVSLTIKKASKVFMIE-NGYIVASGRPIDL 942

>KLTH0G12716g Chr7 (1080818..1085320) [4503 bp, 1500 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1500

 Score =  130 bits (326), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 141/517 (27%), Positives = 235/517 (45%), Gaps = 48/517 (9%)

Query: 216  VLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDG 275
            V   I G R +  + ++ + K     M F++   +G +L+R   D + V   + +  +  
Sbjct: 1001 VYCTIHGSRYLHNIMADAVFKA---PMSFFETTPIGRILNRFSNDIFKVDELLGRTFAQF 1057

Query: 276  FKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQ----ASGN 331
            F   I   V   ++    ST   +L +   P+      Y       SREL++        
Sbjct: 1058 FVNAI--KVSFTIIVICFSTWQFILVIL--PMGTLYIYYQQYYLRTSRELRRLDSVTRSP 1113

Query: 332  LTKVAEEQLSGIKTVQSFVAEGKEVH----RYNNAVRQVF---NVGKKEAFTNATFFSST 384
            +    +E L GI T++ +  + + VH    R +N +   +   N  +  AF    F  S 
Sbjct: 1114 IYAHFQETLGGISTIRGYNQQKRFVHINQARVDNNMSAYYPSVNANRWLAF-RLEFIGS- 1171

Query: 385  NVLGDFSFLLVLAYGSHLVL---QGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGA 441
                    +++LA  S  VL   QG LT G +   + Y      ++  +     E+    
Sbjct: 1172 --------VIILAASSLSVLRLKQGALTPGMIGLSVSYALQITQSLNWIVRMTVEVETNI 1223

Query: 442  GAATRLFELLDYK----PTIKSTTGKAFKPLNGKVEFQHVSFSY-PTRKTNQIFKDLNFT 496
             +  R+ E  + +      I+S       P  G ++F++ S  Y P  + +   KD+N  
Sbjct: 1224 VSVERIKEYANLESEAPAVIESNRPSEDWPSQGSIKFENYSARYRPELELS--LKDINLD 1281

Query: 497  IEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQE 556
            I+P   + IVG +G GKS++   L R     SG+I +DG  I  +  + LR  L ++ Q+
Sbjct: 1282 IKPQERIGIVGRTGAGKSSLTLALFRIIEAASGRIYIDGLPIDSIGLRDLRHHLSIIPQD 1341

Query: 557  PILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPR---GALLS 613
              L  GTIRENI    + + + E+I    +       +     G E +  P    G+ LS
Sbjct: 1342 SQLFEGTIRENI--DPTNEYTDEQIWRALELSHLKDHVKGL--GKEELDAPLTEGGSNLS 1397

Query: 614  GGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLS 673
             GQ+Q + +ARALL   KIL+LDEAT+A+DVE++  I  T+    K++  TI++IAHR++
Sbjct: 1398 VGQRQLMCLARALLIPSKILVLDEATAAVDVETDQVIQETIRTAFKNR--TILTIAHRIN 1455

Query: 674  TIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
            TI  S+ ++VL   G V E     +L  N +S  + L
Sbjct: 1456 TILDSDRILVLD-SGKVAEFDTPDNLLKNPESLFYSL 1491

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 59/233 (25%), Positives = 113/233 (48%), Gaps = 35/233 (15%)

Query: 490 FKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQ 549
            K++NF  + G   C+VG  G GKS +   +L       G   V G              
Sbjct: 636 LKNINFAAKKGKLTCVVGKVGSGKSALIQAILGDLFRVKGFASVHGS------------- 682

Query: 550 LGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRG 609
           +  V Q P +M+GT+++NI +G     S   +    K C     ++  P G +T++G +G
Sbjct: 683 IAYVSQVPWIMNGTVKDNILFGHKYDESFYTM--TLKACALIVDLAVLPKGDQTLVGEKG 740

Query: 610 ALLSGGQKQRIAIARALLNKPKILILDEATSALDVE-SEGAINYTLG---------RLMK 659
             LSGGQK R+++ARA+  +    +LD+  +A+D   ++  + + LG         +++ 
Sbjct: 741 ISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVTKHLVEHVLGPNGLLASKTKVLA 800

Query: 660 SKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLLT 712
           + ++T++SIA  ++ +           +G +++ G + D+ +   SAL K+++
Sbjct: 801 TNKITVLSIADHIALLE----------NGEIIQQGSYDDVTSAKSSALSKIIS 843

>TPHA0F00180 Chr6 complement(23050..27990) [4941 bp, 1646 aa] {ON}
            Anc_4.6 YHL035C
          Length = 1646

 Score =  129 bits (324), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 121/505 (23%), Positives = 236/505 (46%), Gaps = 46/505 (9%)

Query: 233  VIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGMMFHI 292
            ++ K +H  + F+D   +G +++R   D   + + +T  +       +     + ++ +I
Sbjct: 1136 LLSKVLHSKLRFFDSTPIGRIMNRFSKDIEAIDQELTPYVESVVYNSVQLIATVLLITYI 1195

Query: 293  SSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEEQLSGIKTVQSFVAE 352
            ++    V  L           Y +  R + R        + +   E L G+ T++++   
Sbjct: 1196 TNGFIVVALLVILLYYFVGVYYLSGSRELKRFESTTKSPIYQHFSETLVGVTTIRAY--- 1252

Query: 353  GKEVHRYNNAVRQVFNVGKKEAF----TNATFFSSTNVLGDFSFLLVLAYGSHLVLQGNL 408
            G E+      + ++ +   K  F     N       +++G    L++   G  +++  N 
Sbjct: 1253 GDEIRFMKENLTKI-DENNKPFFYLWVANRWLCFRIDIIGS---LVIFGAGVLVLMNINK 1308

Query: 409  TIGDLTAFMLY--TEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIKST----TG 462
                L    L     +T SA++ + + YS +     +  R+ E +D +    S       
Sbjct: 1309 IDSGLAGISLTYAITFTESALWLVRS-YSNVEINMNSVERVKEYMDIEQEPYSAGIVNVD 1367

Query: 463  KAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLR 522
            K++ P  GK+E   +S  Y      ++ K+++FT+EP   V +VG +G GKSTI + L R
Sbjct: 1368 KSW-PSEGKIEVNDLSLRYAP-SLPKVIKNVSFTVEPKMKVGVVGRTGAGKSTIITALFR 1425

Query: 523  YYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENI----------TYGV 572
            + +P +G I +D  DIT +  K LR+ + ++ Q+P L +GTI+ N+           +  
Sbjct: 1426 FLDPETGYIKIDNIDITTIDLKKLRKSITIIPQDPTLFTGTIKSNLDPYNEYNDDQIFKA 1485

Query: 573  SRQPSM-------EEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARA 625
             R+ ++        ++ SV+ +      ++KF N  ++ I   G+ LS GQ+Q + +AR+
Sbjct: 1486 LRRVNLIVDGNLNSDVTSVSSEN-----VNKFLN-LQSEISEGGSNLSQGQRQLMCLARS 1539

Query: 626  LLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLG 685
            LL  P I++LDEAT+++D  S+  I  T+    + K+ TI++IAHRL ++   + ++V+ 
Sbjct: 1540 LLRAPNIMLLDEATASIDYASDAKIQGTIRN--EFKDSTILTIAHRLRSVIDYDKILVMD 1597

Query: 686  IDGSVVEMGKFKDLYANHDSALHKL 710
              G V E      L  N +S  + +
Sbjct: 1598 -AGEVKEYDHPYSLLLNKNSIFYSM 1621

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 69/233 (29%), Positives = 117/233 (50%), Gaps = 11/233 (4%)

Query: 468 LNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPT 527
           L  K+  ++V+ S+  +K +   ++LN   + G    ++GP+G GK+++   LL   +  
Sbjct: 694 LGNKISLENVTVSWNKQKQDFKLRNLNIDFKVGKLNVVIGPTGSGKTSLLMALLGEMHLL 753

Query: 528 SGKILVDGQDI---TKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSV 584
            GKI V   D        S  L   +    Q   L++ T++ NI +        E   +V
Sbjct: 754 EGKITVPSLDPRCEMTFDSDGLSNSMAYCSQAAWLLNDTVKNNILFNAEYNE--ERYLAV 811

Query: 585 AKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDV 644
              C           G  T IG RG  LSGGQKQRI++ARAL +  K ++LD+  SA+D 
Sbjct: 812 ISACALKRDFEILAAGDLTEIGERGITLSGGQKQRISLARALYSSSKHILLDDCLSAVDS 871

Query: 645 ESEGAI--NYTLGRLMKSKELTIISIAHRLS-TIRRSENVIVLGIDGSVVEMG 694
            +   I  N  +G LM+++  T I ++H ++ T++ +E VI++  +G +  +G
Sbjct: 872 HTAAWIYDNCIIGPLMENR--TCILVSHNVALTLKNAEQVIMID-NGKISHIG 921

>Kpol_1060.7 s1060 complement(13248..17630) [4383 bp, 1460 aa] {ON}
            complement(13248..17630) [4383 nt, 1461 aa]
          Length = 1460

 Score =  129 bits (323), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 135/532 (25%), Positives = 254/532 (47%), Gaps = 76/532 (14%)

Query: 214  RVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNIS 273
            +  ++  +G     +L  + +++ +H  M F D   +G +L+R   D   +   +T+N+ 
Sbjct: 937  QFTIVCFIGVNASKKLNLSAVRRILHTPMAFLDTTPLGRILNRFTKDTDSLDNELTENVR 996

Query: 274  DGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASG--- 330
                A     +G+ +M  I     ++     P +L+   +  N  ++  RE+++      
Sbjct: 997  LML-AQFANIIGVCVMCIIYLPWFAIAI---PFILLIFVLVSNHYQSAGREIKRLEAIQR 1052

Query: 331  -----NLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTN 385
                 NL +V    L G+ T++ + +E + + + +  + ++   G    +          
Sbjct: 1053 SFVYNNLNEV----LGGMDTIRFYNSEERFMAKSDYLIDKMNEAG----YLVVCVQRWVA 1104

Query: 386  VLGD-----FSFLLVLAYGSHLVLQGNLTIGDLTAFMLY--------------TEYTGSA 426
            VL D     F+ ++ L   +        ++G L  ++L               TE   ++
Sbjct: 1105 VLLDMIAVCFALIIALLCVTRQFHISASSVGVLLTYVLQLPGLLNTVLRALTQTENDMNS 1164

Query: 427  VFGLSTFYSELMKGAGAATRLFELLDYKPTIKSTTGKAFKPLNGKVEFQHVSFSYPTRKT 486
            V  L ++ +EL     AA R       KP  +S+   ++ P  GK++F+ VSF+Y     
Sbjct: 1165 VERLVSYATEL--PTEAAYR-------KP--ESSPDPSW-PQEGKIDFEEVSFAYRP-GL 1211

Query: 487  NQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSL 546
              + K+L+ +I  G  + I G +G GKSTI S L R     SG+I++DG +I+ +    L
Sbjct: 1212 PAVLKNLSMSINGGEKIGICGRTGAGKSTIMSALYRLNELESGRIIIDGVNISNIGLFDL 1271

Query: 547  RRQLGVVQQEPILMSGTIRENIT-YG----------VSR-----QPSMEEIRSVAKKCFC 590
            RR L ++ Q+P+L  GTIR+N+  +G          +SR     + S+EE+++  +K   
Sbjct: 1272 RRSLSIIPQDPVLFRGTIRKNLDPFGERSDDELWDALSRGGSIDKESLEEVKT--QKSTG 1329

Query: 591  HAFISKFPNGY-ETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGA 649
            ++ + +    + +  +   G+  S G++Q +A+ARAL+   K+LILDEATS++D E++  
Sbjct: 1330 NSKVQELHKFHLDQEVEEEGSNFSLGERQLLALARALVRNSKVLILDEATSSVDYETDNK 1389

Query: 650  INYTLGRLMKS-KELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLY 700
            I     R++++  E TI+ IAHRL TI   + ++VL   G + E     +LY
Sbjct: 1390 IQ---NRIIEAFSECTILCIAHRLKTILNYDRILVLE-KGEIAEFDSPYNLY 1437

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 67/211 (31%), Positives = 102/211 (48%), Gaps = 20/211 (9%)

Query: 490 FKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQ 549
           FKD+N  I  G  + I GP G GK+++ + +      T G + ++G+ +           
Sbjct: 604 FKDINLEIHKGEFIMITGPIGTGKTSLLNAMSGLMEKTEGSVQINGELL----------- 652

Query: 550 LGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRG 609
              +   P + + T+R+NI +G     S  +   V K C   A +   P G  T IG RG
Sbjct: 653 ---MGGYPWIQNATVRDNIIFGSPFDKS--KYNMVVKACCLDADLDILPAGDMTEIGERG 707

Query: 610 ALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAI-NYTLGRLMKSKELTIISI 668
             LSGGQK RI +AR +     I + D+  SA+D      I +  L  L+  K  T +  
Sbjct: 708 INLSGGQKARINLARCVYKNKDIYLFDDVLSAVDSRVGKLIMDECLLGLLNGK--TRVLA 765

Query: 669 AHRLSTIRRSENVIVLGIDGSVVEMGKFKDL 699
            H+LS +  +  VIVLG DGS V++G  ++L
Sbjct: 766 THQLSLVENASRVIVLGNDGS-VDIGTVEEL 795

>KNAG0K00170 Chr11 complement(15700..20028) [4329 bp, 1442 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1442

 Score =  127 bits (320), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 136/535 (25%), Positives = 244/535 (45%), Gaps = 68/535 (12%)

Query: 217  LLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGF 276
            LL  LG R    L    +++ +H  M + D   +G +L+R   D   +   +T++I    
Sbjct: 921  LLCTLGLRASKWLNLKAVERILHTPMSYLDTTPLGRILNRFTKDTDSLDNELTESIR--- 977

Query: 277  KALICGGVG--IGMMFHISSTLASVLFLFAPP-LLVGATIYGNKIRAISRELQQASGNLT 333
              L+   VG  IG++      L    F  A P LL+   +  +  ++  RE+++      
Sbjct: 978  --LMLSQVGNLIGVIVMCIVYLP--WFAIAVPFLLIIFVLICDHYQSTGREIKRLEAVQR 1033

Query: 334  KVA----EEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTN---ATFFSSTNV 386
                    E L G+ T++++ ++ + + + +  + ++   G          A    S  V
Sbjct: 1034 SFVYNNFNEVLGGMDTIKAYGSQERFLAKTDYLINKMNEAGYLIVAVQRWVAILLDSVAV 1093

Query: 387  LGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLY--------------TEYTGSAVFGLST 432
            +  F+ ++ L   +        ++G L  ++L               TE   ++   L T
Sbjct: 1094 V--FALIITLLCVTRAFPISAGSVGVLLTYVLQLPGLLNTILRALTQTENDMNSAERLVT 1151

Query: 433  FYSELMKGAGAATRLFELLDYKPTIKSTTGKAFKPLNGKVEFQHVSFSY-PTRKTNQIFK 491
            + +EL     AA R       KP +         P  G ++F  V+F+Y P      + K
Sbjct: 1152 YATEL--PLEAAYR-------KPEVSPPESW---PEKGDIDFIDVNFAYRPGLPV--VLK 1197

Query: 492  DLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLG 551
            ++N  I  G  + I G +G GKSTI S L R    + GKI++DG DI K+    LR++L 
Sbjct: 1198 NMNLKINNGEKIGICGRTGAGKSTIMSALYRLNELSDGKIVIDGVDIRKIGLYDLRKKLT 1257

Query: 552  VVQQEPILMSGTIREN----------------ITYGVSRQPSMEEIRSVAKKCFCHAFIS 595
            ++ Q+P+L  GTIR+N                I  GV  + ++ +I+ + K    +++ +
Sbjct: 1258 IIPQDPVLFRGTIRKNLDPFKECSDDLLWDALIRTGVVERENLNDIK-LEKPDENNSYSN 1316

Query: 596  KFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLG 655
                  + ++   G+  S G++Q +A+ RAL+   KILILDEATS++D E++G I   + 
Sbjct: 1317 MHKFHLDELVEEEGSNFSLGERQMLALTRALVRNSKILILDEATSSVDYETDGKIQSRI- 1375

Query: 656  RLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
             + +  + TI+ IAHRL TI   + ++VL   G + E  K  +L+ + +S    +
Sbjct: 1376 -VSEFGDCTILCIAHRLKTILSYDKILVLE-KGVIAEYEKPWELFNDKNSIFRSM 1428

 Score = 94.0 bits (232), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 65/203 (32%), Positives = 104/203 (51%), Gaps = 23/203 (11%)

Query: 490 FKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQ 549
           F DLN  I  G  + + GP G GK+++ + +  +   TSG++ V+G+ +           
Sbjct: 581 FTDLNLEIFKGEFIIVTGPIGTGKTSLLNAMAGFMKQTSGRVEVNGELL----------- 629

Query: 550 LGVVQQEPILMSGTIRENITYGVSRQPSMEEIR--SVAKKCFCHAFISKFPNGYETIIGP 607
              +   P +++ T+R+NI +G       EE R   + + C   A +   P G  T IG 
Sbjct: 630 ---LCGYPWILNATVRDNILFG----SPYEEARYNEIVEVCSLDADLKILPAGDRTEIGE 682

Query: 608 RGALLSGGQKQRIAIARALLNKPKILILDEATSALDVE-SEGAINYTLGRLMKSKELTII 666
           RG  LSGGQK RI +ARA+     I + D+  SA+D    +  ++  L  ++K K  T I
Sbjct: 683 RGITLSGGQKARINLARAVYKNKDIFLFDDVLSAVDSRVGKHIMDDCLLGILKGK--TRI 740

Query: 667 SIAHRLSTIRRSENVIVLGIDGS 689
              H+LS I R++ +IV+G +GS
Sbjct: 741 LATHQLSVIERADRIIVVGPNGS 763

>YDR135C Chr4 complement(723004..727551) [4548 bp, 1515 aa] {ON}
            YCF1Vacuolar glutathione S-conjugate transporter; member
            of the ATP-binding cassette family; has a role in
            detoxifying metals such as cadmium, mercury, and
            arsenite; also transports unconjugated bilirubin,
            selenodigluthatione, and oxidized glutathione; similar to
            human cystic fibrosis protein CFTR
          Length = 1515

 Score =  127 bits (319), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 131/491 (26%), Positives = 223/491 (45%), Gaps = 45/491 (9%)

Query: 242  MEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGMMFHISSTLASVL- 300
            M F++   +G +L+R   D Y V   + +  S  F         + + F I+   A+   
Sbjct: 1038 MTFFETTPIGRILNRFSNDIYKVDALLGRTFSQFFVN------AVKVTFTITVICATTWQ 1091

Query: 301  FLFAP-PLLVGATIYGNKIRAISRELQQASGNLTKVA-----EEQLSGIKTVQSFVAEGK 354
            F+F   PL V    Y       SREL++   ++T+       +E L G+ TV+ +  + +
Sbjct: 1092 FIFIIIPLSVFYIYYQQYYLRTSRELRRLD-SITRSPIYSHFQETLGGLATVRGYSQQKR 1150

Query: 355  EVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAYGSHLVL---------- 404
              H   N  R   N+        + F+ S N     ++ L L  GS ++L          
Sbjct: 1151 FSHI--NQCRIDNNM--------SAFYPSINANRWLAYRLELI-GSIIILGAATLSVFRL 1199

Query: 405  -QGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKP----TIKS 459
             QG LT G +   + Y       +  +     E+     +  R+ E  D K      ++ 
Sbjct: 1200 KQGTLTAGMVGLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYADLKSEAPLIVEG 1259

Query: 460  TTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASL 519
                   P  G ++F + S  Y   + + + K +N  I+P   V IVG +G GKS++   
Sbjct: 1260 HRPPKEWPSQGDIKFNNYSTRYRP-ELDLVLKHINIHIKPNEKVGIVGRTGAGKSSLTLA 1318

Query: 520  LLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSME 579
            L R    + G I++D   I ++    LR +L ++ Q+  +  GT+RENI   +++     
Sbjct: 1319 LFRMIEASEGNIVIDNIAINEIGLYDLRHKLSIIPQDSQVFEGTVRENID-PINQYTDEA 1377

Query: 580  EIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEAT 639
              R++         +S   +G +  +   G  LS GQ+Q + +ARA+L   KIL+LDEAT
Sbjct: 1378 IWRALELSHLKEHVLSMSNDGLDAQLTEGGGNLSVGQRQLLCLARAMLVPSKILVLDEAT 1437

Query: 640  SALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDL 699
            +A+DVE++  +  T+    K +  TI++IAHRL+TI  S+ +IVL  +G V E      L
Sbjct: 1438 AAVDVETDKVVQETIRTAFKDR--TILTIAHRLNTIMDSDRIIVLD-NGKVAEFDSPGQL 1494

Query: 700  YANHDSALHKL 710
             +++ S  + L
Sbjct: 1495 LSDNKSLFYSL 1505

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 107/445 (24%), Positives = 196/445 (44%), Gaps = 46/445 (10%)

Query: 290 FHISSTLASVLFLFAPPLLVGATIY------GNKIRAISRELQQASGNL----TKVAEEQ 339
           F I   L S+  L    + VG  I        + +  I ++LQ++        T+V  E 
Sbjct: 431 FQIIICLYSLYKLLGNSMWVGVIILVIMMPLNSFLMRIQKKLQKSQMKYKDERTRVISEI 490

Query: 340 LSGIKTVQSFVAEGK-----EVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLL 394
           L+ IK+++ +  E       E  R N  ++ +  +G   A T+  F     ++   +F  
Sbjct: 491 LNNIKSLKLYAWEKPYREKLEEVRNNKELKNLTKLGCYMAVTSFQFNIVPFLVSCCTFA- 549

Query: 395 VLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYK 454
           V  Y     L  +L    LT F L +         L++F    ++ + +  RLF     +
Sbjct: 550 VFVYTEDRALTTDLVFPALTLFNLLSFPLMIIPMVLNSF----IEASVSIGRLFTFFTNE 605

Query: 455 PTIKSTTGKAFKPLN-GKVEFQ---HVSFSYPTRKTNQI-FKDLNFTIEPGSNVCIVGPS 509
                +  +  K  N G V        +F +  +   ++  K++NF  + G+  CIVG  
Sbjct: 606 ELQPDSVQRLPKVKNIGDVAINIGDDATFLWQRKPEYKVALKNINFQAKKGNLTCIVGKV 665

Query: 510 GRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENIT 569
           G GK+ + S +L       G   V G              +  V Q P +M+GT++ENI 
Sbjct: 666 GSGKTALLSCMLGDLFRVKGFATVHGS-------------VAYVSQVPWIMNGTVKENIL 712

Query: 570 YGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNK 629
           +G   +   E      K C     ++   +G +T++G +G  LSGGQK R+++ARA+  +
Sbjct: 713 FG--HRYDAEFYEKTIKACALTIDLAILMDGDKTLVGEKGISLSGGQKARLSLARAVYAR 770

Query: 630 PKILILDEATSALDVE-SEGAINYTLGR--LMKSKELTIISIAHRLSTIRRSENVIVLGI 686
               +LD+  +A+D   +   I + LG   L+ +K  T +   +++S +  ++++ +L  
Sbjct: 771 ADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTK--TKVLATNKVSALSIADSIALLD- 827

Query: 687 DGSVVEMGKFKDLYANHDSALHKLL 711
           +G + + G + ++  + DS L KLL
Sbjct: 828 NGEITQQGTYDEITKDADSPLWKLL 852

>Suva_7.577 Chr7 (1007741..1012177) [4437 bp, 1478 aa] {ON} YGR281W
            (REAL)
          Length = 1478

 Score =  127 bits (318), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 134/533 (25%), Positives = 245/533 (45%), Gaps = 52/533 (9%)

Query: 213  GRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNI 272
            G+  +L  +G      L    +K+ +H  M + D   +G +L+R   D   +   +T+++
Sbjct: 952  GQYTILCAMGIMASKWLNLKAVKRILHTPMSYIDTTPLGRILNRFTKDTDSLDNELTESL 1011

Query: 273  ---SDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISR-ELQQA 328
               +  F  ++  GV +  + ++     ++ FL    +L+ A  Y +  R I R E  Q 
Sbjct: 1012 RLMTSQFANIV--GVCVMCIVYLPWFAIAIPFLLIIFVLI-ADHYQSSGREIKRLEAVQR 1068

Query: 329  S---GNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTN---ATFFS 382
            S    NL +V    L G+ T++++ ++ + + + +  + ++   G            F  
Sbjct: 1069 SFVYNNLNEV----LGGMDTIKAYRSQERFLAKSDFLINKMNEAGYLVVVLQRWVGIFLD 1124

Query: 383  STNVLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGA- 441
               ++  F+ ++ L   +        ++G +  ++L      + +    T     M  A 
Sbjct: 1125 MVAIV--FALIITLLCVTRAFPISAASVGVMLTYVLQLPGLLNTLLRALTQTENDMNSAE 1182

Query: 442  ---GAATRLFELLDY-KPTIKSTTGKAFKPLNGKVEFQHVSFSY-PTRKTNQIFKDLNFT 496
                 AT L    DY KP +         P  G++ F++V FSY P      + K+LN  
Sbjct: 1183 RLVSYATELPLEADYRKPEMAPPESW---PSKGEIAFKNVDFSYRPGLPV--VLKNLNLN 1237

Query: 497  IEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQE 556
            I+ G  + I G +G GKSTI S L R    + G+IL+D  +I+++    LRR+L ++ Q+
Sbjct: 1238 IKSGEKIGICGRTGAGKSTIMSALYRLNELSGGEILIDDVNISQIGLFDLRRKLAIIPQD 1297

Query: 557  PILMSGTIREN----------------ITYGVSRQPSMEEIR-SVAKKCFCHAFISKFPN 599
            P+L  GTIR+N                +  G   +  + E++    ++   H  + KF  
Sbjct: 1298 PVLFRGTIRKNLDPFNERTEDELWDALVRGGAIAKNDLPEVKLQKPEENGTHGKMHKF-- 1355

Query: 600  GYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMK 659
              +  +   G+  S G++Q +A+ RAL+ + KILILDEATS++D E++G I   +  + +
Sbjct: 1356 HLDQAVEEEGSNFSLGERQLLALTRALVRQSKILILDEATSSVDYETDGKIQVRI--VEE 1413

Query: 660  SKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLLT 712
              + TI+ IAHRL TI   + ++VL   G V E      L++  DS    + +
Sbjct: 1414 FGDCTILCIAHRLKTIVNYDRILVLE-KGEVAEFDTPWALFSQEDSIFKNMCS 1465

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 73/223 (32%), Positives = 117/223 (52%), Gaps = 22/223 (9%)

Query: 490 FKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQ 549
           FKDL+F I+ G  + I GP G GKS++ + +      T GKI V+G D+           
Sbjct: 604 FKDLDFEIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKIEVNG-DL----------- 651

Query: 550 LGVVQQEPILMSGTIRENITYGVSRQP-SMEEIRSVAKKCFCHAFISKFPNGYETIIGPR 608
             ++   P + + T+++NI +G    P + E+   V   C   A +   P G  T IG R
Sbjct: 652 --LMCGYPWIQNATVKDNIIFG---SPFNKEKYDEVIHVCSLKADLDILPAGDMTEIGER 706

Query: 609 GALLSGGQKQRIAIARALLNKPKILILDEATSALDVE-SEGAINYTLGRLMKSKELTIIS 667
           G  LSGGQK RI +AR++  +  I + D+  SA+D    +  ++  L  L+++K  T + 
Sbjct: 707 GITLSGGQKARINLARSVYKRKDIYLFDDVLSAVDSRVGKHIMDECLTGLLENK--TRVL 764

Query: 668 IAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
             H+LS I ++  VIVLG DG  V++G   +L A + + ++ L
Sbjct: 765 ATHQLSLIEKASRVIVLGTDGD-VDIGTVDELKARNQTLINLL 806

>Kpol_YGOB_1041.45 s1041 complement(118923..123629) [4707 bp, 1568 aa]
            {ON} ANNOTATED BY YGOB -
          Length = 1568

 Score =  127 bits (318), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 140/535 (26%), Positives = 233/535 (43%), Gaps = 52/535 (9%)

Query: 211  NFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQ 270
            N   +V+L     R   +L  N+    ++  M F++   +G +++R   D   V   +  
Sbjct: 1032 NLRSIVMLIFCSIRGSKKLHDNMALSVVYSPMSFFETTPIGRIINRFSGDLDSVDSGLQF 1091

Query: 271  NISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASG 330
              S  F++L+   V + ++ +         F+F   L+V    Y       SREL++   
Sbjct: 1092 IFSHFFRSLLGYIVTVILVGYN----MPWFFVFNIFLIVIYFYYQAYYIVTSRELKR--- 1144

Query: 331  NLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVR-QVFNVGKKEAFTNATF-FSSTNV-- 386
             LT +    +  +  +   +A    ++ YN+A R   FN    +   +  F F STN   
Sbjct: 1145 -LTSITYSPIMSL--ISETLAGYLVINAYNHAKRFSYFNFESVQFNIDCLFNFRSTNRWL 1201

Query: 387  ---LGDFSFLLVLAYG----SHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMK 439
               L     L+VLA G    S +     LT G +   M Y+    +++  +     ++  
Sbjct: 1202 SVRLQAIGALIVLATGLLSLSTIGTSKQLTAGMVGLLMSYSLQVTNSLMWIVRMSVQIET 1261

Query: 440  GAGAATRLFELLDYKPTIKS----TTGKAFKPLNGKVEFQHVSFSYPTRKT-NQIFKDLN 494
               +  R+ E  +  P        T  +   P +G ++F  + +S   RK  + +   +N
Sbjct: 1262 NIVSVERILEYCELPPEPPHEIEETKPEKSWPAHGSIKF--IDYSTKYRKNLDPVLNKIN 1319

Query: 495  FTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQ 554
              IEP   + IVG +G GKST+   L R    T GKI++DG DI+ L    LR  L ++ 
Sbjct: 1320 LEIEPREKIGIVGRTGAGKSTLTLALFRILEATDGKIVIDGVDISTLGLSDLRSNLAIIP 1379

Query: 555  QEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFI-------------------S 595
            Q+     GTIR N+      Q S EE+    +       +                   +
Sbjct: 1380 QDAQAFEGTIRTNL--DPFDQHSDEELWKAIEASHLKPHLERIISNRDDNSESEETNVSA 1437

Query: 596  KFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLG 655
            K  N  E  I   G+ LS GQ+Q + ++RALLN  KIL+LDEAT+++D+E++  I  T+ 
Sbjct: 1438 KDNNLLEIKINENGSNLSVGQRQLLCLSRALLNHSKILVLDEATASVDMETDKIIQETIR 1497

Query: 656  RLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
                 +  TI++IAHR+ T+   + ++VL   G V E      L  N +S  + L
Sbjct: 1498 NEFSDR--TILTIAHRIDTVLGYDKILVLD-KGEVREFDSPDTLLENKNSIFYNL 1549

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 118/528 (22%), Positives = 227/528 (42%), Gaps = 100/528 (18%)

Query: 317 KIRAISRELQQASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAF- 375
           K++++++E  +      +   E L+ IK+++ +  E   + R +     V N  + E+F 
Sbjct: 452 KVKSLNKEQMKYKDIRIRTLTEILNSIKSIKLYSWEKPMLKRLD----HVRNDLELESFK 507

Query: 376 -----TNATFFSSTNV--LGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVF 428
                +N  FF+   V  +   S  ++ A  S + L  ++    L  F +  +    A++
Sbjct: 508 KIGIVSNCIFFAWNCVPIMVTCSSFIIFALTSGMALTPDIVFPALALFNILND----AIY 563

Query: 429 GLSTFYSELMKGAGAATRLFELLDYKPTIKSTTGKAFKPLNGK---VEFQHVSFSYPTRK 485
            + +  + +++ + +  RL   L  +   +S   ++    +G    VE  + +F +  +K
Sbjct: 564 SVPSTITNIIEVSVSLGRLKNFLATEELDRSFIEQSDPKNDGHSCAVEIDNATFLWKGKK 623

Query: 486 ----------------TNQIFKDLN-FTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTS 528
                           T   FK++N F ++ GS  CIVG  G GK+T+   +L      S
Sbjct: 624 NLVSSENGDEESTIDNTQVAFKNVNHFEVKEGSLTCIVGRVGSGKTTLLRAVLGQLPCIS 683

Query: 529 G-------KILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEI 581
           G       K+++ G  I                Q+  +M+ +++ENI +G         +
Sbjct: 684 GAQESIPPKLIIRGNSI------------AYCPQQAWIMNSSVKENILFGHKYDEHYYNL 731

Query: 582 RSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSA 641
               + C     +   P+G ETI+G +G  LSGGQK R+++ARA+ ++  I +LD+  SA
Sbjct: 732 --TIEACQLTEDLKMLPDGDETIVGEKGISLSGGQKARLSLARAVYSRSDIYLLDDILSA 789

Query: 642 LDVE-SEGAINYTLGR---LMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFK 697
           +D E S+  I   L     L+KSK  TII   + +S ++ S+ +  L  +  ++E G + 
Sbjct: 790 VDAEVSKNIIEKVLDEQTGLLKSK--TIILTTNAISVLKHSQKIYALE-NCEIIEEGAYD 846

Query: 698 DLY-ANHDSALHKLLTXXXXXXXXXXXXYAPPAITQESEPQTEENGKDDSGEDQNSDHE- 755
           D+  ++ DS L                     A+  E +   + N K++  E++ +  E 
Sbjct: 847 DVMNSSEDSKLK--------------------ALINEFDNDRDNNSKEEVSEERKTSEET 886

Query: 756 -------ENSQDQNEKRLQEEVI-------HQVLEDISHDQKTSTLRP 789
                  +N  + ++  L E  +        + LE  S     +TL+P
Sbjct: 887 SDVVPIDDNLIENDDDNLAESTVAYTGKEQRKALEISSRKASMATLKP 934

>Kpol_1041.45 s1041 complement(118923..123713) [4791 bp, 1596 aa]
            {OFF} complement(118923..123713) [4791 nt, 1597 aa]
          Length = 1596

 Score =  126 bits (317), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 140/535 (26%), Positives = 233/535 (43%), Gaps = 52/535 (9%)

Query: 211  NFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQ 270
            N   +V+L     R   +L  N+    ++  M F++   +G +++R   D   V   +  
Sbjct: 1060 NLRSIVMLIFCSIRGSKKLHDNMALSVVYSPMSFFETTPIGRIINRFSGDLDSVDSGLQF 1119

Query: 271  NISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASG 330
              S  F++L+   V + ++ +         F+F   L+V    Y       SREL++   
Sbjct: 1120 IFSHFFRSLLGYIVTVILVGYN----MPWFFVFNIFLIVIYFYYQAYYIVTSRELKR--- 1172

Query: 331  NLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVR-QVFNVGKKEAFTNATF-FSSTNV-- 386
             LT +    +  +  +   +A    ++ YN+A R   FN    +   +  F F STN   
Sbjct: 1173 -LTSITYSPIMSL--ISETLAGYLVINAYNHAKRFSYFNFESVQFNIDCLFNFRSTNRWL 1229

Query: 387  ---LGDFSFLLVLAYG----SHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMK 439
               L     L+VLA G    S +     LT G +   M Y+    +++  +     ++  
Sbjct: 1230 SVRLQAIGALIVLATGLLSLSTIGTSKQLTAGMVGLLMSYSLQVTNSLMWIVRMSVQIET 1289

Query: 440  GAGAATRLFELLDYKPTIKS----TTGKAFKPLNGKVEFQHVSFSYPTRKT-NQIFKDLN 494
               +  R+ E  +  P        T  +   P +G ++F  + +S   RK  + +   +N
Sbjct: 1290 NIVSVERILEYCELPPEPPHEIEETKPEKSWPAHGSIKF--IDYSTKYRKNLDPVLNKIN 1347

Query: 495  FTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQ 554
              IEP   + IVG +G GKST+   L R    T GKI++DG DI+ L    LR  L ++ 
Sbjct: 1348 LEIEPREKIGIVGRTGAGKSTLTLALFRILEATDGKIVIDGVDISTLGLSDLRSNLAIIP 1407

Query: 555  QEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFI-------------------S 595
            Q+     GTIR N+      Q S EE+    +       +                   +
Sbjct: 1408 QDAQAFEGTIRTNL--DPFDQHSDEELWKAIEASHLKPHLERIISNRDDNSESEETNVSA 1465

Query: 596  KFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLG 655
            K  N  E  I   G+ LS GQ+Q + ++RALLN  KIL+LDEAT+++D+E++  I  T+ 
Sbjct: 1466 KDNNLLEIKINENGSNLSVGQRQLLCLSRALLNHSKILVLDEATASVDMETDKIIQETIR 1525

Query: 656  RLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
                 +  TI++IAHR+ T+   + ++VL   G V E      L  N +S  + L
Sbjct: 1526 NEFSDR--TILTIAHRIDTVLGYDKILVLD-KGEVREFDSPDTLLENKNSIFYNL 1577

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 118/528 (22%), Positives = 227/528 (42%), Gaps = 100/528 (18%)

Query: 317 KIRAISRELQQASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAF- 375
           K++++++E  +      +   E L+ IK+++ +  E   + R +     V N  + E+F 
Sbjct: 480 KVKSLNKEQMKYKDIRIRTLTEILNSIKSIKLYSWEKPMLKRLD----HVRNDLELESFK 535

Query: 376 -----TNATFFSSTNV--LGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVF 428
                +N  FF+   V  +   S  ++ A  S + L  ++    L  F +  +    A++
Sbjct: 536 KIGIVSNCIFFAWNCVPIMVTCSSFIIFALTSGMALTPDIVFPALALFNILND----AIY 591

Query: 429 GLSTFYSELMKGAGAATRLFELLDYKPTIKSTTGKAFKPLNGK---VEFQHVSFSYPTRK 485
            + +  + +++ + +  RL   L  +   +S   ++    +G    VE  + +F +  +K
Sbjct: 592 SVPSTITNIIEVSVSLGRLKNFLATEELDRSFIEQSDPKNDGHSCAVEIDNATFLWKGKK 651

Query: 486 ----------------TNQIFKDLN-FTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTS 528
                           T   FK++N F ++ GS  CIVG  G GK+T+   +L      S
Sbjct: 652 NLVSSENGDEESTIDNTQVAFKNVNHFEVKEGSLTCIVGRVGSGKTTLLRAVLGQLPCIS 711

Query: 529 G-------KILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEI 581
           G       K+++ G  I                Q+  +M+ +++ENI +G         +
Sbjct: 712 GAQESIPPKLIIRGNSI------------AYCPQQAWIMNSSVKENILFGHKYDEHYYNL 759

Query: 582 RSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSA 641
               + C     +   P+G ETI+G +G  LSGGQK R+++ARA+ ++  I +LD+  SA
Sbjct: 760 --TIEACQLTEDLKMLPDGDETIVGEKGISLSGGQKARLSLARAVYSRSDIYLLDDILSA 817

Query: 642 LDVE-SEGAINYTLGR---LMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFK 697
           +D E S+  I   L     L+KSK  TII   + +S ++ S+ +  L  +  ++E G + 
Sbjct: 818 VDAEVSKNIIEKVLDEQTGLLKSK--TIILTTNAISVLKHSQKIYALE-NCEIIEEGAYD 874

Query: 698 DLY-ANHDSALHKLLTXXXXXXXXXXXXYAPPAITQESEPQTEENGKDDSGEDQNSDHE- 755
           D+  ++ DS L                     A+  E +   + N K++  E++ +  E 
Sbjct: 875 DVMNSSEDSKLK--------------------ALINEFDNDRDNNSKEEVSEERKTSEET 914

Query: 756 -------ENSQDQNEKRLQEEVI-------HQVLEDISHDQKTSTLRP 789
                  +N  + ++  L E  +        + LE  S     +TL+P
Sbjct: 915 SDVVPIDDNLIENDDDNLAESTVAYTGKEQRKALEISSRKASMATLKP 962

>Smik_11.367 Chr11 (644116..648903) [4788 bp, 1595 aa] {ON} YKR103W
            (REAL)
          Length = 1595

 Score =  126 bits (316), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 123/537 (22%), Positives = 253/537 (47%), Gaps = 63/537 (11%)

Query: 213  GRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNI 272
            G+V +  + G     ++ + ++       + F+D   VG +++R   D  I+ + +  N 
Sbjct: 1058 GKVWVAVLFGTNATKKIFAKLLSSIFLAKLRFHDITPVGRIMNRFSKDMDIIDQQLIPNF 1117

Query: 273  SDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASG-N 331
               F +++   V + ++F I       L LFA PL     I G+     SREL++    N
Sbjct: 1118 EGLFYSVV---VCLWVIFLIGYITPRFL-LFAIPLCALYYIVGSLYLRASRELKRIDNIN 1173

Query: 332  LTKVAE---EQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFS------ 382
            ++ + +   E + G+ T+++   E + + +   A+ +          +NA FF       
Sbjct: 1174 VSPIHQLFTEAIKGVATIRALADERRFITQTLVAIDK----------SNAPFFYLNLATE 1223

Query: 383  ----STNVLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYT--EYTGSAVFGLSTFYS- 435
                  +++G    L++ +    +VL+       L   +L     +T +A + +  F   
Sbjct: 1224 WITYRVDIIGA---LILFSSSLMIVLKAPYLDAGLAGILLSNAFSFTETAQWIIKVFSGV 1280

Query: 436  ELMKGAGAATRLFELLDYKPTIKSTTGKAFKPL-----NGKVEFQHVSFSYPTRKTNQIF 490
            EL+    +  R+ E +D  P   S +     PL      G +EF++++  Y +  +++  
Sbjct: 1281 ELL--MSSVERIKEYVDV-PLESSESNNYATPLANWPQTGDIEFENLTLRY-SPHSSKAL 1336

Query: 491  KDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQL 550
              ++F ++ G+ V IVG +G GKS+I + + R  +   G I++D +DI  +  + LR  +
Sbjct: 1337 DGVSFKVKAGTKVGIVGRTGAGKSSIIAAIYRLSDWEDGTIIIDNKDIKYVPLECLRNSI 1396

Query: 551  GVVQQEPILMSGTIRENI----TYG-VSRQPSMEEIRSVAKK---CFCHAFISKFPNGYE 602
              + Q P L  GTIR N+     Y  V    ++E++  + +    C        +P+ ++
Sbjct: 1397 SCIPQNPTLFEGTIRSNLDPWDQYSDVQVFEALEKVGLIEQSEGLCSLPGQKLSYPSNHK 1456

Query: 603  ---------TIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYT 653
                     T++   G+ +S GQ+Q + +AR++L    I+++DEAT+++D  S+  I  T
Sbjct: 1457 LRNRFIDLNTVVKSGGSNISQGQRQLLCLARSMLGARNIMLIDEATASIDYVSDAKIQKT 1516

Query: 654  LGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
            +   M++   T+++IAHRL ++   + ++V+ + G V E     +L ++ ++  H+L
Sbjct: 1517 IRETMRNT--TVLTIAHRLRSVIDYDKILVMDM-GRVEEYDHPYNLISDKNTIFHRL 1570

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 85/319 (26%), Positives = 148/319 (46%), Gaps = 28/319 (8%)

Query: 471 KVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGK 530
           K+ F++ +  +   +T+   K+++   +  +   I+GP+G GKS++   LL   N  SGK
Sbjct: 664 KLGFENANMEWEAAETSFKLKNISIDFKQNTLNAIIGPTGSGKSSLLLGLLGELNLRSGK 723

Query: 531 I---LVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKK 587
           I    V  +D  ++    +   +    Q P L+SGTI++NI +G     + ++   V K 
Sbjct: 724 INVPTVHSRDDLEIGIDGMANSMAYCSQSPWLISGTIKDNIVFG--EFFNQQKFDDVIKC 781

Query: 588 CFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESE 647
           C     I     G +T +G  G  LSGGQ+QRIA+ARA+ +  + L+ D+  SA+D E+ 
Sbjct: 782 CCLEKDIKAMTAGLKTDVGEGGFSLSGGQQQRIALARAIYSSSRYLLFDDCLSAVDPETA 841

Query: 648 GAI--NYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANH-- 703
             I      G +MK +  T I  +H +S I +    +V+  +G V   GK  DL  +   
Sbjct: 842 LHIYEECLCGPMMKGR--TCIVTSHNISLIIKQAQWLVILDNGEVKAQGKPSDLIESSKF 899

Query: 704 ----------DSALHKLLTXXXXXXXXXXXXYAPPAITQESEPQTEENGKDDSGEDQNSD 753
                     D + +++                   +  E +PQ EEN ++     +  D
Sbjct: 900 LKESINNDPGDKSYNQI-----KLKQFKTLKKTENVLPIEEDPQDEENPQEAENPQEEED 954

Query: 754 HEENSQDQN--EKRLQEEV 770
            +E  + +N  EK+++  V
Sbjct: 955 PQETPEMENFEEKKMEGSV 973

>SAKL0H00704g Chr8 (85322..89641) [4320 bp, 1439 aa] {ON} similar to
            uniprot|P53049 Saccharomyces cerevisiae YGR281W YOR1
            Plasma membrane transporter of the ATP- binding cassette
            (ABC) family mediates export of many different organic
            anions including oligomycin
          Length = 1439

 Score =  125 bits (313), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 134/515 (26%), Positives = 232/515 (45%), Gaps = 52/515 (10%)

Query: 229  LRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNIS-DGFKALICGGVGIG 287
            L    +K+ +H  M F D   +G +L+R   D   +   +T+++    ++     GV I 
Sbjct: 928  LNLKAVKRLLHTPMSFMDTTPLGRVLNRFTKDTDTLDNELTESVRLFVYQTANIAGVIIM 987

Query: 288  MMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEEQLSGIKTVQ 347
             + ++     +V FL     ++ A  Y +  R I R        +     E LSG+ T++
Sbjct: 988  CIIYLPWFAIAVPFL-GLIFIIVADHYQSSGREIKRLEAVQRSFVYNNFNEVLSGMDTIK 1046

Query: 348  SFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLG-DFSFLLVL---------- 396
            ++ +E + + + +  + ++   G            S +++   F+ ++ L          
Sbjct: 1047 AYKSENRFLMKSDFLINRMSEAGYLVVAVQRWVSISLDMIAVAFALIITLLCVTRQFDIS 1106

Query: 397  --AYGSHL--VLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLD 452
              + G  L  VLQ    +  L   M   E   ++V  +  + +EL + A  A R  E+  
Sbjct: 1107 AASVGVLLTYVLQLPGLLNGLLRAMTQAENDMNSVERIVNYATELPQEA--AYRKPEMTP 1164

Query: 453  YKPTIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRG 512
             +P           P NG+V F +VS SY       + K ++  I+ G  + I G +G G
Sbjct: 1165 QEPW----------PSNGEVVFDNVSLSYRP-GLPLVLKGVSLNIKGGEKIGICGRTGAG 1213

Query: 513  KSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGV 572
            KSTI S L R      G++L+DG D +KL    LRR+L ++ Q+P+L  G+IR+N+    
Sbjct: 1214 KSTIMSALYRLCELNEGRVLIDGVDTSKLGLYDLRRKLSIIPQDPVLFKGSIRKNLDPFG 1273

Query: 573  SRQPSMEEIRS--VAKKCFCHAFISKFPNGYETIIGPRGAL---------------LSGG 615
             R+   EE+ S  V         + K  N +    G    L                S G
Sbjct: 1274 ERED--EELWSALVRSGTIEAEEVEKVKNQHRDESGSSTGLHKFHLDQEVEDDGTNFSLG 1331

Query: 616  QKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTI 675
            ++Q +A+ RAL+ + KILILDEATS++D E++  I   + +  +    TI+ IAHRL TI
Sbjct: 1332 ERQLLALTRALVRQSKILILDEATSSVDHETDAKIQSLIAQ--EFNRCTILCIAHRLKTI 1389

Query: 676  RRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
               + ++VL  +G+V E    + L+   D+   ++
Sbjct: 1390 LNYDRLVVLD-NGTVKEFDTPRSLFRIKDTIFREM 1423

 Score = 95.5 bits (236), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 87/269 (32%), Positives = 132/269 (49%), Gaps = 32/269 (11%)

Query: 448 FELLDYKPTIKSTTGKAF--KPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCI 505
           FE+ D K T K   G+AF  KP    V+    +F+   + +   FK+LNF I+ G  V I
Sbjct: 532 FEVEDAKETAKEK-GEAFEEKPKGANVD----AFASSEKASFSGFKNLNFQIQKGELVII 586

Query: 506 VGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIR 565
            G  G GKS++ + L  +   T G I  +G         SL     ++   P + + T+R
Sbjct: 587 TGSIGTGKSSLLNALAGFMKKTEGDIFKNG---------SL-----LLCGYPWIQNTTVR 632

Query: 566 ENITYGVSRQPSMEEIR--SVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIA 623
           +NI +G     S +++R   V + C   A +   P G  T IG RG  LSGGQK RI +A
Sbjct: 633 DNILFG----SSFDDVRYKEVIRVCALQADLDILPAGDFTEIGERGITLSGGQKARINLA 688

Query: 624 RALLNKPKILILDEATSALDVE-SEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVI 682
           R++     I + D+  SA+D    +  ++  L  ++  K  T I   H+LS I R+  VI
Sbjct: 689 RSVYKSMDIYLFDDVLSAVDARVGKHIMDECLMGMLDGK--TRILATHQLSLIERASRVI 746

Query: 683 VLGIDGSVVEMGKFKDLYANHDSALHKLL 711
            LG  GS  ++G  ++L    +S   KL+
Sbjct: 747 FLGAGGS-FDIGTVEEL-KERNSGFVKLM 773

>SAKL0H23958g Chr8 complement(2062067..2066743) [4677 bp, 1558 aa]
            {ON} similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1558

 Score =  124 bits (312), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 132/516 (25%), Positives = 226/516 (43%), Gaps = 49/516 (9%)

Query: 228  RLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIG 287
            +L   + +  +   M F++   VG +++R  +D  +V + +  + +  F  ++     + 
Sbjct: 1048 KLHDTMARAVLRSPMSFFETTPVGRIINRFSSDVNVVDQGLQFSFTYFFIYILNYLFTVI 1107

Query: 288  MMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASG----NLTKVAEEQLSGI 343
            ++    S    +  LF   LLV    Y      +SREL++ +      +  +  E L G 
Sbjct: 1108 LI----SFNMPLFLLFNGILLVLYFYYQIYYITLSRELKRLTSISYSPIMSLLSETLGGH 1163

Query: 344  KTVQSFVAEGKEVHRY---NNAVRQVFNVGKKEAF--TNATFFSSTNVLGDFSFLLVLAY 398
              + ++    K + R+   NN   Q FN+     F  TN         +G    LL    
Sbjct: 1164 LVINAY----KHLQRFTYLNNESIQ-FNINCMFNFRSTNRWLSMRLQTIGAVLVLLTALL 1218

Query: 399  GSHLV-LQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKP-- 455
                +     L+ G +   M Y     +++  +     ++     +  R+ E  +  P  
Sbjct: 1219 SLSTINTDKALSSGMVGLLMSYALQVTTSLTWIVRMSVQVETDIVSVERILEYCNLPPEA 1278

Query: 456  --TIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGK 513
               I+ +      P  G + FQ+ S  Y     + + KD+   I+P   + IVG +G GK
Sbjct: 1279 DAIIEESRPPKEWPSRGAITFQNYSTKY-RENLDPVLKDITVEIKPQEKIGIVGRTGAGK 1337

Query: 514  STIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENI-TYGV 572
            ST++  L R   P+ G I++DG DI KL    LR  L ++ Q+     GTI+ N+  +G 
Sbjct: 1338 STLSLALFRLLEPSGGSIVIDGIDIAKLGLSDLRGNLAIIPQDAQAFEGTIKSNLDPFG- 1396

Query: 573  SRQPSMEEIRSVAKKCFCHAFISKFPN---------------GYETI---IGPRGALLSG 614
              Q S EEI    +       I K  +                +E +   I   G  LS 
Sbjct: 1397 --QYSDEEIWRALELSHLKPHILKMASEENTENSETTTEATRSHELLSARITENGGNLSI 1454

Query: 615  GQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLST 674
            GQ+Q + ++RALLN  KIL+LDEAT+A+D+E++  I  T+    K +  TI++IAHR+ T
Sbjct: 1455 GQRQLLCLSRALLNHSKILVLDEATAAVDMETDKIIQETIKTAFKDR--TILTIAHRIDT 1512

Query: 675  IRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
            +  S+ ++VL   G V E     +L A+  +  + L
Sbjct: 1513 VMDSDKIMVLD-KGEVKEFDTPTNLLADKSTIFYNL 1547

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 75/283 (26%), Positives = 138/283 (48%), Gaps = 42/283 (14%)

Query: 494 NFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVV 553
           +F    G   CIVG  G GKST    +L      SG   +D     KL  ++  + +   
Sbjct: 650 HFEARKGDLTCIVGRVGSGKSTFLQAILGQLPCISG---LDEHVPPKLIIRA--KSIAYC 704

Query: 554 QQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLS 613
            Q+P +M+ ++++N+ +G   + + +  ++  +KC     +   P+G +T++G +G  LS
Sbjct: 705 PQQPWIMNASLKDNVIFG--HRLNEDYYKATIRKCQLLPDLDILPDGDQTLVGEKGISLS 762

Query: 614 GGQKQRIAIARALLNKPKILILDEATSALDVE-SEGAINYTLGR---LMKSKELTIISIA 669
           GGQK R+++ARA+  +  + +LD+  SA+D E S+  +   L R   ++K+K  T+I   
Sbjct: 763 GGQKARLSLARAVYARADVYLLDDILSAVDAEVSKNIVEQVLNRGTGILKNK--TVILTT 820

Query: 670 HRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLLTXXXXXXXXXXXXYAPPA 729
           + +S ++ S+N+  L +DG +VE   + D  +  DS++ K L                  
Sbjct: 821 NAVSVLKHSQNIYAL-LDGEIVENKSYADAMSCDDSSILKTLI----------------- 862

Query: 730 ITQESEPQTEENGKDDSGEDQNSDHEENSQ-------DQNEKR 765
                E  + EN ++D+ + Q S   ++ Q       D+ E R
Sbjct: 863 ----QEFDSNENSREDTKDGQPSSTAKDDQKSFHSIKDEQEDR 901

>Skud_18.2 Chr18 (5442..10184) [4743 bp, 1580 aa] {ON} YHL035C (REAL)
          Length = 1580

 Score =  124 bits (311), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 126/530 (23%), Positives = 245/530 (46%), Gaps = 52/530 (9%)

Query: 213  GRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNI 272
            G+V +  + G     ++ S ++       + F+D   VG +++R   D  I+ + +  N 
Sbjct: 1045 GKVWVAMLSGTNATKKIFSKLLSSIFEAKLRFHDITPVGRIMNRFSKDMDIIDQQLIPNF 1104

Query: 273  SDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASG-N 331
               F +++   V + ++  I       L +FA PL       G      SREL++    N
Sbjct: 1105 EGLFYSVV---VCLWIVILIGYVTPRFL-IFAIPLCGLYYFVGALYLRASRELKRIDNIN 1160

Query: 332  LTKVAE---EQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLG 388
            ++ + +   E + G+ T+++   E + +     A+            +NA FF   +V  
Sbjct: 1161 VSPIHQLFTEAIKGVVTIRALADERRFITHTLEAIDG----------SNAPFFY-LSVAT 1209

Query: 389  DFSFLLVLAYGSHLVLQGNLTI--------GDLTAFMLYT--EYTGSAVFGLSTF--YSE 436
            ++    V   G+ ++   +L I          L   +L     +T +A + +  F     
Sbjct: 1210 EWITYRVDIIGALVLFSSSLMIIARAPYLDAGLAGILLSNAFSFTETAQWIIKVFSGVEL 1269

Query: 437  LMKGAGAATRLFEL-LDYKPTIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNF 495
            LM          E+ L++  +  S T     P  G++EF+++S  Y +  +++   +++F
Sbjct: 1270 LMSSVERIKEYIEVPLEFSKSNDSATSPVDWPQTGEIEFKNLSLRY-SPHSSKALDNVSF 1328

Query: 496  TIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQ 555
             +  G+ V IVG +G GKS+I + + R  +  SG I++D +DI  +S + LR  +  + Q
Sbjct: 1329 KVRTGTKVGIVGRTGAGKSSIIAAIYRLSDWESGTIIIDNKDIKCVSLECLRNSISCIPQ 1388

Query: 556  EPILMSGTIRENITYGVSRQPSMEEIRSVAK-------KCFC-----HAFISKFPNGYE- 602
             P L  GTIR N+    ++    +   ++AK       +  C         S  PN +  
Sbjct: 1389 NPTLFDGTIRSNLD-PYNQYSDKQVFDALAKVGLIERNEVLCLVTDRQQSSSFSPNKFSD 1447

Query: 603  --TIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKS 660
              +++   G+ LS GQ+Q + +AR++L   KI+++DEAT+++D  S+  I  T+   M++
Sbjct: 1448 LNSVVRSGGSNLSQGQRQLLCLARSMLGSRKIMLIDEATASIDYISDAKIQKTIRETMEN 1507

Query: 661  KELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
               TI++IAHRL ++     ++V+ + G V E     +L ++ ++  H L
Sbjct: 1508 T--TILTIAHRLRSVIDYNKILVMDM-GRVKEYDHPYNLISDKNTIFHHL 1554

 Score = 79.3 bits (194), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 74/235 (31%), Positives = 120/235 (51%), Gaps = 9/235 (3%)

Query: 470 GKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSG 529
            KV F+  +  +   +T+   K+++   +  S   I+GP+G GKS++   LL   N  SG
Sbjct: 662 SKVGFKDANMEWDADETSFKLKNISIEFKLNSLNAIIGPTGSGKSSLLLGLLGELNLCSG 721

Query: 530 KILV---DGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAK 586
           +I V   D +D  ++    +   +    Q P L+SGTI +NI +G   +P+     +V K
Sbjct: 722 QIYVPSVDSRDDLEVGIDGMTNSMAYCSQSPWLISGTIEDNIVFG--ERPNQRRFNAVIK 779

Query: 587 KCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVES 646
            C     +     G +T +G  G  LSGGQ+QR+A+ARA+ +  + L+LD+  SA+D E+
Sbjct: 780 ACCLEKDVKAMSAGLKTSVGGGGFSLSGGQQQRVALARAIYSSSRFLLLDDCLSAVDPET 839

Query: 647 EGAI--NYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDL 699
              I      G +MK +  T I  +H +S I +    +V+  +G V   GK  DL
Sbjct: 840 ALNIYEKCLCGPIMKGR--TCIITSHNISLITKKAEWLVILDNGEVKGQGKPSDL 892

>AGR047W Chr7 (802679..807157) [4479 bp, 1492 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YDR135C (YCF1)
          Length = 1492

 Score =  124 bits (310), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 126/502 (25%), Positives = 227/502 (45%), Gaps = 47/502 (9%)

Query: 229  LRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGM 288
            L  +++   +   M F++   +G +L+R   D Y V   + +  S  F         +  
Sbjct: 1003 LHESMLAAVLRAPMSFFETTPIGRILNRFSNDIYKVDELLARTFSQFF----ANTTRVSF 1058

Query: 289  MFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVA-----EEQLSGI 343
               +          F  PL +    Y       SREL++   ++TK       +E L+G+
Sbjct: 1059 TIIVICVTTWQFTFFVIPLAMLYIYYQQYYLKTSRELRRLD-SVTKSPVYAHFQETLNGV 1117

Query: 344  KTVQSFVAEGKEVH----RYNN---AVRQVFNVGKKEAF------TNATFFSSTNVLGDF 390
             +++ +    + +H    R NN   A     NV +  A+      +   FF++T      
Sbjct: 1118 SSIRGYGQLDRFIHINQARINNNTSAYYPSMNVNRWLAYRLEFIGSCIIFFAAT------ 1171

Query: 391  SFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFEL 450
              L V    S     G+LT G +   + Y      ++  +     E+     +  R+ E 
Sbjct: 1172 --LSVFRLAS-----GSLTSGMVGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEY 1224

Query: 451  LDYKPT----IKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIV 506
             + +P     I ++      P +G+++F++ S  Y     + I + +N  I+P   V IV
Sbjct: 1225 AELEPEAPQFIANSVPSGDWPKDGEIKFENYSTRYRP-GLDLILRGINLHIKPHERVGIV 1283

Query: 507  GPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRE 566
            G +G GKS++A  L R      G I +DG  I  +    LR++L ++ Q+  +  GT+R+
Sbjct: 1284 GRTGAGKSSLALSLFRIIEAAEGHISIDGVPIDTIGLTDLRKKLSIIPQDSQVFEGTVRD 1343

Query: 567  NITYGVSRQPSMEEIRSVAKKCFCHAFISKF-PNGYETIIGPRGALLSGGQKQRIAIARA 625
            NI    ++Q + E+I    +       +     +G +T +   G  LS GQ+Q + +ARA
Sbjct: 1344 NI--DPTKQYTDEQIWKALELSHLADHVKGMGSDGLDTPLTEGGKNLSVGQRQLMCLARA 1401

Query: 626  LLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLG 685
            LL   +IL+LDEAT+A+DVE++  I  T+      +  TI++IAHR++TI  S+ ++VL 
Sbjct: 1402 LLIPFRILVLDEATAAIDVETDKVIQDTIRSSFNDR--TILTIAHRINTIMDSDKIVVLD 1459

Query: 686  IDGSVVEMGKFKDLYANHDSAL 707
              G+V E    ++L    + ++
Sbjct: 1460 -KGTVAEFDTPENLLKKKEESI 1480

 Score = 94.0 bits (232), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 113/519 (21%), Positives = 227/519 (43%), Gaps = 68/519 (13%)

Query: 222 GERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALIC 281
           G  L + + S + KK +H   E    +  GD+++ +  DA  + R +TQ           
Sbjct: 355 GTDLRSGITSLIYKKALHLSNEASGTSATGDIVNLMSVDAQRL-RDLTQ----------W 403

Query: 282 GGVGIGMMFHISSTLASVLFLFAPPLLVGATI---------YGNKI-RAISRELQQASGN 331
           G V     F +   L S+  L  P + VG  +         Y +++ + + +E  +    
Sbjct: 404 GNVIWSGPFQLCLCLYSLHRLLGPCIWVGVVLLLFTLPLNSYISRVLKRLQKEQMKNKDE 463

Query: 332 LTKVAEEQLSGIKTVQSFVAE-----GKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNV 386
            T++  E L+ IK+++ +  E       +  R    ++ +  +G   AF N  +     +
Sbjct: 464 RTRLISEILNNIKSLKLYAWEIPYKEKLDYVRNQKELKTLRKMGLTTAFANFQYNIIPFL 523

Query: 387 LGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATR 446
           +   +F + +       L  +L    LT F L +         +++F    ++ + A  R
Sbjct: 524 VSCSTFAVFVLTQKGRPLTTDLVFPALTLFNLLSFPLAVLPIAITSF----IEASVAIGR 579

Query: 447 LFELLDYK----------PTIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQI-FKDLNF 495
           L   L  +          P +K+  G A    +      + +F +  +   ++  K++NF
Sbjct: 580 LTNFLTAEELQRDAITREPAVKAPGGVAVALAD------NATFLWQRKPEYKVALKNINF 633

Query: 496 TIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQ 555
             +     CI+G  G GKS +   +L      +G  +V G              +  V Q
Sbjct: 634 RAKKSELTCIIGKVGSGKSALIQAMLGDLFRVNGSAVVRGN-------------VAYVSQ 680

Query: 556 EPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGG 615
              +M+GT+R+NI +G   +   +  +   K C     +S  P+G  T +G +G  LSGG
Sbjct: 681 VAWIMNGTVRDNILFG--HKYDAKFYQQTIKACALTVDLSILPDGDNTFVGEKGISLSGG 738

Query: 616 QKQRIAIARALLNKPKILILDEATSALDVE-SEGAINYTLGR--LMKSKELTIISIAHRL 672
           QK R+++ARA+  +    +LD+  +A+D   ++  +    G   L+KSK   + +  +++
Sbjct: 739 QKARLSLARAVYARADTYLLDDPLAAVDEHVAKHLLQNVFGPNGLLKSKARVLTT--NKI 796

Query: 673 STIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLL 711
           + +  ++++++L  +G +V+ G F ++ ++ DSA+ KL+
Sbjct: 797 TALEIADHIVLLE-NGEIVQQGTFSEVISDEDSAISKLV 834

>ZYRO0G22176g Chr7 (1822665..1827377) [4713 bp, 1570 aa] {ON} similar
            to uniprot|P14772 Saccharomyces cerevisiae YLL015W BPT1
            ABC type transmembrane transporter of MRP/CFTR family
            found in vacuolar membrane involved in the transport of
            unconjugated bilirubin and in heavy metal detoxification
            via glutathione conjugates along with Ycf1p
          Length = 1570

 Score =  122 bits (306), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 129/503 (25%), Positives = 228/503 (45%), Gaps = 55/503 (10%)

Query: 242  MEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGMMFHISSTLASVLF 301
            M F++   +G +++R  +D   V R++  N +  FK ++   V I +   I   +   L 
Sbjct: 1075 MGFFESTPIGRIINRFSSDMSTVDRNLKYNFAFFFKCVLDYFVTILL---IGYNMPWFL- 1130

Query: 302  LFAPPLLVGATIYGNKIRAISRELQQASGN----LTKVAEEQLSGIKTVQSFVAEGKEVH 357
            +F   LLV    Y      +SREL++ S      +  +  E L G   + +F    +   
Sbjct: 1131 VFNAGLLVVYVYYQVFYVTLSRELKRLSSTAFSPIMSLFSETLGGHMVITAF----RHSE 1186

Query: 358  RYNNAVRQVFNVGKKEAFTNATF-FSSTNVLGDFSFLLVLAYGSHLVLQGNLTIG----- 411
            R++       N  K +   +A F   STN     S  L +  G+ +++   LT+      
Sbjct: 1187 RFH-----FLNFNKTQFQIDAQFNLRSTNRW--LSIRLQIIGGAMVLITALLTLATIGTK 1239

Query: 412  -DLTA-----FMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELL----DYKPTIKSTT 461
              +TA      M Y     +++  +    + +     +  R++E      +    I+S+ 
Sbjct: 1240 KQMTAGLVGLLMSYVLQVTNSLMWIVRMTTMIETNIISVERIYEYCQLPSEAPAIIESSR 1299

Query: 462  GKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLL 521
             +   P  G++ F+  S  Y   + + + K +N +I+P   + +VG +G GKS+++  L 
Sbjct: 1300 PEKSWPSMGEIIFKDYSTKY-RPELDPVLKKINLSIKPREKIGVVGRTGAGKSSLSLALF 1358

Query: 522  RYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEI 581
            R    T G I +DG DI+K+    LR  L ++ Q+     GT+R N+      Q S++EI
Sbjct: 1359 RLLESTGGSIEIDGVDISKIGLYDLRSHLSIIPQDAQAFEGTVRSNL--DPFNQYSVQEI 1416

Query: 582  RSVAKKCFCHAFISKF-----PN---------GYETIIGPRGALLSGGQKQRIAIARALL 627
                +       I K      P+           +  I   G  +S GQ+Q + ++RALL
Sbjct: 1417 WKAVELAHLKPHIIKMMTDEDPDKSSPEDEISALDVKISENGNNMSMGQRQLLCLSRALL 1476

Query: 628  NKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGID 687
            +K K+L+LDEAT+A+D+E++  I  T+    + K  TI++IAHR+ T+  S+ ++VL   
Sbjct: 1477 SKSKVLVLDEATAAVDMETDQIIQETIRNEFQDK--TILTIAHRIDTVLDSDKILVLD-K 1533

Query: 688  GSVVEMGKFKDLYANHDSALHKL 710
            G V E      L  +  S  + L
Sbjct: 1534 GEVKEFESPDTLLKDEKSLFYGL 1556

 Score = 82.0 bits (201), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 67/224 (29%), Positives = 114/224 (50%), Gaps = 17/224 (7%)

Query: 494 NFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSG-KILVDGQDITKLSSKSLRRQLGV 552
           +F  + G+  C+VG  G GKST+   +L      SG K  +  + + +       R +  
Sbjct: 661 HFEAKKGALTCVVGRVGSGKSTLLRAILGQLPCRSGPKEFISPEILVR------ARSVAY 714

Query: 553 VQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALL 612
             Q P +M+ +I++NI +G     +   +    K C     +     G ET++G +G  L
Sbjct: 715 CPQAPWVMNASIKDNILFGHRYDETYYNL--TIKACQLIPDLKILSEGDETLVGEKGISL 772

Query: 613 SGGQKQRIAIARALLNKPKILILDEATSALDVE-SEGAINYTLGR---LMKSKELTIISI 668
           SGGQK R+++ARA+ ++  + ++D+  SA+D E S+  I+  LG    L+K K  TII  
Sbjct: 773 SGGQKARLSLARAVYSRADLYLMDDILSAVDAEVSKNIIDKVLGEENGLLKHK--TIILT 830

Query: 669 AHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYAN-HDSALHKLL 711
            + +S ++ S N+I     G +VE G ++   +   DS L KL+
Sbjct: 831 TNAVSVLKHS-NMIYALQGGRIVEEGTYEQAVSRGDDSVLQKLI 873

>KLTH0B09724g Chr2 complement(796023..800483) [4461 bp, 1486 aa] {ON}
            similar to uniprot|P53049 Saccharomyces cerevisiae
            YGR281W YOR1 Plasma membrane transporter of the ATP-
            binding cassette (ABC) family mediates export of many
            different organic anions including oligomycin
          Length = 1486

 Score =  122 bits (305), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 124/511 (24%), Positives = 221/511 (43%), Gaps = 38/511 (7%)

Query: 217  LLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGF 276
            L+  +G     RL    +++ +H  M F D   +G +L+R   D   V   +T+++   F
Sbjct: 964  LICYIGLSAAKRLNLKAVQRLLHTPMSFLDTTPIGRVLNRFTKDTDTVDTELTESVR-LF 1022

Query: 277  KALICGGVGIGMMFHISSTLASVLFLFAPPLLVG-ATIYGNKIRAISRELQQASGNLTKV 335
               +   VG+ +M  I     ++   F   + VG A  Y +  R I R       ++   
Sbjct: 1023 VFQLSNIVGVIVMCIIYLPWFAIAVPFLMLVFVGVADHYQSSSREIKRLEAVQRSHVFNN 1082

Query: 336  AEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGK-KEAFTNATFFSSTNVLGDFSFLL 394
              E L G+ T++++  E + + + +    ++   G    A       +   +   F+ ++
Sbjct: 1083 FNEVLGGMDTIRAYRGERRFLTKSDFLTNKMNEAGYLVVAIQRWVAIALDMIAMAFALIV 1142

Query: 395  VLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYK 454
             L   +        ++G L  ++L  +  G     L+     + +G         L+ Y 
Sbjct: 1143 TLLCVTRQFHISAASVGVLLTYVL--QLPGL----LNMLLRAMTQGENDMNSTERLISYA 1196

Query: 455  PTIK--------STTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIV 506
              +           +  A  P +G++EF HVS +Y       + KD+   +  G  + I 
Sbjct: 1197 TELPLEAAYRRPEMSPPAEWPTDGRIEFDHVSLAYRP-GLPLVLKDVTLHVAAGEKIGIC 1255

Query: 507  GPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRE 566
            G +G GKSTI S L R      G I +DG DI+ L    LR +L ++ Q+P++  G +R+
Sbjct: 1256 GRTGAGKSTIMSALYRMCELHDGSITIDGVDISTLGLYDLRSKLSIIPQDPVMFKGDVRK 1315

Query: 567  N-----------ITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGY----ETIIGPRGAL 611
            N           + + + R  ++        +   H       N +    +  +   G  
Sbjct: 1316 NLDPFHERTDDELWHALVRGGAIPAESLATVRAQTHENAGSLSNMHKFHLQQEVEEDGTN 1375

Query: 612  LSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKS-KELTIISIAH 670
             S G++Q +A+ RAL+ + KILILDEATS++D E++  I     R++++    TI+ IAH
Sbjct: 1376 FSLGERQLLALTRALVRQSKILILDEATSSVDYETDAKIQ---TRIVEAFSNCTILCIAH 1432

Query: 671  RLSTIRRSENVIVLGIDGSVVEMGKFKDLYA 701
            RL+TI   + ++VL   G V E      LYA
Sbjct: 1433 RLNTILDYDRILVLD-QGRVCEFDTPAALYA 1462

 Score = 87.8 bits (216), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 73/235 (31%), Positives = 106/235 (45%), Gaps = 36/235 (15%)

Query: 490 FKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQ 549
           F +LN  I  G  V + G  G GKS++   L  +   T G I  DG  +           
Sbjct: 603 FDNLNIQITKGELVIVTGSVGTGKSSLLYALSGFMKKTGGDIYKDGTML----------- 651

Query: 550 LGVVQQEPILMSGTIRENITYGVSRQPSME-EIRSVAKKCFCHAFISKFPNGYETIIGPR 608
              +   P + + T+R+NI +G    P  E     + + C   A +   P G  T IG R
Sbjct: 652 ---LCGYPWIQNATVRDNILFG---SPYNEARYNEIIRVCSLQADLELLPAGDRTEIGER 705

Query: 609 GALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAI--NYTLGRLMKSKELTII 666
           G  LSGGQK RI +ARA+  K  I + D+  SA+D      I     +G+L  S   T +
Sbjct: 706 GITLSGGQKARINLARAVYKKKDIYLFDDVLSAVDARVGKHIMDECLMGKLEGS---TRV 762

Query: 667 SIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDL------------YANHDSALHK 709
              H+LS I R+  VI + +DGS V++G  ++L            Y+NH  +  K
Sbjct: 763 LATHQLSLIARASKVIYIDLDGS-VDVGSVEELKKRKPGFVNLMQYSNHSESEKK 816

>YLL015W Chr12 (116432..121111) [4680 bp, 1559 aa] {ON}  BPT1ABC type
            transmembrane transporter of MRP/CFTR family, found in
            vacuolar membrane, involved in the transport of
            unconjugated bilirubin and in heavy metal detoxification
            via glutathione conjugates, along with Ycf1p
          Length = 1559

 Score =  120 bits (302), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 142/535 (26%), Positives = 249/535 (46%), Gaps = 54/535 (10%)

Query: 211  NFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQ 270
            N   +++L     R   +L  ++ K  +   M F++   VG +++R  +D   V  ++  
Sbjct: 1036 NLRSIMMLLYCSIRGSKKLHESMAKSVIRSPMTFFETTPVGRIINRFSSDMDAVDSNLQY 1095

Query: 271  NISDGFKALICGGVGIGMM-FHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQ-- 327
              S  FK+++   V + ++ +++   L   +FL     +V    Y      +SREL++  
Sbjct: 1096 IFSFFFKSILTYLVTVILVGYNMPWFLVFNMFL-----VVIYIYYQTFYIVLSRELKRLI 1150

Query: 328  --ASGNLTKVAEEQLSGIKTV------QSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNAT 379
              +   +  +  E L+G   +      + F+    E  +YN  V  VFN      + +  
Sbjct: 1151 SISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQYN--VDFVFNFRSTNRWLSVR 1208

Query: 380  F--FSSTNVLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYT-EYTGSAVFGLSTFYSE 436
                 +T VL   + +L LA    +  +  L+ G +   M Y+ E TGS  + + T  + 
Sbjct: 1209 LQTIGATIVLA--TAILALA---TMNTKRQLSSGMVGLLMSYSLEVTGSLTWIVRTTVT- 1262

Query: 437  LMKGAGAATRLFELLDYKPTIKSTTGKAFK----PLNGKVEFQHVSFSYPTRKTNQIFKD 492
            +     +  R+ E  +  P  +S   +       P  G +EF++ S  Y     + +  +
Sbjct: 1263 IETNIVSVERIVEYCELPPEAQSINPEKRPDENWPSKGGIEFKNYSTKY-RENLDPVLNN 1321

Query: 493  LNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGV 552
            +N  IEP   V IVG +G GKST++  L R   PT GKI++DG DI+ +    LR  L +
Sbjct: 1322 INVKIEPCEKVGIVGRTGAGKSTLSLALFRILEPTEGKIIIDGIDISDIGLFDLRSHLAI 1381

Query: 553  VQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKF----PNG-------- 600
            + Q+     GT++ N+      + S +E++   ++      + K     P G        
Sbjct: 1382 IPQDAQAFEGTVKTNL--DPFNRYSEDELKRAVEQAHLKPHLEKMLHSKPRGDDSNEEDG 1439

Query: 601  -----YETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLG 655
                  +  I   G+ LS GQ+Q + +ARALLN+ KIL+LDEAT+++D+E++  I  T+ 
Sbjct: 1440 NVNDILDVKINENGSNLSVGQRQLLCLARALLNRSKILVLDEATASVDMETDKIIQDTIR 1499

Query: 656  RLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
            R  K +  TI++IAHR+ T+  S+ +IVL   GSV E      L ++  S  + L
Sbjct: 1500 REFKDR--TILTIAHRIDTVLDSDKIIVLD-QGSVREFDSPSKLLSDKTSIFYSL 1551

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 89/301 (29%), Positives = 147/301 (48%), Gaps = 27/301 (8%)

Query: 494 NFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSG-KILVDGQDITKLSSKSLRRQLGV 552
           +F  + G  VC+VG  G GKST    +L      SG +  +  + I + SS      +  
Sbjct: 659 HFEAKRGDLVCVVGRVGAGKSTFLKAILGQLPCMSGSRDSIPPKLIIRSSS------VAY 712

Query: 553 VQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALL 612
             QE  +M+ ++RENI +G        ++    K C     +   P+G ET++G +G  L
Sbjct: 713 CSQESWIMNASVRENILFGHKFDQDYYDL--TIKACQLLPDLKILPDGDETLVGEKGISL 770

Query: 613 SGGQKQRIAIARALLNKPKILILDEATSALDVE-SEGAINYTL-GRLMKSKELTIISIAH 670
           SGGQK R+++ARA+ ++  I +LD+  SA+D E S+  I Y L G+    K  TII   +
Sbjct: 771 SGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEYVLIGKTALLKNKTIILTTN 830

Query: 671 RLSTIRRSENVIVLGIDGSVVEMGKFKDLY--ANHDSALHKLLTXXXXXXXXXXXXYAPP 728
            +S ++ S+ +  L  +G +VE G ++D+    N+ S L KLL              +P 
Sbjct: 831 TVSILKHSQMIYALE-NGEIVEQGNYEDVMNRKNNTSKLKKLLEEFD----------SPI 879

Query: 729 AITQESEPQTEENGKDDSGEDQNSDHEENSQDQNEKRLQEEVIHQVLEDISHDQKTSTLR 788
               ES+ QTE   + +  E       E S+ ++E   + E+  ++++  S     +TLR
Sbjct: 880 DNGNESDVQTEHRSESEVDEPLQLKVTE-SETEDEVVTESEL--ELIKANSRRASLATLR 936

Query: 789 P 789
           P
Sbjct: 937 P 937

>TPHA0A05620 Chr1 (1273220..1277653) [4434 bp, 1477 aa] {ON} Anc_5.10
            YGR281W
          Length = 1477

 Score =  120 bits (301), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 130/522 (24%), Positives = 221/522 (42%), Gaps = 66/522 (12%)

Query: 229  LRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGM 288
            L    +K+ +H  M F D   +G +L+R   D   +   + +N+           VG+ +
Sbjct: 968  LNIQALKRIIHTPMSFMDTTPIGRILNRFTKDTDSLDNELIENVRLTVSQF-ANIVGVCV 1026

Query: 289  M-------FHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEEQLS 341
            M       F I+      +F+F       A     ++ AI R     + N      E L 
Sbjct: 1027 MCIVYLPWFAIAVPFLVFIFVFIQNHYQSAGREIKRLEAIQRSFVYNNFN------EILG 1080

Query: 342  GIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAYGSH 401
            G+ T++ + +E + + + +  + ++   G    +          +L D   ++ +A+   
Sbjct: 1081 GMDTIKFYKSEERYIAKSDYLIDKMNEAG----YLTVCVQRWVAILVD---MIAVAFALI 1133

Query: 402  LVL-----QGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRL--------F 448
            + L     Q +++   +   + Y          L    S++     +  RL         
Sbjct: 1134 ITLLCVTRQFHISASSVGVLLTYVLQLPGLFNTLLRAVSQVENDMNSTERLVSYATDLPL 1193

Query: 449  ELLDYKPTIKSTTGKAFKPLNGKVEFQHVSFSY-PTRKTNQIFKDLNFTIEPGSNVCIVG 507
            E   +KP    T      P  G ++F++V F+Y P      + K++N  I     + I G
Sbjct: 1194 EAQYHKP---ETAPPESWPEEGTIKFENVDFAYRPGLPI--VLKNINLQINGTEKIGICG 1248

Query: 508  PSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIREN 567
             +G GKSTI + L R    TSG IL+D  DI KL    LR++L ++ Q+P+L  G IR+N
Sbjct: 1249 RTGAGKSTIMTALYRLNELTSGSILIDDVDINKLGLHELRKKLAIIPQDPVLFRGDIRKN 1308

Query: 568  ITYGVSRQPSMEEIRSV------------AKKCFCH-------AFISKFPNGYETIIGPR 608
            +     R    EE+  V            A+    H       A + KF    + ++   
Sbjct: 1309 LDPFHERTD--EELWDVLVRGGAIAPEDLAETKAQHITEDGTSADLHKF--HLDKVVEED 1364

Query: 609  GALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISI 668
            GA  S G++Q +A+ RAL+   KILILDEATS++D E++  I   +         TI+ I
Sbjct: 1365 GANFSLGERQILALTRALVRNTKILILDEATSSVDYETDRKIQERIATAF--SHCTILCI 1422

Query: 669  AHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
            AHRL TI   + ++VL   G V E     +L+ +  +  H +
Sbjct: 1423 AHRLKTILNYDRILVLE-HGEVAEFDTPMNLFKDETTIFHNM 1463

 Score = 97.1 bits (240), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 68/206 (33%), Positives = 111/206 (53%), Gaps = 20/206 (9%)

Query: 490 FKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQ 549
           F +LNF I+ G  V I GP G GK+++ +    +   TSG I ++G D+           
Sbjct: 612 FTNLNFEIKKGEFVMITGPIGTGKTSLLNSFAGFMEKTSGTIQING-DL----------- 659

Query: 550 LGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRG 609
             ++   P + + T+R+NI +G   +   ++ + V + C   + +   P G +T IG RG
Sbjct: 660 --LMGGYPWIQNATVRDNIIFGSPYEE--DKYKEVLRACSLESDLDILPAGDKTEIGERG 715

Query: 610 ALLSGGQKQRIAIARALLNKPKILILDEATSALDVE-SEGAINYTLGRLMKSKELTIISI 668
             LSGGQK RI +AR +  +  I +LD+  SA+D    +  ++  L +L+ +K  T +  
Sbjct: 716 ITLSGGQKARINLARCVYKEKDIYLLDDVLSAVDSRVGKHIMDECLTKLIGNK--TRLLA 773

Query: 669 AHRLSTIRRSENVIVLGIDGSVVEMG 694
            H+LS I ++  +IVLG DGS VE+G
Sbjct: 774 THQLSLIDKASRIIVLGNDGS-VEIG 798

>ACL072C Chr3 complement(224562..229445) [4884 bp, 1627 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLL048C
            (YBT1) and YHL035C
          Length = 1627

 Score =  120 bits (300), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 121/504 (24%), Positives = 224/504 (44%), Gaps = 41/504 (8%)

Query: 233  VIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALI-CGGVGIGMMFH 291
            V+ K +H  M F+D    G +++RL  D   V + +       F A++ C    + + + 
Sbjct: 1114 VLWKILHAKMRFFDATPTGRIMNRLSKDLEAVDQELIPYFEGSFAAVVQCISTLVLIAYV 1173

Query: 292  ISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEEQLSGIKTVQSFVA 351
                L   +F+     L+G   Y    R + R        + +   E L GI +++++  
Sbjct: 1174 TPQFLIMAIFIGFLYALIG-YFYVTTSRELKRFESITRSPIYQHFSETLVGITSIRAYGD 1232

Query: 352  EGK----EVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAYGSHLVLQ-G 406
            E +     + R ++  R  F +       N       ++LG    L+    G  + L  G
Sbjct: 1233 ERRFMLENLSRIDDNNRPFFYLW----IANRWLAFRVDLLGA---LVTFFSGLFIYLNIG 1285

Query: 407  NLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIKSTTGKA-- 464
             L  G     + Y  +           YS +     +  RL E ++ +    +   +   
Sbjct: 1286 KLDAGLAGISLTYAIFFTEGALWFVRHYSNVEMTMNSFERLKEYMEIEQEPYNENAQLPP 1345

Query: 465  -FKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRY 523
               P +G+++   +S  Y      ++ K++NF++EP   V IVG +G GKSTI + + R+
Sbjct: 1346 DNWPQHGRIDVSDLSLRYAP-NLPKVIKNVNFSVEPKLKVGIVGRTGAGKSTIITAMFRF 1404

Query: 524  YNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRS 583
             +P +G + +D  DIT +    LR+ + ++ Q+P L +GT++  +      Q S ++I  
Sbjct: 1405 LDPETGFVKIDNIDITTIPLHRLRQSITIIPQDPTLFTGTLKSIL--DPYSQYSDKQIYE 1462

Query: 584  VAKKCFCHA-----------------FISKFPNGYETIIGPRGALLSGGQKQRIAIARAL 626
              ++    +                  I+KF +     +   GA LS GQ+Q + +AR+L
Sbjct: 1463 ALQRVNLLSDTDINSLSSPSTQSSGENINKFLD-LNNEVTEGGANLSQGQRQLVCLARSL 1521

Query: 627  LNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGI 686
            L  PKI++LDEAT+++D  S+  I  T+    + ++ TI++IAHRL +I   + V+V+  
Sbjct: 1522 LRSPKIIMLDEATASIDYTSDEKIQQTIRE--EFRDSTILTIAHRLKSIIDYDKVLVMD- 1578

Query: 687  DGSVVEMGKFKDLYANHDSALHKL 710
             G V E      L  N ++  + +
Sbjct: 1579 AGEVKEYDHPYSLLLNKNTIFYNM 1602

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 98/402 (24%), Positives = 173/402 (43%), Gaps = 46/402 (11%)

Query: 321 ISRELQQASGNLTKVA-----------EEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNV 369
           ++ +L Q  GNLT V             E L  I+ ++ F  E        N  ++V  +
Sbjct: 514 LNYKLAQKLGNLTVVTLGFTDKRIQKLNETLQSIRIIKFFAWE-------TNFEKEVQAI 566

Query: 370 GKKEAFTNATFFSSTNVLGDFSFLLVL--------AYGSHLVLQGN-LTIG-DLTAFMLY 419
            + E    AT      V    SFL  +        ++  ++ +QG  LTI    TA  L+
Sbjct: 567 REDEL---ATLLKRAIVWSAISFLWFMVSTIVVSASFACYIYIQGEVLTIPVAFTALSLF 623

Query: 420 TEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIKSTTGKAFKPLNGKVEFQHVSF 479
                + +  L+   S +++   +  R+   LD   T K    +       ++ F++ + 
Sbjct: 624 VMLR-NPLDVLADMLSYVVQSKVSLDRIQAFLDEDETTKY---EQLTISGNRLAFENATI 679

Query: 480 SYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILV---DGQ 536
           ++    ++   ++++     G      GP+G GKS++   LL       GKI V   D +
Sbjct: 680 AWNDDPSSFRLRNIDIEFMIGKLNVAFGPTGTGKSSLLLGLLGEMTLQEGKIYVPSLDPR 739

Query: 537 DITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEE-IRSVAKKCFCHAFIS 595
           +   + +  L   +    Q   L++ T R NI +     P  E+    V + C       
Sbjct: 740 EDLVIQADGLTNSIAYCSQSAWLLNDTARSNILFN---SPYNEQRYNDVLEACGLKKDFE 796

Query: 596 KFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAI--NYT 653
               G  T IG +G  LSGGQKQRI++ARAL +  + L+LD+  SA+D  +   I  N  
Sbjct: 797 ILSGGDLTQIGEKGMTLSGGQKQRISLARALYSSARHLLLDDCLSAVDSHTALLIYENCI 856

Query: 654 LGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGK 695
           +G LM+ +  T + ++H ++   R+ + +V+  +G V   G+
Sbjct: 857 IGPLMEGR--TCVLVSHNVALTMRNADWVVILENGRVKAQGE 896

>Kwal_26.9532 s26 complement(1256241..1260656) [4416 bp, 1471 aa] {ON}
            YGR281W (YOR1) - ABC transporter [contig 363] FULL
          Length = 1471

 Score =  117 bits (292), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 122/504 (24%), Positives = 215/504 (42%), Gaps = 40/504 (7%)

Query: 217  LLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDG- 275
            +L  +G      L    +K+ +H  M F D   +G +L+R   D   +   +T+++    
Sbjct: 949  VLCYMGLSAAKWLNLKAVKRLLHTPMSFLDTTPIGRVLNRFTKDTDTLDTELTESVRLFL 1008

Query: 276  FKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATI---YGNKIRAISRELQQASGNL 332
            F+A    GV I  + ++     +V FL    LL+ A +   Y +  R I R       ++
Sbjct: 1009 FQASNIVGVVIMCIIYLPWFAIAVPFL----LLIFAAVADHYQSSSREIKRLEAVQRSHV 1064

Query: 333  TKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSF 392
                 E LSG+ T++++  E + + + +  + ++   G            + +++   +F
Sbjct: 1065 FNNFNEVLSGMDTIRAYRGEARFLTKSDFLINKMNEAGYVVVAIQRWVSIALDMIA-MAF 1123

Query: 393  LLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLD 452
             L++     L +    +I   +  +L T Y       L+T    + +G         L+ 
Sbjct: 1124 ALIITL---LCVTRQFSISAASVGVLLT-YVLQLPGLLNTLMRAMTQGENDMNSAERLIS 1179

Query: 453  YKPTIK--------STTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVC 504
            Y   +          T+     P  G ++F HVS +Y       +  D++  +  G  + 
Sbjct: 1180 YATDLPLEAAYRRPETSPPESWPSEGAIDFDHVSLAYRP-GLPLVLHDVSLHVRGGEKIG 1238

Query: 505  IVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTI 564
            I G +G GKSTI S L R      G I +DG DI +L    LR +L ++ Q+P+L  G +
Sbjct: 1239 ICGRTGAGKSTIMSALYRMIELHDGSITIDGIDIAQLGLYELRSKLAIIPQDPVLFKGDV 1298

Query: 565  RENITYGVSRQPSM---------------EEIRSVAKKCFCHAFISKFPNGYETIIGPRG 609
            R+N+     R  +                E       +    A  +      E  +   G
Sbjct: 1299 RKNLDPFHERSDNELWDALVRAGAIATEDEAAARAVTRATAGALTNLHKFHLEQEVEEDG 1358

Query: 610  ALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIA 669
            +  S G++Q +A+ RAL+   +ILILDEATS++D E++  I   +       E T++ IA
Sbjct: 1359 SNFSLGERQLLALTRALVRSSRILILDEATSSVDYETDAKIQARIADAF--SECTVLCIA 1416

Query: 670  HRLSTIRRSENVIVLGIDGSVVEM 693
            HRL+TI   + ++VL   G V E 
Sbjct: 1417 HRLNTILDYDRILVLD-QGRVCEF 1439

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 77/270 (28%), Positives = 122/270 (45%), Gaps = 46/270 (17%)

Query: 490 FKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQ 549
           FK+LN  I  G  V + G  G GKS++ + +  +    SG I  +G         SL   
Sbjct: 594 FKNLNIEIAKGELVIVTGSVGTGKSSLLAAMSGFMKKKSGDIYKNG---------SL--- 641

Query: 550 LGVVQQEPILMSGTIRENITYGVSRQPSME-EIRSVAKKCFCHAFISKFPNGYETIIGPR 608
             ++   P + + T+++NI +G    P  E   +   + C   A +   P G +T IG R
Sbjct: 642 --LLCGYPWIQNTTVKDNILFG---SPFDEARYKETIRVCSLQADLDLLPAGDKTEIGER 696

Query: 609 GALLSGGQKQRIAIARALLNKPKILILDEATSALDVE-SEGAINYTLGRLMKSKELTIIS 667
           G  LSGGQK RI +AR++  K  I + D+  SA+D    +  ++  +   +  K  T + 
Sbjct: 697 GITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDARVGKHIMDECMMGALDGK--TRVL 754

Query: 668 IAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLLTXXXXXXXXXXXXYAP 727
             H+LS I R+  VI + +DG+ V+ G   +L + H +   KL+             Y+ 
Sbjct: 755 ATHQLSLIARASKVIFIDLDGT-VDSGTLDELKSRH-AGFVKLM------------EYSN 800

Query: 728 PAITQESEPQTEENGKDDSGEDQNSDHEEN 757
              T E E           G+D   +HEEN
Sbjct: 801 HTSTDEEE-----------GQDGEVEHEEN 819

>YKR104W Chr11 (656836..657756) [921 bp, 306 aa] {ON} Putative
           transporter of the multidrug resistance-associated
           protein (MRP) subfamily; contains a stop codon in S288C;
           adjacent ORFs YKR103W and YKR104W are merged in
           different strain backgrounds
          Length = 306

 Score =  110 bits (276), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 75/254 (29%), Positives = 134/254 (52%), Gaps = 37/254 (14%)

Query: 467 PLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNP 526
           P  G VE +++S  Y +  +++   +++F ++ G+ V IVG +G GKS+I + + R  + 
Sbjct: 28  PQTGDVELKNLSLRY-SPHSSKALDNVSFKVKAGTKVGIVGRTGAGKSSIIAAIYRLSDW 86

Query: 527 TSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENI----------TYGV-SRQ 575
            +G I +D +DI  +  + LR  +  + Q+P L  GT+R N+           YGV S+ 
Sbjct: 87  ENGTITIDNKDIKHIPLERLRNSISCIPQDPTLFDGTVRSNLDPFDRYSDVQIYGVLSKV 146

Query: 576 PSMEEIRSVAKKCFCHAFISKFPN-----------GYETIIGPRGALLSGGQKQRIAIAR 624
             +EE   +     C  F  + PN              T++   G+ LS GQ+Q + +AR
Sbjct: 147 GLIEECDEL-----CLIFEQEQPNFSSHKLRNRFIDLNTVVKSGGSNLSQGQRQLLCLAR 201

Query: 625 ALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVL 684
           ++L    I+++DEAT+++D  S+  I  T+   MK+   TI++IAHRL ++   + ++V+
Sbjct: 202 SMLGARNIMLIDEATASIDYISDAKIQKTIRETMKNT--TILTIAHRLRSVIDYDKILVM 259

Query: 685 GIDGSVVEMGKFKD 698
                  EMG+ K+
Sbjct: 260 -------EMGRVKE 266

>KLLA0C14234g Chr3 (1234598..1238962) [4365 bp, 1454 aa] {ON} similar
            to uniprot|P53049 Saccharomyces cerevisiae YGR281W YOR1
            Plasma membrane transporter of the ATP- binding cassette
            (ABC) family mediates export of many different organic
            anions including oligomycin
          Length = 1454

 Score =  116 bits (291), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 131/536 (24%), Positives = 238/536 (44%), Gaps = 60/536 (11%)

Query: 212  FGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQN 271
            F + + + +LG      L    +++ +H  M F D   +G +++R   D    + ++   
Sbjct: 927  FTQFISIGLLGTYASKHLNIKALQRLLHAPMSFMDVTPIGRVMNRFTKD----TDTLDNE 982

Query: 272  ISDGFKALICGGVGIGMMFHISSTLASV--------LFLFAPPLLVGATIY-GNKIRAIS 322
            I++  + LI         F I++    +         F  A P LV   ++  +  +A  
Sbjct: 983  ITESVRLLI---------FQIANLTGIIILCIIYIPWFAIAMPFLVFLYVFVADHYQASG 1033

Query: 323  RELQQASGNLTKVA----EEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNA 378
            RE+++              E L G+ T++++ +E + + + +  + ++   G        
Sbjct: 1034 REIKRMDAVQRSFVYNNFNEVLGGMDTIKAYRSEQRFLMKSDFLINKMNEAGYLVTSIQR 1093

Query: 379  TFFSSTNVLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELM 438
                S ++L    F L++A    +  Q +++ G +   + Y       +  L    ++  
Sbjct: 1094 WVAISLDMLA-VIFALIIALLC-VTRQFHVSAGSVGVMVTYVLQLPGLLNALLRSQTQTE 1151

Query: 439  KGAGAATRL----FEL-LDYKPTIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDL 493
                +A RL    ++L ++ K  I  T      P  G+++F++VS +Y       +    
Sbjct: 1152 NDLNSAERLVNYAYDLPIEAKYRILETQPPEQWPSEGRIKFENVSLAYRPELPVAL---K 1208

Query: 494  NFTIEPGSN--VCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLG 551
            N +I+ GSN  + I G +G GKSTI S L R     +GKI +D  DI+ L    LR +L 
Sbjct: 1209 NVSIDIGSNEKIGICGRTGAGKSTIMSALYRLVELKTGKITIDDIDISTLGLYELRSKLA 1268

Query: 552  VVQQEPILMSGTIREN----------------ITYGVSRQPSMEEIRSVAKKCFCHAFIS 595
            ++ Q+P+L  G IR N                +  G   +  ++ IR+  K     +   
Sbjct: 1269 IIPQDPVLFKGDIRRNLDPFQECTDEQLWDALVRGGAIDRKDVDSIRAQHKDANGLSG-D 1327

Query: 596  KFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLG 655
             F    + ++   G+  S G++Q +A+ RAL+   KILILDEATS++D  ++  I     
Sbjct: 1328 MFKFHLDQMVEDDGSNFSLGERQLLALTRALVRGSKILILDEATSSVDYATDAKIQ---S 1384

Query: 656  RLMKS-KELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
            R+++     TI+ IAHRL TI     ++VL   G VVE    K LY + DS  +++
Sbjct: 1385 RIVEEFSNCTILCIAHRLKTILAYNRILVLD-QGQVVEFDTPKKLYNDRDSIFNEM 1439

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 70/228 (30%), Positives = 112/228 (49%), Gaps = 30/228 (13%)

Query: 490 FKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQ 549
           F  LNF ++    + I GP G GKS++ + L  +   +SG + + G D+           
Sbjct: 592 FHGLNFDVKENEFIIITGPIGTGKSSLLNALAGFMRRSSGSMTIKG-DL----------- 639

Query: 550 LGVVQQEPILMSGTIRENITYGVS-RQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPR 608
             ++   P + + T+++NI +G    +P  +++  +   C   A +   P G  T IG R
Sbjct: 640 --LLCGYPWVQNATVKDNILFGSPFDKPKYQKVIEI---CSLQADLDILPAGDRTEIGER 694

Query: 609 GALLSGGQKQRIAIARALLNKPKILILDEATSALDVE-SEGAINYTLGRLMKSKELTIIS 667
           G  LSGGQK RIA+AR++     I + D+  SA+D    +  ++  +   +K K  T I 
Sbjct: 695 GITLSGGQKARIALARSVYKDMDIYLFDDVLSAVDSRVCKHIVDECMMGYLKQK--TRIL 752

Query: 668 IAHRLSTIRRSENVIVLGIDGS-----VVEMGK----FKDLYANHDSA 706
             H+LS I ++  VI LG+DGS     V E+ K    F DL    +SA
Sbjct: 753 ATHQLSLIDKASRVIFLGLDGSFDIGTVPELLKRNTGFSDLMQFQNSA 800

>TBLA0A06840 Chr1 (1666910..1670086) [3177 bp, 1058 aa] {ON} Anc_5.10
            YGR281W possible pseudogene; NNN added to avoid internal
            stop codon; truncated at 5' end
          Length = 1058

 Score =  115 bits (289), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 78/250 (31%), Positives = 131/250 (52%), Gaps = 17/250 (6%)

Query: 467  PLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNP 526
            P NGK++F+  +F Y       I K+ N  ++ G  + I G +G GKSTI + L R    
Sbjct: 797  PENGKIQFKDANFRYK-EGLPLILKNFNMLVQSGEKIGICGRTGAGKSTIMNCLFRLDEL 855

Query: 527  TSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENIT-YGVSRQPSMEEIRSVA 585
            T G I +D  DI+ L    LR+ L ++ Q+PIL  GTIR+N+  +      ++ E   ++
Sbjct: 856  TDGAIYIDDIDISTLGLHDLRKNLSIIPQDPILFEGTIRKNLDPFSYFDDATLWEAMILS 915

Query: 586  ----KKCFCHAFISKFPNGYETI-------IGPRGALLSGGQKQRIAIARALLNKPKILI 634
                +  F H F  K  N  E         +   G   S G+KQ +A  RA+++  K+++
Sbjct: 916  GFIDRDTFGH-FSEKPVNNKELTKFHLTAHVEEDGTNYSLGEKQLLAFTRAIIHHSKVVV 974

Query: 635  LDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMG 694
            LDEA+S++D E++  I   + +       TI+ IAHRL+TI + + ++VL   G+++   
Sbjct: 975  LDEASSSVDYETDAKIQTLISKQFSHN--TILCIAHRLNTILKYDRILVLD-HGNIIGFE 1031

Query: 695  KFKDLYANHD 704
              + L+ N++
Sbjct: 1032 NPRVLFENNE 1041

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 68/212 (32%), Positives = 101/212 (47%), Gaps = 22/212 (10%)

Query: 490 FKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQ 549
           F +LNF+I  G  + I GP G GK+++   +        G I +DG             Q
Sbjct: 205 FNNLNFSIX-GEFIIITGPIGTGKTSLLYAMSGLMKKLEGTIEIDGN-----------LQ 252

Query: 550 LGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRG 609
           L      P + + T+R+NI +G   +   E+   V + C     +  F     T IG  G
Sbjct: 253 LC---GYPWVQNTTVRDNIIFGSKYEK--EKFDHVIRICALTEDLENFSGKDLTEIGELG 307

Query: 610 ALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAI--NYTLGRLMKSKELTIIS 667
             LSGGQK RI +ARA+     I + D+  SA+D      I  N  LG L  S +   I 
Sbjct: 308 ITLSGGQKARINLARAIYKTSDIYLFDDILSAVDSRVGNFIMENCLLGAL--SGKTXXIL 365

Query: 668 IAHRLSTIRRSENVIVLGIDGSVVEMGKFKDL 699
             H+LS I++++ ++VLG D S  E+G +K+L
Sbjct: 366 ATHQLSLIKKADRIVVLGNDNS-FEIGPYKEL 396

>Zrou_YGOB_Anc_5.10 Chr3 complement(92067..95045) [2979 bp, 992 aa]
           {ON} ANNOTATED BY YGOB -
          Length = 992

 Score =  114 bits (286), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 132/535 (24%), Positives = 233/535 (43%), Gaps = 74/535 (13%)

Query: 214 RVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNIS 273
           +  +L  LG      L    +K  +H  + F D   +G +L+R   D   +   +T++I 
Sbjct: 467 QFTVLCFLGVTASKFLNLKAVKGILHTPLSFMDTTPLGRILNRFTKDTDSMDNELTEDIR 526

Query: 274 DGFKALICGGVGIGMMFHISSTLASVLF------LFA---PPLLVGATIYGNKIRAISRE 324
                         MMF + + +  ++        FA   P LL+   +  +  ++  RE
Sbjct: 527 -------------LMMFQLGNIIGVIVMCIVYLPWFAIAVPFLLIMFVMIADHYQSSGRE 573

Query: 325 LQQASG--------NLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFT 376
           +++           NL +V    L G+ T++++ ++ + + + +  + ++   G   A  
Sbjct: 574 VKRLEAVQRSFVYNNLNEV----LGGLDTIRAYRSQDRFLVKSDFLINKMNEAGYMVAAL 629

Query: 377 N---ATFFSSTNVLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTF 433
               A F     V+  F+ ++ L   +        + G L  ++L      + V    T 
Sbjct: 630 QRWVAIFLDMLAVI--FALIITLLCVTRQFKISPSSTGVLLTYVLQLPGLLNTVLRALT- 686

Query: 434 YSELMKGAGAATRLFEL-LDYKPTIKSTTGKAFKPLN----GKVEFQHVSFSY-PTRKTN 487
             +   G  +A RL    LD     +    +   P N    G+++F+ VSF+Y P+    
Sbjct: 687 --QAENGMNSAERLVTYALDLPQEAEYRRPEMSPPENWPDRGEIKFEGVSFAYRPSLPP- 743

Query: 488 QIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLR 547
            + K+ +  I  G  + I G +G GKSTI S L R      GKI +D  +I  L    LR
Sbjct: 744 -VLKNFSLNIGSGEKIGICGRTGAGKSTIMSALYRINEVIDGKIFIDNINIADLGLFELR 802

Query: 548 RQLGVVQQEPILMSGTIREN----------------ITYGVSRQPSMEEIRSVAKKCF-C 590
            +L ++ Q+P+L  GTI++N                +  G      +EE ++        
Sbjct: 803 SKLAIIPQDPVLFRGTIKKNLDPFGEKTDQELWESLVRGGAIAPEDIEETKAQQPDASGS 862

Query: 591 HAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAI 650
           H+ + KF    E  +   G   S G+KQ +A+ RAL+   +ILILDEATS++D E++  I
Sbjct: 863 HSKMHKF--HLEQKVEEEGGNFSLGEKQLLALTRALVRNSRILILDEATSSVDYETDDKI 920

Query: 651 NYTLGRLMKS-KELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHD 704
                R++++  + TI+ IAHRL+TI   + ++VL   G V E     +L+   D
Sbjct: 921 Q---SRIVEAFGDCTILCIAHRLNTILNYDRILVLE-QGEVAEFDTPWNLFTKED 971

 Score = 94.0 bits (232), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 82/303 (27%), Positives = 143/303 (47%), Gaps = 32/303 (10%)

Query: 490 FKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQ 549
           F++LNF I+ G  + + GP G GK+++ S +  +   + G + V+G+ ++          
Sbjct: 106 FQNLNFDIKKGEFIIVTGPIGTGKTSLLSAMAGFMARSGGSVEVNGRLLS---------- 155

Query: 550 LGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRG 609
            G     P + + T+R+NI +G   + +  + R V K C   + +   P G  T IG RG
Sbjct: 156 CGY----PWIQNATVRDNIIFGSPYEKA--KYRKVIKACSLDSDLEILPAGDMTEIGERG 209

Query: 610 ALLSGGQKQRIAIARALLNKPKILILDEATSALDVE-SEGAINYTLGRLMKSKELTIISI 668
             LSGGQK RI +AR +     I + D+  SA+D    +  ++  L  L+  K  T I  
Sbjct: 210 INLSGGQKARINLARCVYKDKDIYLFDDVLSAVDARVGKHIMDECLLGLLGQK--TRILA 267

Query: 669 AHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLLTXXXXXXXXXXXXYAPP 728
            H+L+ I ++  +IVLG DGS   +G +++L    +S L KLL                 
Sbjct: 268 THQLALIEKATRLIVLGNDGSFT-IGTYEEL-QKSNSQLKKLLQFTSDKSEEDDND---- 321

Query: 729 AITQESEPQTEENGKDDSGEDQNSD-----HEENSQDQNEKRLQEEVIHQVLEDISHDQK 783
              +++E   E + +D  G D+ +        E   + N + L+++V  + +E+   D  
Sbjct: 322 --QKQNENDKEVHAEDLEGLDEKAKIGEVAKYEGEDEMNWEELKKQVSRKSIENKQKDGH 379

Query: 784 TST 786
            +T
Sbjct: 380 ITT 382

>TBLA0C07100 Chr3 (1721628..1726085) [4458 bp, 1485 aa] {ON} 
          Length = 1485

 Score =  113 bits (282), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 137/534 (25%), Positives = 228/534 (42%), Gaps = 76/534 (14%)

Query: 213  GRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNI 272
            G+  LL  +G      L    + K +H  M F D N +G +L+R   D   +   +T+N+
Sbjct: 960  GQYTLLCYMGVVASKTLNLQALHKILHTPMSFMDTNPLGRILNRFTKDTDALDNELTENL 1019

Query: 273  SDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNL 332
                   I   +G+G M  I     ++     P LL+   +  +  ++  RE+++     
Sbjct: 1020 RLAMSQ-IANIIGVGAMCIIYLPWFAIAI---PFLLLIFLLIADHYQSTGREVKRLEAIQ 1075

Query: 333  TKVA----EEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNV-- 386
                     E L+G+ T++++ A+ +       A +  F + K     N   + S  V  
Sbjct: 1076 RSFVYNNLNEMLTGMDTIKAYNAQDR------FATKSEFLIDK----MNEAAYISIAVQR 1125

Query: 387  -LGDFSFLLVLAYGSHLVL-----QGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKG 440
              G F  L+ +A+   + L     Q +++  D    + Y       V  L    + +++ 
Sbjct: 1126 WAGIFLDLVAVAFALIITLLCVTRQFHISGADTGVLLTY-------VLQLPGLLNTVLRA 1178

Query: 441  --------------AGAATRLFELLDY-KPTIKSTTGKAFKPLNGKVEFQHVSFSY-PTR 484
                             AT+L +   Y KP           P NG + F++++F+Y P  
Sbjct: 1179 LTQTENDMNSTERLVSYATQLPQEAQYRKPECSPPIDW---PQNGHIVFENINFAYRPGL 1235

Query: 485  KTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSK 544
                I K+ N  I+P   + I G +G GKSTI + L R    T+GKI++D  DI+ L   
Sbjct: 1236 PI--ILKNFNLIIKPNEKIGICGRTGAGKSTIMNALYRLTELTTGKIIIDDIDISNLGLY 1293

Query: 545  SLRRQLGVVQQEPILMSGTIREN----------------ITYGVSRQPSMEEIRSVAKKC 588
             LR +L ++ Q+P+L  G IR N                +  G      +E ++S  K  
Sbjct: 1294 ELRSKLAIIPQDPVLFRGNIRRNLDPFDEYQDDLLWESLVKAGAIDSQELETVKSQDKNS 1353

Query: 589  FCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEG 648
                 + KF       +   G   S G++Q +A+ RAL+ + KILILDEATS++D E++ 
Sbjct: 1354 DAKN-LHKF--HLNQSVDEDGNNFSLGERQVLALTRALVRQSKILILDEATSSVDYETDA 1410

Query: 649  AINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYAN 702
             I   +         TI+ IAHRL TI   + ++VL   G V E     +L+ N
Sbjct: 1411 KIQNLIATAF--NHCTILCIAHRLKTILNYDRILVLE-KGEVAEFDTPWNLFNN 1461

 Score = 87.8 bits (216), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 66/226 (29%), Positives = 107/226 (47%), Gaps = 22/226 (9%)

Query: 489 IFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRR 548
           +  ++NFTI  G  V + GP G GK+++   L       SG++   G  +          
Sbjct: 624 LLSNINFTIPKGEFVVVTGPVGSGKTSLLFALAGLMEQLSGEMNHSGDLLL--------- 674

Query: 549 QLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPR 608
             G+    P + + TIR+NI +G    P+    + V   C   + +   P   +T +G R
Sbjct: 675 -CGI----PWVQNATIRDNILFGSPYDPTF--YKRVLHVCALESDLENLPAHDKTEVGER 727

Query: 609 GALLSGGQKQRIAIARALLNKPKILILDEATSALDVE-SEGAINYTLGRLMKSKELTIIS 667
           G  LSGGQK RI++ARA+     I + D+  SA+D       ++Y +   +  K  T I 
Sbjct: 728 GVTLSGGQKARISLARAVYKNKDIYLFDDVLSAVDARVGRHIMDYCMNDHLSDK--TRIL 785

Query: 668 IAHRLSTIRRSENVIVLGI--DGSVVEMGKFKDLYANHDSALHKLL 711
             H+LS + +++ +IVL    D    E+G FK+L    +S L  L+
Sbjct: 786 ATHQLSLVEKADRIIVLSTSKDAPHFEIGTFKELIKT-NSTLQSLM 830

>TDEL0G00330 Chr7 complement(58587..62984) [4398 bp, 1465 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1465

 Score =  112 bits (281), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 83/261 (31%), Positives = 129/261 (49%), Gaps = 23/261 (8%)

Query: 467  PLNGKVEFQHVSFSY-PTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYN 525
            P  G++ F+ VSF+Y P      + K ++  I+    + I G +G GKSTI S L R   
Sbjct: 1199 PSKGEIVFEDVSFAYRPGLPV--VLKGISLDIKSQEKIGICGRTGAGKSTIMSALYRLNE 1256

Query: 526  PTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQP--------- 576
             + GKI +D  DI ++    LR++L ++ Q+P+L  GTIR+N+       P         
Sbjct: 1257 LSDGKIFIDSVDIGQIGLYDLRKKLSIIPQDPVLFRGTIRKNLD-PFQEHPDELLWKSLV 1315

Query: 577  -----SMEEIRSVA--KKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNK 629
                 S EE+  V   K     +  S      +  +   GA  S G++Q +A+ RAL+ +
Sbjct: 1316 SGGAISAEEVEVVKGQKPDSIGSLSSMHKFHLDQKVEEEGANFSLGERQLLALTRALVRQ 1375

Query: 630  PKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGS 689
             KILILDEATS++D E++  I   +       + TI+ IAHRL TI   + ++VL   G 
Sbjct: 1376 SKILILDEATSSVDYETDNKIQSRIAAAF--GDCTILCIAHRLKTILTYDRILVLE-QGE 1432

Query: 690  VVEMGKFKDLYANHDSALHKL 710
            + E    + LY   D    ++
Sbjct: 1433 IEEFDTPRSLYEKKDGIFRQM 1453

 Score =  109 bits (272), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 92/290 (31%), Positives = 137/290 (47%), Gaps = 29/290 (10%)

Query: 484 RKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSS 543
           +K+   FK+LN  I+ G  V I GP G GKS++ S +  +   TSG + VDG D+     
Sbjct: 590 KKSFHGFKNLNIDIKKGDFVMITGPIGTGKSSLLSAMAGFMRKTSGTVEVDG-DL----- 643

Query: 544 KSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYET 603
                   ++   P + + T+R+NI +G       E    V + C   A I   P G  T
Sbjct: 644 --------LMCGYPWIQNATVRDNIIFGSPYDK--ERFDEVVRVCSLKADIDILPGGELT 693

Query: 604 IIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAI--NYTLGRLMKSK 661
            IG RG  LSGGQK RI +AR++     I + D+  SA+D      I     LGRL   K
Sbjct: 694 EIGERGITLSGGQKARINLARSVYKDKDIFLFDDVLSAVDSRVGKHIMDECLLGRL---K 750

Query: 662 ELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLLTXXXXXXXXX 721
             T I   H+LS I ++  VIVLG+DGS  E GK +DL  ++ + ++ L           
Sbjct: 751 GKTRILATHQLSLIEKASVVIVLGVDGS-FEAGKLEDLKRSNKTLINLL-------HFSS 802

Query: 722 XXXYAPPAITQESEPQTEENGKDDSGEDQNSDHEENSQDQNEKRLQEEVI 771
               +  A T E +   + + ++    D  S   E  Q Q  K+ ++E++
Sbjct: 803 QKSSSKEADTSEKDLALKTSIEEVKTHDSESKEWEELQKQLSKKSRDELV 852

>TBLA0C06400 Chr3 complement(1545011..1549144) [4134 bp, 1377 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1377

 Score =  108 bits (271), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 127/536 (23%), Positives = 228/536 (42%), Gaps = 78/536 (14%)

Query: 213  GRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNI 272
            G+  LL  +G R    L    + + +H  M F +   +G +++R   D    + S+   I
Sbjct: 857  GQFSLLCYIGLRASKSLNLQAVNRVIHSPMWFMESTPMGRIMNRFTKD----TESLDNQI 912

Query: 273  SDGFKALI---CGGVGIGMMFHISSTLASVLFLFAPP-----LLVGATIYGNKIRAISRE 324
             D  + ++   C  VGI ++      +    F  A P     L V  + Y +  R I R 
Sbjct: 913  LDNLRFVVYQACTIVGISVL----CIIYLPWFAIAIPGLGLILFVACSHYQSSAREIKRL 968

Query: 325  LQQASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSST 384
                   +     + L G+ T++++ AE +  ++ +  + +                   
Sbjct: 969  EAVQRSFIYNHLNDVLGGVDTIRAYGAEERFSYKLDYLIDKTNEASYLYTAVQRWINIVI 1028

Query: 385  NVLGDFSFLLVLAY------------GSHLVLQGNLTIGDLT----AFMLYTEYTGSAVF 428
            N++G  SF L+++              + +VL   L I DL       +  TE   ++V 
Sbjct: 1029 NLVG-ISFTLIVSLLCVTKVFNLSGASTGVVLSYVLLIPDLLNNTLTMVTQTENDMNSVE 1087

Query: 429  GLSTFYSELMKGAGAATRLFELLDYKPTIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQ 488
             L T+ +EL + A           +   + S T     P NG+++F++V +++       
Sbjct: 1088 RLVTYATELPQEAS----------HGEEVPSKTW----PENGEIKFENVRYTHRD-GLPA 1132

Query: 489  IFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRR 548
            +       I  G  V I G +G GKST+   L R     SG++++D  D++KL+  +LR 
Sbjct: 1133 VLDKFTLKIAAGERVGICGRTGAGKSTVLGALYRLREVESGRVMIDDVDVSKLNLTALRS 1192

Query: 549  QLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKF-PNGYETIIG- 606
            +L ++ Q+P+L  G++R N+       P  E    V K       + KF   G E+  G 
Sbjct: 1193 RLAIIPQDPVLFQGSVRHNL------DPFGEYDDDVLKNALMRCTVGKFNKTGNESTEGI 1246

Query: 607  -------------------PRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESE 647
                                 G   S G++Q +A+ARAL+    IL+LDEAT+A+D  ++
Sbjct: 1247 DTDADNGLVGKFRLDQDVEENGCNFSVGERQVLALARALIRNSSILVLDEATAAVDAATD 1306

Query: 648  GAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANH 703
              +   +    K +  T++ +AHRL TI   + ++VL  +G ++ +   K L  N+
Sbjct: 1307 AHVQRLVAEAFKGR--TVLCVAHRLDTILNYDRILVLE-NGKIIGLDTPKSLLDNN 1359

 Score =  103 bits (256), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 116/460 (25%), Positives = 202/460 (43%), Gaps = 83/460 (18%)

Query: 282 GGV---GIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEE 338
           GG+   G+G+ F    T+  V+FLF   +         K+R     + Q +     +  E
Sbjct: 324 GGIAMSGVGLFF---VTIIVVIFLFGIVM---------KMRL---NINQVTDQRVSILRE 368

Query: 339 QLSGIKTVQSFVAEGKEVHRYNNAVRQVFNV-----GKKEAFTNATF---FSSTNVLGDF 390
            L+ IK V+ +  E      Y  +++++ ++      + E   N  F   FS  N+    
Sbjct: 369 VLNNIKMVKLYCWE----QAYEKSIKKIRSLETSKLTRMEILKNVIFSVTFSLPNICSLM 424

Query: 391 SFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAG-----AAT 445
           +FL +        + G L      A  +++  +   +  L +FY  L  G       +  
Sbjct: 425 TFLALFK------IHGGLK----NAATIFSSLSLFKILSLLSFYIPLSLGTAIDIVTSLD 474

Query: 446 RLFELLDYKPT-----IKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQI-------FKDL 493
           R  E L+ + +     I+ T  + +      ++  H SF + T + +         F DL
Sbjct: 475 RFQEFLEAEESKETRIIRETNSEIYGDNTVAIKASHCSFRWDTEEKDNNEEKEFSGFHDL 534

Query: 494 NFTIEPGSNVCIVGPSGRGKST----IASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQ 549
           NF I  G  + IVGP G GK++    I  L+ +Y N   G++ VDG  ++          
Sbjct: 535 NFEIMKGELIIIVGPIGSGKTSLLNAICGLMPQYGN--EGELEVDGSLVS---------- 582

Query: 550 LGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRG 609
                  P + + T+R+NI +G     S  + + V + C     + K      T IG RG
Sbjct: 583 ----CGYPWIQNTTVRDNILFGSKYDES--KFKRVIRMCSLEEDLEKLSAYDMTEIGERG 636

Query: 610 ALLSGGQKQRIAIARALLNKPKILILDEATSALDVE-SEGAINYTLGRLMKSKELTIISI 668
             LSGGQK RI +AR+L  +  I + D+  SA+D    +  +   L   +K+K  T +  
Sbjct: 637 VTLSGGQKSRINLARSLYKEKDIYLFDDILSAVDSRVGQSIMKECLMEGLKNK--TRVLA 694

Query: 669 AHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALH 708
            H+LS I +++ +IVLG DG   +MG+++DL   +++ ++
Sbjct: 695 THQLSLIGKADQLIVLGNDGK-FDMGRYEDLIKTNETLIN 733

>AGL346W Chr7 (61232..65434) [4203 bp, 1400 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YGR281W (YOR1)
          Length = 1400

 Score =  104 bits (259), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 75/244 (30%), Positives = 119/244 (48%), Gaps = 21/244 (8%)

Query: 471  KVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGK 530
            ++ FQ VSF+Y           ++F +  G  + I G +G GK+++ + L R     SG 
Sbjct: 1144 EIVFQEVSFAYRP-GLPLALCGVSFHVRAGEKIGICGRTGAGKTSVTTALYRLSELESGS 1202

Query: 531  ILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFC 590
            I +DG DI  L    LR  L ++ Q+P+L  GT+R+N+       P  E           
Sbjct: 1203 IKIDGVDIATLGLHDLRSALSIIPQDPLLFRGTVRKNL------DPFAEHTDGTLWSALV 1256

Query: 591  HAFI---------SKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSA 641
             + +          KF    E   G  GA  S G++Q +A+ARAL+   +ILILDEATS+
Sbjct: 1257 RSGVVPAGVVPTSHKFHLDQEVDEG--GANFSLGERQLLALARALVRSTRILILDEATSS 1314

Query: 642  LDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYA 701
            +D  ++  +   +    + ++ T++ +AHRL TI   + ++VL   G V E      L+A
Sbjct: 1315 VDYATDARVQARIA--AEFRQATVLCVAHRLRTIISYDRILVLD-QGRVAEFDTPYRLFA 1371

Query: 702  NHDS 705
              DS
Sbjct: 1372 RKDS 1375

 Score = 91.3 bits (225), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 70/212 (33%), Positives = 106/212 (50%), Gaps = 24/212 (11%)

Query: 492 DLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLG 551
           DL F+I+ G  + ++G  G GK+++ + +  Y   T+G + V+G  +            G
Sbjct: 553 DLLFSIKKGEFIIVIGAIGTGKTSLLNAVAGYMKKTTGSVHVNGSLLF----------CG 602

Query: 552 VVQQEPILMSGTIRENITYGVS-RQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGA 610
           V    P + + TIR+NI +G S  Q   +E   V   C   A    FP G +T +G RG 
Sbjct: 603 V----PWIQNATIRDNIIFGSSFDQTRYDE---VVNACALEADFKIFPAGDKTEVGERGI 655

Query: 611 LLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAIN--YTLGRLMKSKELTIISI 668
            LSGGQK RI++ARA+     I + D+  SA+D      I     L RL   +  T I  
Sbjct: 656 TLSGGQKARISLARAIYKDRDIYLFDDIISAVDANVAAHITQKCLLDRL---QNRTRILA 712

Query: 669 AHRLSTIRRSENVIVLGIDGSVVEMGKFKDLY 700
            H+L+ ++ +  VI LG DGS  +MG   +L+
Sbjct: 713 THQLALVQEASRVIFLGQDGS-FDMGTPAELH 743

>TBLA0A03800 Chr1 complement(947158..951798) [4641 bp, 1546 aa] {ON}
           Anc_8.303 YDR135C
          Length = 1546

 Score = 91.7 bits (226), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 120/520 (23%), Positives = 220/520 (42%), Gaps = 71/520 (13%)

Query: 222 GERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALIC 281
           G  + + + S + +K++    E    +  GD+++ +  D         Q + D   A  C
Sbjct: 358 GMNIRSAMSSVIYQKSLVLSNEASGTSSTGDVVNLMSVDV--------QRLQD--VAQWC 407

Query: 282 GGVGIGMMFHISSTLASVLFLFAPPLLVGATIY------GNKIRAISRELQQAS----GN 331
             +  G  F I+  L S+  L    + +G  I        + +  I ++LQ+        
Sbjct: 408 NIIWSGP-FQITLCLVSLYKLLGNSMWIGVFILIFMMPINSYLMRIQKKLQKIQMKNKDE 466

Query: 332 LTKVAEEQLSGIKTVQSFVAEG--KEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNV--L 387
            T++  E L+ IK+++ +  E   KE   Y    +++ N+ K   +   T F    V  L
Sbjct: 467 RTRLISEILNNIKSLKLYAWEAPYKEKLEYVRNEKELKNLTKMGCYVAFTHFQFNIVPFL 526

Query: 388 GDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRL 447
              S   V  +     L  +L    LT F L +    +    +++F    ++ + +  RL
Sbjct: 527 VSCSTFAVFVWTQDRPLTTDLVFPALTLFNLLSFPMAAIPIMITSF----IEASISINRL 582

Query: 448 FELLDYKPTIKSTTGKAFKPLN-GKVEFQ---HVSFSYPTRKTNQI-FKDLNFTIEPGSN 502
           F  L  +   K    +     N G V  +     +F +  +   ++  K++NF    G  
Sbjct: 583 FSFLTNEELQKDAVQRLPNVKNTGDVSIKLGDDATFLWKRKPEYKVALKNINFQARKGEL 642

Query: 503 VCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSG 562
            CIVG  G GKS +   +L       G   V G              +  V Q P +M+G
Sbjct: 643 TCIVGKVGSGKSALIQSILGDLFRVKGFATVHGD-------------VAYVSQVPWIMNG 689

Query: 563 TIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAI 622
           T++ENI +G        E     K C     +S  P+G  T++G +G  LSGGQK R+++
Sbjct: 690 TVKENILFGHKFDKKFYE--KTIKACALTIDLSILPDGDSTLVGEKGISLSGGQKARLSL 747

Query: 623 ARALLNKPKILILDEATSALDVESEGA--INYTLG---------RLMKSKELTIISIAHR 671
           ARA+  +    + D+  +A+D E  G   I + LG         +++ + ++T+++IA  
Sbjct: 748 ARAVYARADTYLFDDPLAAVD-EHVGKHLIEHVLGPNGLLHSKTKVLATNKITVLNIA-- 804

Query: 672 LSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLL 711
                   + I L  +G +++ GK++++ ++  S L KL+
Sbjct: 805 --------DYITLLDNGEIIQRGKYEEVTSDPGSPLCKLI 836

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 91/376 (24%), Positives = 162/376 (43%), Gaps = 46/376 (12%)

Query: 216  VLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAY----IVSRSMTQN 271
            V   I G ++   L S ++   +   M F++   +G +L+R   D Y    ++ R+ +Q 
Sbjct: 999  VFCTIHGSKI---LHSQMLASVLRAPMSFFETTPIGRILNRFSNDMYKVDELLGRTFSQF 1055

Query: 272  ISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGN 331
             S+  K      V   ++    ST   + F+   P+      Y       SREL++   +
Sbjct: 1056 FSNAVK------VTFTLVVICVSTWQFIFFIV--PMSFLYIYYQQYYMRTSRELRRLD-S 1106

Query: 332  LTKVA-----EEQLSGIKTVQSFVAEGKEVH----RYNNAVRQVF---NVGKKEAFTNAT 379
            +T+       +E L GI T++ +  E + +H    R +N +   +   N  +  AF    
Sbjct: 1107 VTRSPTISHFQETLGGISTIRGYSQENRFIHINQQRVDNNMSAYYPSINCNRWLAF-RLE 1165

Query: 380  FFSSTNVLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMK 439
            F  S  +LG  +       G + + QGN+T G +   + Y      ++  +     E+  
Sbjct: 1166 FLGSVIILGASTL------GIYRLSQGNMTPGMIGLSLSYALQITQSLNWIVRMTVEVET 1219

Query: 440  GAGAATRL---FELLDYKPTI-KSTTGKAFKPLNGKVEFQHVSFSYPTR---KTNQIFKD 492
               +  R+    EL    P+I +        P +G V+F H    Y TR     + + KD
Sbjct: 1220 NIVSVERIKEYSELASEAPSIVEDKRPDVNWPQDGAVKFNH----YYTRYRADLDYVLKD 1275

Query: 493  LNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGV 552
            +   I+P   + IVG +G GKS++   L R    + G I VDG +  ++    LR +L +
Sbjct: 1276 ITLDIKPREKIGIVGRTGAGKSSLTLALFRIIEASEGNINVDGINTDEIGLYDLRHKLSI 1335

Query: 553  VQQEPILMSGTIRENI 568
            + Q+  +  GT+R+NI
Sbjct: 1336 IPQDSQVFEGTVRDNI 1351

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 68/112 (60%), Gaps = 3/112 (2%)

Query: 599  NGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLM 658
            N   T +   G+ LS GQ+Q + +ARALL    IL+LDEAT+A+DVE++  I  T+    
Sbjct: 1424 NALNTKLSEGGSNLSVGQRQLMCLARALLVPSNILVLDEATAAVDVETDQLIQETIRSAF 1483

Query: 659  KSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
            K++  TI++IAHRL+TI  S+ ++VL   G + E    + L  + DS  + L
Sbjct: 1484 KNR--TILTIAHRLNTIMDSDRILVLD-KGEIKEFDSPQTLLGDKDSLFYSL 1532

>Ecym_5660 Chr5 complement(1331316..1335926) [4611 bp, 1536 aa] {ON}
           similar to Ashbya gossypii AGL346W
          Length = 1536

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 92/327 (28%), Positives = 145/327 (44%), Gaps = 77/327 (23%)

Query: 471 KVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGK 530
           KV+    SFS         F DL+F ++ G  + I G  G GK+++ + L  + + T+G 
Sbjct: 579 KVDLSKTSFSG--------FSDLSFEVKKGELLVITGAIGTGKTSLLNALAGFMHKTNGD 630

Query: 531 ILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEI-RSVAKKCF 589
           I  +G+               +    P + + TIR+NIT+G    P  E + R V + C 
Sbjct: 631 IQYNGR--------------MLFCGAPWIQNATIRDNITFG---SPYDENLYREVMRVCS 673

Query: 590 CHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGA 649
               +S  P G +T +G RG  LSGGQK RI +AR +     I + D+  SA+D     +
Sbjct: 674 LDRDMSVLPAGDKTEVGERGITLSGGQKARINLARCVYKVRDIYLFDDILSAVDARVGAS 733

Query: 650 I--NYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDL------YA 701
           I  +  LG+L    + T I   H++S   ++  VI LG DGS  ++G   +L      +A
Sbjct: 734 IMNDCLLGKL---GDKTRILATHQISLTEQASRVIYLGTDGS-FDIGTVDELKTRNVQFA 789

Query: 702 NHDSALHKLLTXXXXXXXXXXXXYAPPAITQESEPQTEENGKDDSGEDQNSDHEENSQDQ 761
           N    L KL +                        QTE   KDD+   +  D E+     
Sbjct: 790 N----LMKLAS------------------------QTESESKDDNISSEKFDREDQL--- 818

Query: 762 NEKRLQEEVIHQVLEDISHDQKTSTLR 788
             ++LQ+      L+D++  +K +T R
Sbjct: 819 --RQLQQ------LDDLTALRKHATTR 837

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 87/366 (23%), Positives = 162/366 (44%), Gaps = 26/366 (7%)

Query: 217  LLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISD-G 275
            L+  LG R    +    + + +H  + F D   +G +L+R   D  I+   +T+++    
Sbjct: 942  LVSYLGLRASKNINLQSLHRLLHVPVSFIDTTPLGRILNRFTKDTDILDNELTESLRMFS 1001

Query: 276  FKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISR-ELQQASGNLTK 334
            ++  +  GV I  + ++     +V  L    +LV    Y    R I R E  Q S  L  
Sbjct: 1002 YQFTVIWGVIIMSIIYLPWFAVAVPLLVVVFILVSDH-YQCSAREIKRLEAVQRSFVLNN 1060

Query: 335  VAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLL 394
               E +SG+ T++++ AE + + + +  + ++ N      + +  + S   ++G  + L 
Sbjct: 1061 F-NEVISGVDTIKAYHAEARFLKKSDILIDRM-NEMTFPLYASQRWVSI--LIGMIAVLF 1116

Query: 395  VLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGA-------GAATRL 447
             L   S L + G   I   +  +L T      V  L   ++ L++          +A R+
Sbjct: 1117 ALII-SILCVTGWFNISPASTGVLLT-----YVLQLPNLFNTLLRAMTQLENDMNSAERV 1170

Query: 448  FELLDYKPT-----IKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSN 502
                +  P      I         P  G + F +V+ +Y       + +D++F I  G  
Sbjct: 1171 LSYANSLPKEAPYRIPEMAPPKAWPERGAITFDNVALAYRP-GLPLVLQDVSFHISSGEK 1229

Query: 503  VCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSG 562
            + I G +G GKSTI + L R    ++G + +DG DI  +   +LR +L ++ Q+P+L  G
Sbjct: 1230 IGICGRTGAGKSTITNALYRLVELSNGSVTIDGVDIATIGLYNLRSKLSIIPQDPLLFRG 1289

Query: 563  TIRENI 568
            TIR+N+
Sbjct: 1290 TIRKNL 1295

 Score = 61.6 bits (148), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 38/103 (36%), Positives = 60/103 (58%), Gaps = 5/103 (4%)

Query: 609  GALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKS-KELTIIS 667
            G+  S G++Q +A+ARAL+ + KILILDEATS++D E++  I     R+++  +  TI+ 
Sbjct: 1425 GSNFSVGERQFLALARALVRQTKILILDEATSSVDYETDAQIQ---ARIVQEFQHATIMC 1481

Query: 668  IAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
            +AHRL TI   + ++V+   G V E      LY    S    +
Sbjct: 1482 VAHRLKTILHYDRILVME-KGRVAEFDTPLRLYNEQGSIFRSM 1523

>YKR103W Chr11 (653080..656736) [3657 bp, 1218 aa] {ON}
           NFT1Putative transporter of the multidrug
           resistance-associated protein (MRP) subfamily; adjacent
           ORFs YKR103W and YKR104W are merged in different strain
           backgrounds.
          Length = 1218

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 75/241 (31%), Positives = 122/241 (50%), Gaps = 9/241 (3%)

Query: 469 NGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTS 528
           N K  F+  S  +   +T+   K+++   +  S   I+GP+G GKS++   LL   N  S
Sbjct: 648 NTKFGFEDASMEWEAAETSFKLKNISIDFKLNSLNAIIGPTGSGKSSLLLGLLGELNLLS 707

Query: 529 GKILV---DGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVA 585
           GKI V   + +D  ++    +   +    Q P L+SGTI++N+ +G     + ++   V 
Sbjct: 708 GKIYVPTVESRDDLEIGKDGMTNSMAYCSQTPWLISGTIKDNVVFG--EIFNKQKFDDVM 765

Query: 586 KKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVE 645
           K C     I     G  T +G  G  LSGGQ+QRIA+ARA+ +  + LILD+  SA+D E
Sbjct: 766 KSCCLDKDIKAMTAGIRTDVGDGGFSLSGGQQQRIALARAIYSSSRYLILDDCLSAVDPE 825

Query: 646 SEGAI--NYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANH 703
           +   I      G +MK +  T I  +H +S + +  + +V+   G V   GK  DL  ++
Sbjct: 826 TALYIYEECLCGPMMKGR--TCIITSHNISLVTKRADWLVILDRGEVKSQGKPSDLIKSN 883

Query: 704 D 704
           +
Sbjct: 884 E 884

>SAKL0D10208g Chr4 complement(855378..857636) [2259 bp, 752 aa] {ON}
           highly similar to uniprot|P43535 Saccharomyces
           cerevisiae YFR009W GCN20 Positive regulator of the Gcn2p
           kinase activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 80.5 bits (197), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 69/250 (27%), Positives = 112/250 (44%), Gaps = 50/250 (20%)

Query: 472 VEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKI 531
           ++ Q VSF Y   + + + KD+N  ++  S + +VG +G GK+T+  +++    PT G +
Sbjct: 532 IQLQDVSFGY--EENSPLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPTKGYV 589

Query: 532 LVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCH 591
                      S++ R ++G   Q  +                  SM+ + + A      
Sbjct: 590 -----------SRNPRLRIGYFTQHHV-----------------DSMD-LNTSAVDWMSK 620

Query: 592 AFISKFPNGYETIIGPRG----------ALLSGGQKQRIAIARALLNKPKILILDEATSA 641
            F  K    Y   +G  G           LLSGGQK R+A A   LN P IL+LDE ++ 
Sbjct: 621 TFPGKTDEEYRRHLGAFGITGSLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNH 680

Query: 642 LDVESEGAI-----NYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKF 696
           LD     A+     N+T G LM S ++++I   H  S I  SE+  V   DG++ +   +
Sbjct: 681 LDTAGLDALIDALKNFTGGVLMVSHDISVID--HVCSEIWVSEDGTVKRFDGTIYDYRSY 738

Query: 697 KDLYANHDSA 706
             + A+ D A
Sbjct: 739 --ILASADQA 746

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 612 LSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAH 670
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y L   +K+   T++ ++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATVLVVSH 422

>Kwal_26.8730 s26 complement(918498..920993) [2496 bp, 831 aa] {ON}
           YPL147W (PXA1) - ABC family long-chain fatty acid
           transporter [contig 67] FULL
          Length = 831

 Score = 77.8 bits (190), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 99/200 (49%), Gaps = 23/200 (11%)

Query: 499 PGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPI 558
           PGS++ I+GP+G GK++I  ++   + P   K          L S    R+L  + Q+P 
Sbjct: 600 PGSSMLILGPNGSGKTSIQRIIAEIW-PIYNK--------NGLLSVPAERELICIPQKPY 650

Query: 559 LMSG-TIRENITYGVSRQPSME------EIRSVAKKCFCHAFISKFPNGYETI--IGPRG 609
            + G T RE I Y +S     +      E+  V K+     ++ K   G+  +  +    
Sbjct: 651 FIQGGTFREQIIYPMSADQYFDLGYRDKELVHVLKEVKLE-YLLKRDKGWRYLDAVAEWK 709

Query: 610 ALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIA 669
            +LSGG++QR+  AR + +KPK ++LDEAT+A+  + E      L  ++K      I+I+
Sbjct: 710 DVLSGGERQRMNFARIMFHKPKFVVLDEATNAISADMEDY----LFNMLKRYRFNFITIS 765

Query: 670 HRLSTIRRSENVIVLGIDGS 689
            R S I+  +  + +G D S
Sbjct: 766 QRPSLIKYHDLALEIGADES 785

>AEL032W Chr5 (572196..574457) [2262 bp, 753 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR009W (GCN20)
          Length = 753

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 65/240 (27%), Positives = 106/240 (44%), Gaps = 48/240 (20%)

Query: 472 VEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKI 531
           ++ Q VSF Y   ++  + KD+N  ++  S + +VG +G GK+T+  +++    P +G +
Sbjct: 533 IQLQDVSFGYD--ESQLLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPITGHV 590

Query: 532 LVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCH 591
                      S++ R ++G   Q  I                  SM+ + + A      
Sbjct: 591 -----------SRNPRLRIGYFTQHHI-----------------DSMD-LNASAVDWMSK 621

Query: 592 AFISKFPNGYETIIGPRG----------ALLSGGQKQRIAIARALLNKPKILILDEATSA 641
            F  K    Y   +G  G           LLSGGQK R+A A   LN P ILILDE ++ 
Sbjct: 622 TFPGKTDEEYRRHLGAFGITGSLGLQKMQLLSGGQKSRVAFAALCLNSPHILILDEPSNH 681

Query: 642 LDVESEGAI-----NYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKF 696
           LD     A+     N++ G LM S ++++I        I  SE+  V   DG++ +  K+
Sbjct: 682 LDTAGLDALVQALKNFSGGVLMVSHDISVIDSV--CDEIWVSESGTVKRFDGNIHDYKKY 739

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 612 LSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAH 670
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y L   +K+   T++ ++H
Sbjct: 369 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPATVLVVSH 423

>ZYRO0B05588g Chr2 (440556..444368) [3813 bp, 1270 aa] {ON} similar
           to uniprot|Q08234 Saccharomyces cerevisiae YOL075C
           Hypothetical ORF
          Length = 1270

 Score = 75.5 bits (184), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 65/213 (30%), Positives = 101/213 (47%), Gaps = 37/213 (17%)

Query: 481 YPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTI---------ASLLLRYYNPTSGKI 531
           +  +KT QI +D+N   +PG    I+GPSG GKS++         +SLL++++  ++G I
Sbjct: 679 WLQKKTKQILQDVNAVFKPGMINAIMGPSGSGKSSLLNLISGRSNSSLLVKFH--STGSI 736

Query: 532 LVDGQDITKLSSKSLRRQLGVVQQEP--ILMSGTIRENITYGVS----------RQPSME 579
           L++   I+K   KS+      V Q+   +L S T+RE   +  +          R+  ++
Sbjct: 737 LLNTNSISKEMFKSV---CSYVSQDDDHLLASLTVRETFEFAAALRLHYMTSQQRRSKID 793

Query: 580 EIRSVAKKCFCHAFISKFPNGYETIIGPRGAL-LSGGQKQRIAIARALLNKPKILILDEA 638
           EI        C            T+IG      +SGG+K+R+ I   LLN   IL+LDE 
Sbjct: 794 EILLALGLTHCE----------NTVIGNEFVKGISGGEKRRVTIGVQLLNNSPILLLDEP 843

Query: 639 TSALDVESEGAINYTLGRLMKSKELTIISIAHR 671
           TS LD  +  AI   L  L      T+I   H+
Sbjct: 844 TSGLDSFTSAAILEILENLCTEDGKTVIITIHQ 876

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 59/235 (25%), Positives = 115/235 (48%), Gaps = 22/235 (9%)

Query: 485 KTNQIFKDLNFTIE--PGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQ------ 536
           KTN++  + +F+++   GS + ++G SG GK+T+ ++L    +  S  + +DG+      
Sbjct: 32  KTNKVLVN-SFSVDLPSGSVMAVMGGSGSGKTTLLNVLA---SKVSKGLQLDGEIHYALE 87

Query: 537 DITKLSSKSLRRQLGVVQQEPILMSG-TIREN--ITYGVSRQPSMEEIRSVAKKCFCHAF 593
           D ++  +      +  + Q  +L +  T RE   I   +  + S+E+   +  +      
Sbjct: 88  DNSEHFNADTEASMAYLPQHDVLPARLTCRETLMIAADLKLKSSLEKKNEIVDQLLLELG 147

Query: 594 ISKFPNGYETIIG-PRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINY 652
           +    N   T++G  R   LSGG+K+R+++A  L++ P  + LDE T+ LD  S   +  
Sbjct: 148 LRDCAN---TLVGDARNRGLSGGEKRRLSVATQLVSNPSFMFLDEPTTGLDAYSAFLLVK 204

Query: 653 TLGRLMKSKELTIISIAH--RLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDS 705
           +L +L +  + + I   H  R   +   ++V +L   G+VV  GK  ++    DS
Sbjct: 205 SLKKLARDGQKSFIMSVHQPRSDIMFLLDSVCILS-KGNVVYCGKTTEMIPYFDS 258

>CAGL0K10472g Chr11 (1020845..1023103) [2259 bp, 752 aa] {ON} highly
           similar to uniprot|P43535 Saccharomyces cerevisiae
           YFR009w GCN20 positive effector of GCN2P
          Length = 752

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 62/211 (29%), Positives = 94/211 (44%), Gaps = 46/211 (21%)

Query: 472 VEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKI 531
           ++ Q VSF Y   K   + KD+N  I+  S + +VG +G GK+T+  ++L    P SG +
Sbjct: 532 IQLQDVSFGYSPDKL--LLKDVNLDIQMDSRIALVGANGCGKTTLLKVMLEQLRPLSGYV 589

Query: 532 LVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCH 591
                      S++ R ++G   Q  +                  SM+ + + A      
Sbjct: 590 -----------SRNPRLRIGYFTQHHV-----------------DSMD-LSTSAVDWMSK 620

Query: 592 AFISKFPNGYETIIGPRG----------ALLSGGQKQRIAIARALLNKPKILILDEATSA 641
            F  K    Y   +G  G           LLSGGQK R+A A   LN P ILILDE ++ 
Sbjct: 621 TFPGKTDEEYRRHLGSFGITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILILDEPSNH 680

Query: 642 LDVESEGAI-----NYTLGRLMKSKELTIIS 667
           LD     A+     N+T G LM S ++++I+
Sbjct: 681 LDTTGIDALVDAMKNFTGGILMVSHDISVIN 711

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 612 LSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAH 670
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y L   +KS   T+++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKSYPSTVLTVSH 422

>ZYRO0D11880g Chr4 (1003647..1008143) [4497 bp, 1498 aa] {ON} similar
            to uniprot|Q04182 Saccharomyces cerevisiae YDR406W PDR15
            ATP binding cassette (ABC) transporter of the plasma
            membrane general stress response factor implicated in
            cellular detoxification target of Pdr1p Pdr3p and Pdr8p
            transcription regulators promoter contains a PDR
            responsive element
          Length = 1498

 Score = 74.7 bits (182), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 64/224 (28%), Positives = 116/224 (51%), Gaps = 16/224 (7%)

Query: 484  RKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNP--TSGKILVDGQDITKL 541
            R++ +I  +++  ++PG+   ++G SG GK+T+   L         +G I VDG    KL
Sbjct: 866  RESKRILNNIDGWVKPGTLTALMGASGAGKTTLLDCLAERVTTGVITGGIFVDG----KL 921

Query: 542  SSKSLRRQLGVVQQEPI-LMSGTIRENITY-GVSRQPSMEEIRSVAKKCFCHAFIS--KF 597
              +S  R +G  QQ+ + L + T+RE++ +  + RQP  + + +  K+ +    I+  + 
Sbjct: 922  RDESFPRSIGYCQQQDLHLKTATVRESLLFSAMLRQP--KSVPASEKRKYVEEVINVLEM 979

Query: 598  PNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILI-LDEATSALDVESEGAINYTLGR 656
                + I+G  G  L+  Q++R+ I   L+ KPK+LI LDE TS LD ++  +I   L R
Sbjct: 980  EPYADAIVGVAGEGLNVEQRKRLTIGVELVAKPKLLIFLDEPTSGLDSQTAWSIC-QLIR 1038

Query: 657  LMKSKELTIISIAHRLST--IRRSENVIVLGIDGSVVEMGKFKD 698
             + ++   I+   H+ S   I+  + ++ L   G  V  G+  D
Sbjct: 1039 KLANRGQAILCTIHQPSAVLIQEFDRLLFLQKGGETVYFGELGD 1082

>TBLA0C01220 Chr3 complement(263093..265348) [2256 bp, 751 aa] {ON}
           Anc_1.366 YFR009W
          Length = 751

 Score = 73.9 bits (180), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 63/227 (27%), Positives = 104/227 (45%), Gaps = 34/227 (14%)

Query: 472 VEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKI 531
           ++ Q VSF Y  +  N + KD+N  ++  S + +VG +G GK+T+  +++    P  G +
Sbjct: 531 IQLQDVSFGYDEK--NLLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMNQLKPLKGYV 588

Query: 532 LVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQP--SMEEIRSVAKKCF 589
             +G           R ++G   Q  +      +  + +   + P  + EE R       
Sbjct: 589 SSNG-----------RLRIGYFTQHHVDSMDLTKSAVDWMSVKYPGKTDEEYRR------ 631

Query: 590 CHAFISKFPNGYETIIG-PRGALLSGGQKQRIAIARALLNKPKILILDEAT-----SALD 643
               +  F  G    +G  +  LLSGGQK R+A A   LN P IL+LDE +     + LD
Sbjct: 632 ---HLGSF--GITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDNTGLD 686

Query: 644 VESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSV 690
              E   N++ G LM S ++++I    +   I  SEN  V   DG++
Sbjct: 687 ALVESLKNFSGGVLMVSHDISVIDSVCK--EIWVSENGTVRRFDGTI 731

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 612 LSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAH 670
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y L   +K+   T++ ++H
Sbjct: 367 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPSTLLVVSH 421

>ACR128C Chr3 complement(573251..575734) [2484 bp, 827 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL147W
           (PXA1)
          Length = 827

 Score = 73.9 bits (180), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 89/186 (47%), Gaps = 21/186 (11%)

Query: 499 PGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPI 558
           PGS++ I+GP+  GKS+I  +L   + P   K        T L S      L  + Q P 
Sbjct: 597 PGSSLLILGPNSCGKSSIQRILAEIW-PIYNK--------TGLVSIPAESDLMCIAQRPY 647

Query: 559 LMSG-TIRENITYGVSRQPSME------EIRSVAKKCFCHAFISKFPN-GYETIIGPRGA 610
            + G T R+ I Y +S     E      E+  + K+      + +     Y   +     
Sbjct: 648 FIQGGTFRDQIIYPMSVDRFYEKGHKDRELVRILKEVKLDYLLKRSEGLSYLDFVADWKD 707

Query: 611 LLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAH 670
           +LSGG+KQR+  AR + ++PK L+LDEAT+A+ V+ E   +Y    L K +    ISI+ 
Sbjct: 708 ILSGGEKQRMNFARIMFHRPKFLVLDEATNAISVDME---DYLFNMLRKCR-FNFISISQ 763

Query: 671 RLSTIR 676
           R S I+
Sbjct: 764 RPSLIK 769

>KNAG0C01960 Chr3 complement(380896..383154) [2259 bp, 752 aa] {ON}
           Anc_1.366 YFR009W
          Length = 752

 Score = 73.9 bits (180), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 61/233 (26%), Positives = 101/233 (43%), Gaps = 45/233 (19%)

Query: 472 VEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKI 531
           ++ Q VSF Y  +    + KD+N  ++  S + +VG +G GK+T+  +++    PTSG +
Sbjct: 532 IQLQDVSFGYEEQSL--LLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPTSGYV 589

Query: 532 LVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCH 591
                      S++ R ++G   Q  +                  SM+ + + A      
Sbjct: 590 -----------SRNGRLRIGYFTQHHV-----------------DSMD-LNTSAVDWMSK 620

Query: 592 AFISKFPNGYETIIGPRG----------ALLSGGQKQRIAIARALLNKPKILILDEATSA 641
            +  K    Y   +G  G           LLSGGQK R+A A   LN P IL+LDE ++ 
Sbjct: 621 TYPGKTDEEYRRHLGAFGITGTLGLQQMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNH 680

Query: 642 LDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMG 694
           LD     A+   L +        ++ ++H +S I    N I +  DG+V + G
Sbjct: 681 LDTTGLEALVDALKKFTGG----VLMVSHDISVIDSVCNEIWVSEDGNVKKFG 729

 Score = 44.7 bits (104), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 612 LSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAH 670
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y L   +K+   T+++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPSTVLTVSH 422

>TDEL0B05760 Chr2 (1017816..1020926) [3111 bp, 1036 aa] {ON}
           Anc_1.427 YCR011C
          Length = 1036

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 70/246 (28%), Positives = 122/246 (49%), Gaps = 42/246 (17%)

Query: 472 VEFQHVSFSYPTRKTNQ-IFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLL--RYYNPTS 528
           + F++++++  + KT++ I K ++  I+PG  + ++G SG GK+T+  +L   R     +
Sbjct: 377 LSFENITYNVSSSKTDENILKGISGIIKPGQMMALLGGSGAGKTTLLDILAMKRKTGQVT 436

Query: 529 GKILVDGQDITKLSSKSLRRQLGVVQQ-----------EPILMSGTIRENITYGVSRQPS 577
           G I V+G DI +   K   + +G V Q           E +L S  +R   ++  + + +
Sbjct: 437 GSIKVNGSDIPR---KDFTKLIGFVDQDDYLLPTLTVYETVLNSALLRLPRSFSFAAKQT 493

Query: 578 -----MEEIRSVAKKCFCHAFISKFPNGYETIIG---PRGALLSGGQKQRIAIARALLNK 629
                +EE+R +  K              + +IG    RG  +SGG+K+R++IA  L+  
Sbjct: 494 RVYQVLEELRILDIK--------------DRVIGNDFERG--ISGGEKRRVSIACELVTS 537

Query: 630 PKILILDEATSALDVESEGAINYTLGRLMKSKELT-IISIAHRLSTIRRSENVIVLGIDG 688
           P IL LDE TS LD  +   +   L RL K+   T ++SI    S I +  + +VL  +G
Sbjct: 538 PLILFLDEPTSGLDANNANNVVECLVRLAKTYNRTLVLSIHQPRSNIFQLFDKLVLLSNG 597

Query: 689 SVVEMG 694
            +V  G
Sbjct: 598 EMVYSG 603

>KLTH0D10890g Chr4 complement(891012..893504) [2493 bp, 830 aa] {ON}
           similar to uniprot|P41909 Saccharomyces cerevisiae
           YPL147W PXA1 Pxa1p and Pxa2p appear to be subunits of a
           peroxisomal ATP-binding cassette transporter necessary
           for transport of long-chain fatty acids into peroxisomes
           ABC family long-chain fatty acid transporter
          Length = 830

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 58/201 (28%), Positives = 96/201 (47%), Gaps = 25/201 (12%)

Query: 499 PGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPI 558
           PGS++ I+GP+G GK++I  ++   + P   K          L S      L  V Q+P 
Sbjct: 599 PGSSMLILGPNGSGKTSIQRIIAEIW-PIYNK--------NGLLSIPPASDLFCVPQKPY 649

Query: 559 LMSG-TIRENITYGVSRQPSMEEIRSVAKKCFCHA-------FISKFPNGYETI--IGPR 608
            + G T RE I Y +S     +       K   H        ++ K   G+  +  +   
Sbjct: 650 FIQGGTFREQIIYPMSADQYFD--MGYRDKELTHILGEVKLDYLLKRDKGWRYLDAVAEW 707

Query: 609 GALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISI 668
             +LSGG++QRI  AR + +KP+ ++LDEAT+A+  + E   +Y  G L+K      I+I
Sbjct: 708 KDVLSGGERQRINFARIMFHKPRFVVLDEATNAISADME---DYLFG-LLKRYRFNFITI 763

Query: 669 AHRLSTIRRSENVIVLGIDGS 689
           + R S I+  +  + +  DG+
Sbjct: 764 SQRPSLIKYHDLALDISTDGT 784

>Kpol_175.1 s175 complement(1..4131) [4131 bp, 1377 aa] {ON}
           complement(1..4131) [4131 nt, 1377 aa]
          Length = 1377

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 77/295 (26%), Positives = 130/295 (44%), Gaps = 28/295 (9%)

Query: 489 IFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKS--- 545
           I ++LN   +      + GP+G GKS +   LL   +   G+I      +  L+SK    
Sbjct: 708 ILENLNVKFKSKKLNVVAGPTGAGKSLLLMSLLGETHLFKGEI-----HVPSLASKHELM 762

Query: 546 -----LRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNG 600
                L   +    Q P +++ +I+ NI +G   + +++    V + C     +    +G
Sbjct: 763 IHGDGLTNSISYCSQIPWIINDSIKNNILFG--SEFNLKRYNDVIRACCLTNDLRLLQDG 820

Query: 601 YETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTL---GRL 657
             +I+G RG  LSGGQ+QR+++ARA+ +K   +ILD+  SA+D +    I Y L   G L
Sbjct: 821 DNSIVGDRGQNLSGGQRQRVSLARAIYSKSMHIILDDCLSAVDSKCAKDI-YDLCLTGPL 879

Query: 658 MKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLLTXXXXX 717
           MK +  T I ++H +  + +    +++  + +    G   DL    D AL +        
Sbjct: 880 MKGR--TCILVSHNVELVIKKAAYLLILDNRTTAYKGPPGDLLK--DKALRQRYCKFDFN 935

Query: 718 XXXXXXXYAPPAITQE--SEPQTEENGKDDSGEDQNSDHEENSQDQNEKRLQEEV 770
                    P   T     +P      +D S + Q+    +N  DQNE  L E V
Sbjct: 936 ELNEN---CPNQCTTSVVHKPDYYLEDRDSSSKTQSQTILKNLDDQNENILGEVV 987

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 58/306 (18%), Positives = 131/306 (42%), Gaps = 40/306 (13%)

Query: 228  RLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIG 287
            R+   +++  +   + F+++  +G +++    D   +   ++  I   F   +   + + 
Sbjct: 1092 RIFIKILRNVVSSKLIFFEKTPIGSIMNNFSKDIRSLDFELSPFIEGTFSCTLQTLMSLI 1151

Query: 288  MMFHISSTL---ASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVA-----EEQ 339
            ++ +++      A  +FLF           G+     SREL++    +TK        E 
Sbjct: 1152 LITYVNPNFIFPAIFIFLFC-------CFIGHSYLCCSRELKRYES-ITKTPIYQHFSES 1203

Query: 340  LSGIKTVQSFVAEGK-------EVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSF 392
            L+G+ ++++F  E +        V  YN +   ++      +F          ++G  + 
Sbjct: 1204 LAGLVSIRAFGDELRFIKVIFTRVDEYNKSFFYLWEANNWLSF-------RIELIGSIT- 1255

Query: 393  LLVLAYGSHLVLQGNLTIGDLT--AFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFEL 450
              +LA G  L+   N+    L    F     +T SA++ +  FY+ +     +  RL+E 
Sbjct: 1256 --ILATGLFLLSNANMVDSGLAGITFTYAIAFTESALWMIK-FYATMEMNMNSVERLYEY 1312

Query: 451  --LDYKPTIKSTTGKAFK-PLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVG 507
              L+ +P  +  T    + P +G ++F++V+  Y + +  ++ +D+ F I     + +VG
Sbjct: 1313 TNLEQEPYSRCITNVDNQWPNSGDIKFKNVTLRY-SPELPKVLQDVTFVIGDKEKIGVVG 1371

Query: 508  PSGRGK 513
             +G GK
Sbjct: 1372 RTGAGK 1377

>KAFR0C04540 Chr3 complement(907385..909643) [2259 bp, 752 aa] {ON}
           Anc_1.366 YFR009W
          Length = 752

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 64/238 (26%), Positives = 102/238 (42%), Gaps = 55/238 (23%)

Query: 472 VEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKI 531
           ++ Q VSF Y  +  N + KD+N  ++  S + +VG +G GK+T+  +++    P  G +
Sbjct: 532 IQLQDVSFGYDEK--NLLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPLQGYV 589

Query: 532 LVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCH 591
                      S++ R ++G   Q  +                  SM+ + + A      
Sbjct: 590 -----------SRNGRLRIGYFTQHHV-----------------DSMD-LTTSAVDWMSK 620

Query: 592 AFISKFPNGYETIIGPRG----------ALLSGGQKQRIAIARALLNKPKILILDEATSA 641
            F  K    Y   +G  G           LLSGGQK R+A A   LN P ILILDE ++ 
Sbjct: 621 TFPGKNDEEYRRHLGAFGITGSLGLQKMQLLSGGQKSRVAFAALCLNNPHILILDEPSNH 680

Query: 642 LDVESEGAI-----NYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMG 694
           LD     A+     N++ G LM         ++H +S I    N I +  +G+V + G
Sbjct: 681 LDTTGLDALIDALKNFSGGVLM---------VSHDISVINSVCNEIWVSEEGTVKKFG 729

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 612 LSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAH 670
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y L   +K+   T++ ++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATLLVVSH 422

>Kpol_1043.43 s1043 complement(86642..88900) [2259 bp, 752 aa] {ON}
           complement(86642..88900) [2259 nt, 753 aa]
          Length = 752

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 65/240 (27%), Positives = 105/240 (43%), Gaps = 48/240 (20%)

Query: 472 VEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKI 531
           ++ Q VSF Y  +  N +  D+N  ++  S + +VG +G GK+T+  +++    P  G +
Sbjct: 532 IQLQDVSFGYNEK--NLLLADVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPLKGYV 589

Query: 532 LVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCH 591
             +G           R ++G   Q  +                  S++  +S A      
Sbjct: 590 SQNG-----------RLRIGYFTQHHV-----------------DSLDLTKS-AVDWMST 620

Query: 592 AFISKFPNGYETIIGPRG----------ALLSGGQKQRIAIARALLNKPKILILDEATSA 641
           A+  K    Y   +G  G           LLSGGQK R+A A   LN P ILILDE ++ 
Sbjct: 621 AYPGKTDEEYRRHLGAFGITGSLSLQKMQLLSGGQKSRVAFAALCLNNPHILILDEPSNH 680

Query: 642 LDVESEGAI-----NYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKF 696
           LD     A+      +T G LM S ++++IS  +  + I  SEN  V   DG++ +   +
Sbjct: 681 LDTSGIDALVDAMKKFTGGILMVSHDISVIS--NVCNEIWVSENGTVKRFDGTIYDYRDY 738

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 612 LSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAH 670
            SGG + R+++ARAL  +P +L+LDE T+ LDV S   I Y L   +K+   T+++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPTNMLDVPS---IAY-LSEYLKTYPSTVLTVSH 422

>ZYRO0G01144g Chr7 (89341..91599) [2259 bp, 752 aa] {ON} highly
           similar to uniprot|P43535 Saccharomyces cerevisiae
           YFR009W GCN20 Positive regulator of the Gcn2p kinase
           activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 61/234 (26%), Positives = 98/234 (41%), Gaps = 55/234 (23%)

Query: 472 VEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKI 531
           ++ Q V+F Y   + N + KD+N  ++  S + +VG +G GK+T+  +++    P  G +
Sbjct: 532 IQLQDVTFGY--NENNLLLKDVNLDVQLNSRIALVGANGCGKTTLLKIMMETLTPLKGYV 589

Query: 532 LVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCH 591
                      S++ R +LG   Q  +                     ++ + A +    
Sbjct: 590 -----------SRNPRLRLGYFAQHHV------------------DAMDLNASAVEWMSK 620

Query: 592 AFISKFPNGYETIIGP----------RGALLSGGQKQRIAIARALLNKPKILILDEATSA 641
            F  +    Y   +G           R  LLSGGQK R+A A   LN P +LILDE ++ 
Sbjct: 621 TFPGRSDEEYRRHLGSFGITGSLGLQRMELLSGGQKSRVAFAALCLNNPHVLILDEPSNH 680

Query: 642 LDVESEGAI-----NYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSV 690
           LD     A+     N+T G LM         ++H +S I    N I +  DGS 
Sbjct: 681 LDTSGIDALVDALKNFTGGVLM---------VSHDISVINSVCNEIWVSEDGSA 725

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 612 LSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAH 670
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y L   +KS   TI+ ++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKSYPSTILVVSH 422

>KLLA0A10857g Chr1 complement(941784..944042) [2259 bp, 752 aa] {ON}
           highly similar to uniprot|P43535 Saccharomyces
           cerevisiae YFR009W GCN20 Positive regulator of the Gcn2p
           kinase activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 72.0 bits (175), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 63/236 (26%), Positives = 106/236 (44%), Gaps = 48/236 (20%)

Query: 472 VEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKI 531
           ++ Q VSFSY  ++++ +  D+N  ++  S + +VG +G GK+T+  +++    PT G +
Sbjct: 532 IQLQDVSFSY--KESDPLLTDVNLDVQMDSRISLVGANGCGKTTLLKVMMEQLRPTKGFV 589

Query: 532 LVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCH 591
                      S++ R ++G   Q  +                  SM+ +   A      
Sbjct: 590 -----------SRNPRLRIGYFTQHHV-----------------DSMD-LNQSAVDWMST 620

Query: 592 AFISKFPNGYETIIGP----------RGALLSGGQKQRIAIARALLNKPKILILDEATSA 641
           AF  K    Y   +G           R  LLSGGQK R+A A   LN P IL+LDE ++ 
Sbjct: 621 AFPGKTDEEYRRHLGAFGISGSLGIQRMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNH 680

Query: 642 LDVESEGAI-----NYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVE 692
           LD     A+     ++  G LM S ++++I+     + I  SE   V   DG++ +
Sbjct: 681 LDTAGLDALVDALKSFNGGVLMVSHDISVINSV--CNEIWVSEGGKVQRFDGTIFD 734

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 612 LSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAH 670
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y L   +K+   T++ ++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPATVLVVSH 422

>YFR009W Chr6 (162488..164746) [2259 bp, 752 aa] {ON}  GCN20Positive
           regulator of the Gcn2p kinase activity, forms a complex
           with Gcn1p; proposed to stimulate Gcn2p activation by an
           uncharged tRNA
          Length = 752

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 63/232 (27%), Positives = 101/232 (43%), Gaps = 52/232 (22%)

Query: 472 VEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKI 531
           ++ Q VSF Y   + N + KD+N  ++  S + +VG +G GK+T+  +++    P  G +
Sbjct: 532 IQLQDVSFGYD--ENNLLLKDVNLDVQMDSRIALVGANGCGKTTLLKIMMEQLRPLKGFV 589

Query: 532 LVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCH 591
                      S++ R ++G   Q  +                  SM+ + + A      
Sbjct: 590 -----------SRNPRLRIGYFTQHHV-----------------DSMD-LTTSAVDWMSK 620

Query: 592 AFISKFPNGYETIIGPRG----------ALLSGGQKQRIAIARALLNKPKILILDEA--- 638
           +F  K    Y   +G  G           LLSGGQK R+A A   LN P IL+LDE    
Sbjct: 621 SFPGKTDEEYRRHLGSFGITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNH 680

Query: 639 --TSALDVESEGAINYTLGRLMKSKELTII-SIAHRL-----STIRRSENVI 682
             T+ LD   E   N+  G LM S ++++I S+   +      T++R E  I
Sbjct: 681 LDTTGLDALVEALKNFNGGVLMVSHDISVIDSVCKEIWVSEQGTVKRFEGTI 732

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 612 LSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAH 670
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y L   +K+   T+++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPNTVLTVSH 422

>NDAI0A04200 Chr1 complement(948224..952879) [4656 bp, 1551 aa] {ON}
            Anc_5.500
          Length = 1551

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 62/225 (27%), Positives = 112/225 (49%), Gaps = 18/225 (8%)

Query: 484  RKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYN--PTSGKILVDGQDITKL 541
            ++T +I  +++  ++PG+   ++G SG GK+T+   L         +GKI VDG    +L
Sbjct: 886  KETRRILSNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGKICVDG----RL 941

Query: 542  SSKSLRRQLGVVQQEPI-LMSGTIRENITYGVS-RQP---SMEEIRSVAKKCFCHAFISK 596
               S  R +G  QQ+ + L + T+RE++ +    RQP   S+EE     ++      +  
Sbjct: 942  RDTSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQPANISIEEKNKYVEEVIDILEMEP 1001

Query: 597  FPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILI-LDEATSALDVESEGAINYTLG 655
            + +    ++G  G  L+  Q++R+ I   L  KPK+L+ LDE TS LD ++  A    + 
Sbjct: 1002 YADA---VVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWATCQLMR 1058

Query: 656  RLMKSKELTIISIAHRLSTIRRSE--NVIVLGIDGSVVEMGKFKD 698
            +L  + +  + +I H+ S +   E   ++ L   G  V  G+  D
Sbjct: 1059 KLADNGQAILCTI-HQPSAVLMQEFDRLLFLQKGGKTVYFGELGD 1102

>Smik_7.313 Chr7 (524077..526335) [2259 bp, 752 aa] {ON} YFR009W
           (REAL)
          Length = 752

 Score = 71.6 bits (174), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 62/232 (26%), Positives = 102/232 (43%), Gaps = 52/232 (22%)

Query: 472 VEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKI 531
           ++ Q VSF Y  +  N + KD+N  ++  S + +VG +G GK+T+  +++    P  G +
Sbjct: 532 IQLQDVSFGYDEK--NLLLKDVNLDVQMDSRIALVGANGCGKTTLLKIMMEQLRPLKGFV 589

Query: 532 LVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCH 591
                      S++ R ++G   Q  +                  SM+ + + A      
Sbjct: 590 -----------SRNPRLRIGYFTQHHV-----------------DSMD-LTTSAVDWMSK 620

Query: 592 AFISKFPNGYETIIGPRG----------ALLSGGQKQRIAIARALLNKPKILILDEATSA 641
           +F  K    Y   +G  G           LLSGGQK R+A A   LN P IL+LDE ++ 
Sbjct: 621 SFPGKTDEEYRRHLGSFGITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNH 680

Query: 642 LDVESEGAI-----NYTLGRLMKSKELTII-SIAHRL-----STIRRSENVI 682
           LD     A+     N+  G LM S ++++I S+   +      T++R E  I
Sbjct: 681 LDTTGLDALVDALKNFNGGVLMVSHDISVIDSVCKEIWVSEQGTVKRFEGTI 732

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 612 LSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAH 670
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y L   +K+   T+++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPNTVLTVSH 422

>ZYRO0B14762g Chr2 (1201028..1205575) [4548 bp, 1515 aa] {ON} similar
            to uniprot|P32568 Saccharomyces cerevisiae YDR011W SNQ2
            ABC transporter
          Length = 1515

 Score = 72.0 bits (175), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 64/230 (27%), Positives = 118/230 (51%), Gaps = 15/230 (6%)

Query: 474  FQHVSFSYPTRKTNQIFKDLNFT--IEPGSNVCIVGPSGRGKSTIASLLLRYYNP--TSG 529
            +Q V +  P + T +I  D N T  + PG+   ++G SG GK+T+ + L +  N    +G
Sbjct: 871  WQDVRYVIPYQGTEKILLD-NVTGYVAPGTMTALMGESGAGKTTLLNTLAKRANVGIVTG 929

Query: 530  KILVDGQDITKLSSKSLRRQLGVVQQEPI-LMSGTIRENITYG--VSRQPSMEEIRSVAK 586
             + ++G+ +      S  R+ G VQQ+ I +   T+RE++ +   + R  S+ +   VA 
Sbjct: 930  DMSINGKPV----DSSFERRTGYVQQQDIHIAEMTVRESLVFSARLRRPQSIPDAEKVAD 985

Query: 587  KCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILI-LDEATSALDVE 645
                   +     G + ++G  GA L+  Q+++++I   L+ KP +L+ LDE TS LD +
Sbjct: 986  AETVMKLLDMEEYG-DALVGGLGAGLNVEQRKKLSIGVELVAKPDLLLFLDEPTSGLDSQ 1044

Query: 646  SEGAINYTLGRLMKSKELTIISIAHRLSTI-RRSENVIVLGIDGSVVEMG 694
            S  AI   L R+ K+ +  + +I    +T+  + + +++L   G  V  G
Sbjct: 1045 SSWAIVQLLRRIAKAGQCILCTIHQPSATLFEQFDRLLLLKKGGQTVYFG 1094

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 55/236 (23%), Positives = 109/236 (46%), Gaps = 30/236 (12%)

Query: 484 RKTNQIFKDLNFTIEPGSNVCIVGPSGRGKS----TIASLLLRYYNPTSGKILVDG--QD 537
           ++  +I +++N   +PG  + ++G  G G S    T A +  ++     G+IL DG  Q+
Sbjct: 174 QRMRKILQNINVLAKPGEMILVLGRPGSGCSSFLKTAAGVTDQFAGGVDGEILYDGIPQN 233

Query: 538 ITKLSSKS---LRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFC---- 590
           +   + KS      +L V    P L   T+++ + + ++ +     + +V++K       
Sbjct: 234 VMMKNYKSDVIYNPELDV--HFPFL---TVKQTLDFAIACKTPAVRVNNVSRKEHIRATR 288

Query: 591 --HAFISKFPNGYETIIGP---RGALLSGGQKQRIAIARALLNKPKILILDEATSALDVE 645
             +A I    + Y+T +G    RG  +SGG+++R++IA AL  +  +   D AT  LD  
Sbjct: 289 DLYATIFGLTHTYDTKVGNDFVRG--VSGGERKRVSIAEALAARGTVYSWDNATRGLDAS 346

Query: 646 SEGAINYTLG-RLMKS--KELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKD 698
           +  A+ Y    R+M +  +    ++I      I  + + + +   G  +  G  KD
Sbjct: 347 T--ALEYAQAIRIMTNLLRSTAFVTIYQASENIYETFDKVTVLHSGRQIYYGSTKD 400

>KAFR0A03790 Chr1 complement(770906..773536) [2631 bp, 876 aa] {ON}
           Anc_8.661 YPL147W
          Length = 876

 Score = 71.6 bits (174), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 60/215 (27%), Positives = 102/215 (47%), Gaps = 27/215 (12%)

Query: 487 NQIFKDLN--FTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSK 544
           N+I  D++  F    GS++ I+GP+G GKS+I  ++   + P   K          L SK
Sbjct: 629 NEITNDISIPFLNSAGSSLLILGPNGCGKSSIQRIIAEIW-PIYNK--------NGLLSK 679

Query: 545 SLRRQLGVVQQEPILMSG-TIRENITYGVSRQPSMEEIRSVAKKCFCHA-------FISK 596
                L  V Q+P    G T+R+ I Y +S     +  R +  K            ++ K
Sbjct: 680 PTEANLLCVPQKPYFTRGGTLRDQIIYPMSSDEFFD--RGLKDKLLVQVLREVKLDYLLK 737

Query: 597 FPNGYETI--IGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTL 654
              G+  +  +     +LSGG+KQR+  AR + +KP+ ++LDEAT+A+  + E      L
Sbjct: 738 RDKGWSYLDTVSDWKDVLSGGEKQRMNFARIMFHKPRFVVLDEATNAISADMEDY----L 793

Query: 655 GRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGS 689
             ++K      I+I+ R S I+  + ++ +  D S
Sbjct: 794 FNVLKRYRFNFITISQRPSLIKYHDLLLEISDDNS 828

>TBLA0D04350 Chr4 complement(1076344..1079703) [3360 bp, 1119 aa]
           {ON} Anc_1.427 YCR011C
          Length = 1119

 Score = 71.6 bits (174), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 66/238 (27%), Positives = 122/238 (51%), Gaps = 17/238 (7%)

Query: 472 VEFQHVSFSYPTRKTNQ----IFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLL--RYYN 525
           + F+++S++ P+   N     I K+++  ++PG  + I+G SG GK+T+  +L   R   
Sbjct: 433 LSFENISYNVPSISDNNSERDILKNVSGIVKPGEIMAILGGSGAGKTTLLDILAFKRKSG 492

Query: 526 PTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILM-SGTIRENI-TYGVSRQPSMEEIRS 583
             SG I ++G+++++   + + + +G V Q+  L  + T+ E +    + R P+      
Sbjct: 493 HVSGDIKINGKNVSR---EIISKMIGFVDQDDFLFPTLTVYEAVLNSALLRLPNSMTFYQ 549

Query: 584 VAKKCFCHAFISKFPNGYETIIG---PRGALLSGGQKQRIAIARALLNKPKILILDEATS 640
             ++ F      +  N  + +IG    RG  +SGG+K+R++IA  L+  P IL LDE TS
Sbjct: 550 KQQRVFQVLEELRIYNIKDRLIGDDFERG--ISGGEKRRVSIACELVTSPLILFLDEPTS 607

Query: 641 ALDVESEGAINYTLGRLMKSKELTIISIAHR-LSTIRRSENVIVLGIDGSVVEMGKFK 697
            LD  +   +   L RL K+   T++   H+  S I    + +VL   G +V  G+ +
Sbjct: 608 GLDSNNANNVVECLVRLAKNYNRTLVLTIHQPRSNIFHLFSKLVLLSSGEMVYSGEIR 665

>KNAG0B03870 Chr2 complement(741637..746178) [4542 bp, 1513 aa] {ON}
            Anc_5.500 YDR406W
          Length = 1513

 Score = 71.6 bits (174), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 60/203 (29%), Positives = 105/203 (51%), Gaps = 16/203 (7%)

Query: 485  KTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYN--PTSGKILVDGQDITKLS 542
            +T +I  +++  ++PG+   ++G SG GK+T+   L         +G I VDG       
Sbjct: 883  ETRRILNNVDGWVKPGTLTALMGSSGAGKTTLLDCLAERVTMGVITGDIFVDGLP----R 938

Query: 543  SKSLRRQLGVVQQEPI-LMSGTIRENITYGVS-RQP---SMEEIRSVAKKCFCHAFISKF 597
            ++S  R +G  QQ+ + L + T+RE++ +    RQP   S+EE  +  ++      + K+
Sbjct: 939  NESFPRSIGYCQQQDLHLKTSTVRESLRFSAYLRQPKEVSVEEKNAYVEEIIKILEMEKY 998

Query: 598  PNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILI-LDEATSALDVESEGAINYTLGR 656
             +    I+G  G  L+  Q++R+ I   L  KPK+L+ LDE TS LD ++  AI   + +
Sbjct: 999  ADA---IVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWAICQLMKK 1055

Query: 657  LMKSKELTIISIAHRLSTIRRSE 679
            L K  +  + +I H+ S I   E
Sbjct: 1056 LCKHGQAILCTI-HQPSAILMQE 1077

>TBLA0D01780 Chr4 complement(438830..443617) [4788 bp, 1595 aa] {ON}
            Anc_5.500 YDR406W
          Length = 1595

 Score = 71.2 bits (173), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 102/203 (50%), Gaps = 14/203 (6%)

Query: 484  RKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYN--PTSGKILVDGQDITKL 541
            ++T +I  +++  ++PG+   ++G SG GK+T+   L         +G + +DG    K 
Sbjct: 964  KETRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGDVFIDG----KP 1019

Query: 542  SSKSLRRQLGVVQQEPI-LMSGTIRENITYGVS-RQPSMEEIRSVAKKCFCHAFIS--KF 597
              +S  R +G  QQ+ + L + T+RE++ +    RQP+  E+    K  +    I   + 
Sbjct: 1020 RDESFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQPA--EVSIAEKNAYVEDIIKILEM 1077

Query: 598  PNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILI-LDEATSALDVESEGAINYTLGR 656
                + I+G  G  L+  Q++R+ I   L  KPK+L+ LDE TS LD ++  AI   + +
Sbjct: 1078 EKYADAIVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWAICQLMRK 1137

Query: 657  LMKSKELTIISIAHRLSTIRRSE 679
            L    +  + +I H+ S I   E
Sbjct: 1138 LCNQGQAILCTI-HQPSAILMQE 1159

 Score = 35.4 bits (80), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 40/183 (21%), Positives = 73/183 (39%), Gaps = 23/183 (12%)

Query: 482 PTRKTN--QIFKDLNFTIEPGSNVCIVGPSGRGKSTI----------------ASLLLRY 523
           PT++ +  QI K ++  ++PG  + ++G  G G +T+                + +    
Sbjct: 244 PTKEEDLFQILKPMDGCLKPGELLVVLGRPGSGCTTLLKSITSNTHGFHVGKDSQISYSG 303

Query: 524 YNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRS 583
           ++P   K    G+ +    S      L V Q    +      +N   GVSR+     I  
Sbjct: 304 FSPKEIKRHYRGEVVYNAESDIHLPHLTVYQTLITVARLKTPQNRIQGVSREDYANHIAE 363

Query: 584 VAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALD 643
           VA   +  +       G + + G     +SGG+++R++IA   +   K    D AT  LD
Sbjct: 364 VAMATYGLSHTRNTKVGNDLVRG-----VSGGERKRVSIAEVAICGSKFQCWDNATRGLD 418

Query: 644 VES 646
             +
Sbjct: 419 AAT 421

>TDEL0D04040 Chr4 complement(738550..743052) [4503 bp, 1500 aa] {ON} 
          Length = 1500

 Score = 71.2 bits (173), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 64/232 (27%), Positives = 117/232 (50%), Gaps = 12/232 (5%)

Query: 470  GKVEFQHVSFSYPTRK-TNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLL-RYYNPT 527
            G   +Q V ++ P +    ++  +++    PG+   ++G SG GK+T+ + L  R     
Sbjct: 841  GVFMWQKVCYTIPYKGGPRRLLDNVSGYCVPGTMTALMGESGAGKTTLLNTLAQRNVGVI 900

Query: 528  SGKILVDGQDITKLSSKSLRRQLGVVQQEPI-LMSGTIRENITYGVSRQPSMEEIRSVAK 586
            +G +LV+G+ I      S  R+ G VQQ+ + +   T+RE++ +  +R    + +    K
Sbjct: 901  TGDMLVNGRPI----DASFERRTGYVQQQDLHIAEMTVRESLIFS-ARMRRKQSVPDAEK 955

Query: 587  KCFCHAFISKFPNG--YETIIGPRGALLSGGQKQRIAIARALLNKPKILI-LDEATSALD 643
              F    I     G   E ++G  GA LS  Q+++++I   L+ KP +L+ LDE TS LD
Sbjct: 956  IEFAEKIIDILDMGEYAEALVGEPGAGLSVEQRKKLSIGVELVAKPDLLLFLDEPTSGLD 1015

Query: 644  VESEGAINYTLGRLMKSKELTIISIAHRLSTI-RRSENVIVLGIDGSVVEMG 694
             +S  AI   L +L K+ +  + +I    +T+  + + +++L   G  V  G
Sbjct: 1016 SQSAWAIVQLLRKLAKAGQSILCTIHQPSATLFEQFDRLLLLKKGGQTVYFG 1067

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 47/203 (23%), Positives = 92/203 (45%), Gaps = 28/203 (13%)

Query: 485 KTNQIFKDLNFTIEPGSNVCIVGPSGRGKS----TIASLLLRYYNPTSGKILVDG---QD 537
           K  +I + +N    PG  V ++G  G G S    T A +  ++    SG I  +G    +
Sbjct: 154 KMRKILRGVNLLARPGEMVLVLGRPGAGCSSMLKTAAGVTDQFAGGVSGDISYNGISQDE 213

Query: 538 ITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFC------H 591
           I K     +     +    P L   T+++ + + ++ +   + + +++++ +       +
Sbjct: 214 IMKDFRSDVIYNGELDVHFPYL---TVKQTLDFAIACKTPAKRVNNMSEQEYIDFTRDFY 270

Query: 592 AFISKFPNGYETIIGP---RGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEG 648
           A I    + Y+T +G    RG  +SGG+++R++IA A++ +  +   D AT  LD  +  
Sbjct: 271 ATIFGLTHTYDTKVGNDFVRG--VSGGERKRVSIAEAVVARGSVYCWDNATRGLDAST-- 326

Query: 649 AINYT-----LGRLMKSKELTII 666
           A+ Y      +  LM S  L  I
Sbjct: 327 ALEYAKAIRIMTNLMHSTALVTI 349

>NDAI0H03570 Chr8 complement(872905..875172) [2268 bp, 755 aa] {ON}
           Anc_1.366
          Length = 755

 Score = 70.9 bits (172), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 93/203 (45%), Gaps = 32/203 (15%)

Query: 472 VEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKI 531
           ++ Q VSF Y       + KD+N  ++  S + +VG +G GK+T+  +++    PT G +
Sbjct: 535 IQLQDVSFGYDPESL--LLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEELRPTKGFV 592

Query: 532 LVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSM--EEIRSVAKKCF 589
                      S++ R ++G   Q  +      +  + +  +  P    EE R       
Sbjct: 593 -----------SRNGRLRIGYFTQHHVDSLDLTKSAVDWMSTAYPGKNDEEYRR------ 635

Query: 590 CHAFISKFPNGYETIIG-PRGALLSGGQKQRIAIARALLNKPKILILDEA-----TSALD 643
               +  F  G    +G  R  LLSGGQK R+A A   LN P IL+LDE      TS LD
Sbjct: 636 ---HLGSF--GITGSLGLQRMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDTSGLD 690

Query: 644 VESEGAINYTLGRLMKSKELTII 666
              +   N++ G LM S +++II
Sbjct: 691 ALEDSLKNFSGGVLMVSHDISII 713

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 612 LSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAH 670
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y L   +K+   T+++++H
Sbjct: 371 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPATVLTVSH 425

>Suva_6.84 Chr6 complement(145289..147547) [2259 bp, 752 aa] {ON}
           YFR009W (REAL)
          Length = 752

 Score = 70.5 bits (171), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 62/234 (26%), Positives = 103/234 (44%), Gaps = 48/234 (20%)

Query: 472 VEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKI 531
           ++ Q V F Y   + N + +D+N  ++  S + +VG +G GK+T+  +++    PT G +
Sbjct: 532 IQLQDVFFGY--NENNLLLRDVNLDVQMDSRIALVGANGCGKTTLLKIMMEQLRPTKGFV 589

Query: 532 LVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCH 591
                      S++ R ++G   Q  +                  SM+ + + A     +
Sbjct: 590 -----------SRNPRLRIGYFTQHHV-----------------DSMD-LTTSAVDWMSN 620

Query: 592 AFISKFPNGYETIIGPRG----------ALLSGGQKQRIAIARALLNKPKILILDEATSA 641
           +F  K    Y   +G  G           LLSGGQK R+A A   LN P IL+LDE ++ 
Sbjct: 621 SFPGKTDEEYRRHLGSFGITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNH 680

Query: 642 LDVESEGAI-----NYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSV 690
           LD     A+     N+  G LM S ++++I    +   I  SE   V   +GS+
Sbjct: 681 LDTTGLDALVDALKNFNGGVLMVSHDISVIDSVCK--EIWVSEEGTVKRFEGSI 732

 Score = 45.1 bits (105), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 612 LSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAH 670
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y L   +K+   TI++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPNTILTVSH 422

>TPHA0D04700 Chr4 (1026978..1031510) [4533 bp, 1510 aa] {ON} 
          Length = 1510

 Score = 70.9 bits (172), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 65/227 (28%), Positives = 112/227 (49%), Gaps = 24/227 (10%)

Query: 485  KTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYN--PTSGKILVDGQDITKLS 542
            +T +I  +++  ++PG+   ++G SG GK+T+   L         +G I VDG       
Sbjct: 882  ETRRILNNVDGWVKPGTLTALMGSSGAGKTTLLDCLAERVTMGVITGDIFVDGLP----R 937

Query: 543  SKSLRRQLGVVQQEPI-LMSGTIRENITYGVS-RQPSMEEIRSVAKKCFCHAFISKFPNG 600
              S  R +G  QQ+ + L + T+RE++ +    RQP+     SV++K   HA++ +    
Sbjct: 938  DTSFPRSIGYCQQQDLHLTTATVRESLRFSAELRQPAD---VSVSEK---HAYVEEVIKI 991

Query: 601  YE------TIIGPRGALLSGGQKQRIAIARALLNKPKILI-LDEATSALDVESEGAINYT 653
             E       ++G  G  L+  Q++R+ I   L  KPK+L+ LDE TS LD ++  +I   
Sbjct: 992  LEMEKYADAVVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSICQL 1051

Query: 654  LGRLMKSKELTIISIAHRLSTIRRSE--NVIVLGIDGSVVEMGKFKD 698
            + +L K  +  + +I H+ S I   E   ++ L   G  V  G+  D
Sbjct: 1052 MKKLAKFGQAILCTI-HQPSAILMQEFDRLLFLQKGGKTVYFGELGD 1097

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 72/178 (40%), Gaps = 27/178 (15%)

Query: 485 KTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITK--LS 542
           K  QI K ++  I+PG  + ++G  G G +T   LL    + T G  L D  +I+   L+
Sbjct: 168 KKVQILKSVDGLIKPGELLVVLGRPGSGCTT---LLKSITSNTHGFQLTDESEISYDGLT 224

Query: 543 SKSLRR-----------------QLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVA 585
            K +++                  L V Q    +      +N   GV+R+   + +  V 
Sbjct: 225 PKEIKKHYRGDVVYNAEADIHLPHLTVFQTLVTVAKLKTPQNRFKGVTREQFADHVTDVT 284

Query: 586 KKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALD 643
              +          G + + G     +SGG+++R++IA   +   K    D AT  LD
Sbjct: 285 MATYGLLHTRNTKVGNDLVRG-----VSGGERKRVSIAEVTICGSKFQCWDNATRGLD 337

>Skud_14.404 Chr14 (733442..737716) [4275 bp, 1424 aa] {ON} YNR070W
            (REAL)
          Length = 1424

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 68/246 (27%), Positives = 123/246 (50%), Gaps = 16/246 (6%)

Query: 460  TTGKAFKPLNGKVEFQHVSFSYPTRKTN---QIFKDLNFTIEPGSNVCIVGPSGRGKSTI 516
            +T   F+ L     F   + S+  R +N   ++  +++    PG+   ++G SG GK+T+
Sbjct: 761  STHTEFEGLESTGVFIWRNVSFTIRHSNGQRKLLDNVSGYCVPGTLTALIGESGAGKTTL 820

Query: 517  ASLLL-RYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSG-TIRENITYGVS- 573
             + L  R     +G ILVDG  +      S  R+ G VQQ+ +  +  T+RE++ +    
Sbjct: 821  LNTLAQRNVGTVTGDILVDGLPM----DASFERRTGYVQQQDLHTAELTVRESLQFSARM 876

Query: 574  RQPSMEEIRSVAKKCFCHAFIS--KFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPK 631
            R+P  + I  V K  +    I   +     E ++G  G  L+  Q+++++I   L+ KP 
Sbjct: 877  RRP--QSIPDVEKMEYVEKIIDILEMQEFSEALVGEIGYGLNVEQRKKLSIGVELVGKPD 934

Query: 632  ILI-LDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTI-RRSENVIVLGIDGS 689
            +L+ LDE TS LD +S  +I   L RL ++ +  + +I    +T+  + E +++LG  G 
Sbjct: 935  LLLFLDEPTSGLDSQSAWSIVKMLKRLTQAGQSILCTIHQPSATLFEQFERLLLLGKGGQ 994

Query: 690  VVEMGK 695
             V  G+
Sbjct: 995  TVYFGE 1000

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 57/237 (24%), Positives = 105/237 (44%), Gaps = 23/237 (9%)

Query: 485 KTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTI----ASLLLRYYNPTSGKILVDGQDITK 540
           K  +I KD++   +PG  V ++G  G G S++    A    ++    +G I  DG    +
Sbjct: 88  KMRKILKDVSLLAKPGEMVLVLGRPGAGCSSLLKCAAGETNQFAGDLTGDISYDGISQKE 147

Query: 541 LSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSV-------AKKCFCHAF 593
           +        +   +Q+      T+++ + + ++ +   + + +V       A + F +A 
Sbjct: 148 MMQHYKADVIYNGEQDVHFPYLTVKQTLDFAIACKMPAKRVNNVTGAEYIAANRDF-YAQ 206

Query: 594 ISKFPNGYETIIGPRGAL-LSGGQKQRIAIARALLNKPKILILDEATSALD----VESEG 648
           I    + Y+T +G      +SGG+++R++IA AL  +  I   D AT  LD    +E   
Sbjct: 207 IFGLAHTYDTRVGNDFVSGVSGGERKRVSIAEALAARGSIYCWDNATRGLDASTALEFAQ 266

Query: 649 AINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGK---FKDLYAN 702
           AI  T+  L+ S  L  I+I      I  + + + +   G  V  GK    KD + N
Sbjct: 267 AIR-TMTELLGSTAL--ITIYQASENIYETFDKVTVLYAGRQVFYGKATEAKDYFEN 320

>TBLA0D01820 Chr4 (448516..453171) [4656 bp, 1551 aa] {ON} 
          Length = 1551

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 101/202 (50%), Gaps = 14/202 (6%)

Query: 485  KTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYN--PTSGKILVDGQDITKLS 542
            +T +I  +++  ++PG+   ++G SG GK+T+   L         +G + +DG    K  
Sbjct: 907  ETRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGDVFIDG----KPR 962

Query: 543  SKSLRRQLGVVQQEPI-LMSGTIRENITYGVS-RQPSMEEIRSVAKKCFCHAFIS--KFP 598
             +S  R +G  QQ+ + L + T+RE++ +    RQP+  E+    K  +    I   +  
Sbjct: 963  DESFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQPA--EVSIAEKNAYVEDIIKILEME 1020

Query: 599  NGYETIIGPRGALLSGGQKQRIAIARALLNKPKILI-LDEATSALDVESEGAINYTLGRL 657
               + I+G  G  L+  Q++R+ I   L  KPK+L+ LDE TS LD ++  AI   + +L
Sbjct: 1021 KYADAIVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWAICQLMRKL 1080

Query: 658  MKSKELTIISIAHRLSTIRRSE 679
                +  + +I H+ S I   E
Sbjct: 1081 CNQGQAILCTI-HQPSAILMQE 1101

>NCAS0A12060 Chr1 (2388467..2393098) [4632 bp, 1543 aa] {ON} Anc_5.500
          Length = 1543

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 62/233 (26%), Positives = 114/233 (48%), Gaps = 13/233 (5%)

Query: 474  FQHVSFSYPTRK-TNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYN--PTSGK 530
            ++ + +  P +K   +I  +++  ++PG+   ++G SG GK+T+   L         +G 
Sbjct: 880  WRDLCYDVPIKKEVRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGTITGN 939

Query: 531  ILVDGQDITKLSSKSLRRQLGVVQQEPI-LMSGTIRENITYGVS-RQPSMEEIRSVAKKC 588
            I VDG    +L  +S  R +G  QQ+ + L + T+RE++ +    RQP+   I    K  
Sbjct: 940  IYVDG----RLRDESFPRSIGYCQQQDLHLKTSTVRESLRFSAYLRQPAAVSIEEKNKYV 995

Query: 589  FCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILI-LDEATSALDVESE 647
                 I +     + ++G  G  L+  Q++R+ I   L  KPK+L+ LDE TS LD ++ 
Sbjct: 996  EEVIRILEMEAYADAVVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTA 1055

Query: 648  GAINYTLGRLMKSKELTIISIAHRLSTI--RRSENVIVLGIDGSVVEMGKFKD 698
             A    + +L ++ +  + +I H+ S I  +  + ++ L   G  V  G   D
Sbjct: 1056 WATCQLMRKLAENGQAILCTI-HQPSAILMQDFDRLLFLQKGGQTVYFGDLGD 1107

>TPHA0D01170 Chr4 complement(245675..248422) [2748 bp, 915 aa] {ON}
           Anc_8.661 YPL147W
          Length = 915

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 73/261 (27%), Positives = 113/261 (43%), Gaps = 50/261 (19%)

Query: 448 FELLDYKPTIKSTTGKAFKPLNGKVEFQHVSFSYP--TRKTNQIFKDLN----------- 494
           FE +D    I ST G+    L  K+ FQ   F  P  + K N + +DLN           
Sbjct: 612 FENIDV--IIPSTKGQLGSKLIKKLTFQIPPFIAPISSMKINSL-QDLNTSLSKLNISNK 668

Query: 495 ---------FTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKS 545
                    F+  PGS++ I+GP+  GKS+I  ++   + P   K          L S  
Sbjct: 669 NSIYDMTLPFSYGPGSSLLILGPNSCGKSSIQRIIAEIW-PIYNK--------NGLMSIP 719

Query: 546 LRRQLGVVQQEPILMSG-TIRENITYGVSRQPSMEEIRSVAKKCFCH-------AFISKF 597
              +L  + Q P    G T R+ I Y +      +  R +  K            ++ K 
Sbjct: 720 AEDELMCIPQRPYFSKGGTFRDQIIYPMGSDEFFD--RGLKDKLLVQILADVKLEYLLKR 777

Query: 598 PNGYETI--IGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLG 655
             G+     +     +LSGG+KQR+  AR L +KP+ +ILDEAT+A+ V+ E      L 
Sbjct: 778 DKGWSYFDAVFDWKDVLSGGEKQRMNFARILFHKPRFVILDEATNAISVDMEDY----LF 833

Query: 656 RLMKSKELTIISIAHRLSTIR 676
           +++K      ISI+ R S ++
Sbjct: 834 KMLKKYRFNFISISQRPSLVK 854

>KAFR0C05210 Chr3 (1037177..1041658) [4482 bp, 1493 aa] {ON} 
          Length = 1493

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 63/221 (28%), Positives = 111/221 (50%), Gaps = 18/221 (8%)

Query: 485  KTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYN--PTSGKILVDGQDITKLS 542
            +T +I  +++  ++PG+   ++G SG GK+T+   L         +G +LVDG+      
Sbjct: 867  ETRRILNNVDGWVKPGTLTALMGSSGAGKTTLLDCLAERVTMGVITGDVLVDGRP----R 922

Query: 543  SKSLRRQLGVVQQEPI-LMSGTIRENITYGVS-RQP---SMEEIRSVAKKCFCHAFISKF 597
             +S  R +G  QQ+ + L + T+RE++ +    RQP   S+EE  +  ++      + K+
Sbjct: 923  DESFPRSIGYCQQQDLHLKTSTVRESLRFSAYLRQPAEVSVEEKDAYVEEVIKILEMEKY 982

Query: 598  PNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILI-LDEATSALDVESEGAINYTLGR 656
             +    ++G  G  L+  Q++R+ I   L  KPK+L+ LDE TS LD ++  +I   L R
Sbjct: 983  ADA---VVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSIC-QLMR 1038

Query: 657  LMKSKELTIISIAHRLSTIRRSE--NVIVLGIDGSVVEMGK 695
             + S    I+   H+ S I   E   ++ L   G  V  G+
Sbjct: 1039 KLASHGQAILCTIHQPSAILMQEFDRLLFLQKGGKTVYFGE 1079

>YOL075C Chr15 complement(189658..193542) [3885 bp, 1294 aa] {ON}
           Putative ABC transporter
          Length = 1294

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 66/228 (28%), Positives = 109/228 (47%), Gaps = 37/228 (16%)

Query: 484 RKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLL-------LRYYNPTSGKILVDGQ 536
            +T +I + +N   +PG    I+GPSG GKS++ +L+       +     TSG I+ +  
Sbjct: 704 HETKEILQSVNAIFKPGMINAIMGPSGSGKSSLLNLISGRLKSSVFAKFDTSGSIMFNDI 763

Query: 537 DITKLSSKSLRRQLGVVQQEP--ILMSGTIRENITYG-------VSRQPSMEE----IRS 583
            +++L  K++      V Q+   +L + T++E + Y        ++    ME     IRS
Sbjct: 764 QVSELMFKNV---CSYVSQDDDHLLAALTVKETLKYAAALRLHHLTEAERMERTDNLIRS 820

Query: 584 VA-KKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSAL 642
           +  K C  +   ++F  G           +SGG+K+R+ +   LLN P IL+LDE TS L
Sbjct: 821 LGLKHCENNIIGNEFVKG-----------ISGGEKRRVTMGVQLLNDPPILLLDEPTSGL 869

Query: 643 DVESEGAINYTLGRLMKSKELTIISIAH--RLSTIRRSENVIVLGIDG 688
           D  +   I   L +L + +  TII   H  R    +R  NV++L   G
Sbjct: 870 DSFTSATILEILEKLCREQGKTIIITIHQPRSELFKRFGNVLLLAKSG 917

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 55/218 (25%), Positives = 97/218 (44%), Gaps = 42/218 (19%)

Query: 485 KTNQ-IFKDLNFTIEPGSNVCIVGPSGRGKSTIASLL-------------LRYYNPTSG- 529
           KTN  +    +  +  GS + ++G SG GK+T+ ++L             +RY    +G 
Sbjct: 39  KTNTTLVNTFSMDLPSGSVMAVMGGSGSGKTTLLNVLASKISGGLTHNGSIRYVLEDTGS 98

Query: 530 --------KILVDGQDITKLSSKSLRRQLGVV---QQEPILMSGTIRENITYGVSRQPSM 578
                   +  +DGQD        +++ + +    QQ+ +    T RE + +    + + 
Sbjct: 99  EPNETEPKRAHLDGQD------HPIQKHVIMAYLPQQDVLSPRLTCRETLKFAADLKLNS 152

Query: 579 EEIRSVAKKCFCHAFISKF--PNGYETIIGP---RGALLSGGQKQRIAIARALLNKPKIL 633
            E     KK      I +    +  +T++G    RG  LSGG+K+R++I   +++ P I+
Sbjct: 153 SE---RTKKLMVEQLIEELGLKDCADTLVGDNSHRG--LSGGEKRRLSIGTQMISNPSIM 207

Query: 634 ILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHR 671
            LDE T+ LD  S   +  TL +L K    T I   H+
Sbjct: 208 FLDEPTTGLDAYSAFLVIKTLKKLAKEDGRTFIMSIHQ 245

>KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON} Anc_5.500
            YDR406W
          Length = 1499

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 75/276 (27%), Positives = 133/276 (48%), Gaps = 22/276 (7%)

Query: 436  ELMKGAGAATRLFELLDYKPTIKSTTGKAFKPLNGKVEFQHVSFSY--PTRK-TNQIFKD 492
            +  KG+  AT    + D + T +S+T  A + L  +  F   +  Y  P +  T ++  +
Sbjct: 814  DFEKGSFDATNHDLIKDSESTDESSTNGA-RLLKSQAVFHWRNLCYDIPIKHGTRRLLDN 872

Query: 493  LNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYN--PTSGKILVDGQDITKLSSKSLRRQL 550
            ++  ++PG+   ++G SG GK+T+   L         +G +LVDG+       +S  R +
Sbjct: 873  VDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGDVLVDGRP----RDESFPRSI 928

Query: 551  GVVQQEPI-LMSGTIRENITYGVS-RQP---SMEEIRSVAKKCFCHAFISKFPNGYETII 605
            G  QQ+ + L + T+RE++ +    RQP   S+EE  +  ++      + K+ +    ++
Sbjct: 929  GYCQQQDLHLKTSTVRESLRFSAYLRQPAEVSVEEKDAYVEEVIKILEMEKYADA---VV 985

Query: 606  GPRGALLSGGQKQRIAIARALLNKPKILI-LDEATSALDVESEGAINYTLGRLMKSKELT 664
            G  G  L+  Q++R+ I   L  KPK+L+ LDE TS LD ++  +I   L R + S    
Sbjct: 986  GVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSIC-QLMRKLASHGQA 1044

Query: 665  IISIAHRLSTIRRSE--NVIVLGIDGSVVEMGKFKD 698
            I+   H+ S I   E   ++ L   G     G+  D
Sbjct: 1045 ILCTIHQPSAILMQEFDRLLFLQDGGQTTYFGELGD 1080

>TPHA0L01500 Chr12 (311715..316274) [4560 bp, 1519 aa] {ON} Anc_8.517
            YPL058C
          Length = 1519

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 64/231 (27%), Positives = 116/231 (50%), Gaps = 17/231 (7%)

Query: 474  FQHVSFSYPTR-KTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYN--PTSGK 530
            + H++++ P    T Q+  D+   ++PG    ++G SG GK+T+ ++L +  N    +G 
Sbjct: 847  WNHLNYTIPYDGATRQLLNDIFGYVKPGKMTALMGESGAGKTTLLNVLAQRINMGVITGD 906

Query: 531  ILVDGQDITKLSSKSLRRQLGVVQQEPILMSG-TIRENITYGVS-RQP---SMEEIRSVA 585
            +LV+ +D+      S  R  G V Q    M   ++RE++ +    RQP   S+EE     
Sbjct: 907  MLVNAKDL----PASFNRSCGYVAQADNHMGELSVRESLQFAAELRQPKNVSIEEKHEYV 962

Query: 586  KKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILI-LDEATSALDV 644
            +K      +    N  E +IG  G  L+  Q+++++I   L+ KP +L+ LDE TS LD 
Sbjct: 963  EKIIS---LLGMQNYAEALIGKTGRGLNVEQRKKLSIGVELVAKPSLLLFLDEPTSGLDS 1019

Query: 645  ESEGAINYTLGRLMKSKELTIISIAHRLSTI-RRSENVIVLGIDGSVVEMG 694
            +S  +I   L  L  S +  + +I    +T+  + + +++L   G +V  G
Sbjct: 1020 QSSWSIVQFLRALADSGQSILCTIHQPSATLFEQFDRLLLLKKGGKMVYFG 1070

 Score = 37.4 bits (85), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 42/183 (22%), Positives = 74/183 (40%), Gaps = 29/183 (15%)

Query: 482 PTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTI-------ASLLLRYYNPTSGKILVD 534
           PTRK   I +D +  IE G  + +VG  G G ST+        S LL       G+   D
Sbjct: 162 PTRK---IIRDFSGVIESGEMLFVVGRPGAGCSTLLKCISGETSELL----DVQGEFSYD 214

Query: 535 GQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFI 594
           G    ++ SK     +   + +      T++E I + +  +     I ++ +      ++
Sbjct: 215 GLSQEEMISKYKGYVIYCPELDFHFPKITVKETIDFALKCKTPRTRIDNMTRA----EYV 270

Query: 595 SKFPNGYETIIGPRGAL-----------LSGGQKQRIAIARALLNKPKILILDEATSALD 643
            K  + + T+ G R              +SGG+++R+++  A      I   D AT  LD
Sbjct: 271 DKLRDMWCTVFGLRHTYATKVGNDVVRGVSGGERKRVSLVEAQAMGASIYSWDNATRGLD 330

Query: 644 VES 646
             +
Sbjct: 331 AST 333

>Smik_15.84 Chr15 complement(153969..157856) [3888 bp, 1295 aa] {ON}
           YOL075C (REAL)
          Length = 1295

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 65/229 (28%), Positives = 109/229 (47%), Gaps = 39/229 (17%)

Query: 484 RKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLL--------LRYYNPTSGKILVDG 535
            +T QI + +N   +PG    I+GPSG GKS++ +L+           +N T+G I+++ 
Sbjct: 705 HETKQILQSVNAIFKPGMINAIMGPSGSGKSSLLNLISGRLKSSFFAKFN-TAGSIMLND 763

Query: 536 QDITKLSSKSLRRQLGVVQQEP--ILMSGTIRENITYG-------VSRQPSMEE----IR 582
             +++   K++      V Q+   +L + T++E + Y        ++    ME     IR
Sbjct: 764 IQVSEFMFKNV---CSYVSQDDDHLLATLTVKETLKYASALRLHHLTEAERMERTDNLIR 820

Query: 583 SVA-KKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSA 641
           S+  K C  +   ++F  G           +SGG+K+R+ +   LLN P IL+LDE TS 
Sbjct: 821 SLGLKHCENNIIGNEFVKG-----------ISGGEKRRVTMGVQLLNDPPILLLDEPTSG 869

Query: 642 LDVESEGAINYTLGRLMKSKELTIISIAH--RLSTIRRSENVIVLGIDG 688
           LD  +   I   L +L   +  T+I   H  R    +R  NV++L   G
Sbjct: 870 LDSFTSATILEILEKLCTEQGKTVIITIHQPRSELFKRFGNVLLLAKSG 918

 Score = 45.1 bits (105), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 59/114 (51%), Gaps = 8/114 (7%)

Query: 602 ETIIGP---RGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLM 658
           +T++G    RG  LSGG+K+R++I   +++ P ++ LDE T+ LD  S   +  TL +L 
Sbjct: 175 DTLVGDNSHRG--LSGGEKRRLSIGTQMISNPSVMFLDEPTTGLDAYSAYLVIKTLKKLA 232

Query: 659 KSKELTIISIAH--RLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710
           K    T I   H  R   +   + V +L   G+VV   K  ++    +S  +++
Sbjct: 233 KEDGRTFIMSIHQPRSDILFLLDQVCILS-KGNVVYCDKMNNIIPYFESIGYRI 285

>TPHA0A02310 Chr1 (483447..485705) [2259 bp, 752 aa] {ON} Anc_1.366
           YFR009W
          Length = 752

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 63/234 (26%), Positives = 100/234 (42%), Gaps = 48/234 (20%)

Query: 472 VEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKI 531
           ++ Q V F Y  ++   +  D+N  I+  S + +VG +G GK+T+  +++    P  G +
Sbjct: 532 IQLQDVDFGYDNKEL--LLNDVNLDIQMDSRIALVGANGCGKTTLLKVMMEQLRPVKGYV 589

Query: 532 LVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCH 591
                      S++ R ++G   Q  +                  SM+  +S A      
Sbjct: 590 -----------SRNGRLRIGYFTQHHV-----------------DSMDLDKS-AVDWMST 620

Query: 592 AFISKFPNGYETIIGPRG----------ALLSGGQKQRIAIARALLNKPKILILDEATSA 641
           AF  K    Y   +G  G           LLSGGQK R+A A   L  P IL+LDE ++ 
Sbjct: 621 AFPGKTDEEYRRHLGAFGITGSLSLQKIQLLSGGQKSRVAFAALCLENPHILVLDEPSNH 680

Query: 642 LDVESEGAI-----NYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSV 690
           LD     A+     N+T G LM S ++++I    +   I  SE   V   DG++
Sbjct: 681 LDTAGIDALVDALKNFTGGVLMVSHDISVIDSVCK--EIWVSEKGTVKRFDGNI 732

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 612 LSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAH 670
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y L   +K+   T+++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPSTVLTVSH 422

>NCAS0A08570 Chr1 (1693304..1696486) [3183 bp, 1060 aa] {ON}
           Anc_1.427
          Length = 1060

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 70/240 (29%), Positives = 113/240 (47%), Gaps = 22/240 (9%)

Query: 472 VEFQHVSFSYPTRKTN---------QIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLL- 521
           + F+++++  P+   N         ++ K ++  ++PG    I+G SG GK+T+  +L  
Sbjct: 390 LSFENITYEVPSLNKNHKSQPNSNVKVLKSIDGIVKPGQIFAIMGGSGAGKTTLLDILAM 449

Query: 522 -RYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSG-TIRENI-TYGVSRQPSM 578
            R      G+I V+G     +S KS  + +G V Q   L    T+ E +    + R P  
Sbjct: 450 KRKTGQVGGEIKVNGN---IMSRKSYSKLIGFVDQNDYLHPTLTVYETVLNSALLRLPRT 506

Query: 579 EEIRSVAKKCFCHAFISKFPNGYETIIG---PRGALLSGGQKQRIAIARALLNKPKILIL 635
               S   + F      +  +  + IIG    RG  +SGG+K+R++IA  L+  P IL L
Sbjct: 507 MSFESKQSRVFQILEELRIFDIKDRIIGNDFERG--ISGGEKRRVSIACELVTSPLILFL 564

Query: 636 DEATSALDVESEGAINYTLGRLMKSKELTIISIAHR-LSTIRRSENVIVLGIDGSVVEMG 694
           DE TS LD  +   +  +L RL K+   T+I   H+  S I    N +VL   G +V  G
Sbjct: 565 DEPTSGLDANNANNVITSLVRLAKNYNRTLILTIHQPRSNIFNQFNKLVLLSQGEMVFSG 624

>KNAG0I00530 Chr9 (88076..91219) [3144 bp, 1047 aa] {ON} Anc_1.427
           YCR011C
          Length = 1047

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 74/250 (29%), Positives = 116/250 (46%), Gaps = 47/250 (18%)

Query: 472 VEFQHVSFSYPTRKTNQI----FKDLNFTIEPGSNVCIVGPSGRGKSTIASLLL--RYYN 525
           + F+++S+  P  K ++I       +   ++PG  + I+G SG GK+T+  +L   R   
Sbjct: 396 LSFENISYDVPGAKDSKIEEKVLNSITGMVKPGQMLAIMGGSGAGKTTLLDILAMKRKTG 455

Query: 526 PTSGKILVDGQDI-TKLSSKSLRRQLGVVQQEPILM-SGTIRENI-TYGVSRQPS----- 577
              G I V+G  I  KL SK     +G V Q+  L+ + T+ E +    + R P      
Sbjct: 456 RVQGTIAVNGHSILNKLYSK----MIGFVDQDDFLLPTLTVYETVLNSALLRLPRSMPFT 511

Query: 578 ---------MEEIRSVAKKCFCHAFISKFPNGYETIIG---PRGALLSGGQKQRIAIARA 625
                    +EE+R +  K              + IIG    RG  +SGG+K+R++IA  
Sbjct: 512 AKRKRVNRVLEELRIMDIK--------------DRIIGNDFERG--ISGGEKRRVSIACE 555

Query: 626 LLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELT-IISIAHRLSTIRRSENVIVL 684
           L+  P IL LDE TS LD  +   +   L RL K+   T ++SI    S I    + +VL
Sbjct: 556 LVTSPAILFLDEPTSGLDANNANNVIECLVRLAKNYNRTLVLSIHQPRSNIFNLFDKLVL 615

Query: 685 GIDGSVVEMG 694
             DG ++  G
Sbjct: 616 LSDGEMIYSG 625

>Kwal_34.16240 s34 (257762..260020) [2259 bp, 752 aa] {ON} YFR009W
           (GCN20) - 1:1 [contig 265] FULL
          Length = 752

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 59/240 (24%), Positives = 97/240 (40%), Gaps = 48/240 (20%)

Query: 472 VEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKI 531
           ++ Q VSF +  ++   + KD+N  ++  S + +VG +G GK+T+  +L+    P  G +
Sbjct: 532 IQLQDVSFGFDPKQL--LLKDVNLDVQMDSRIALVGANGCGKTTLLKILMEQLRPIQGYV 589

Query: 532 LVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCH 591
                                        S   R  + Y         ++ + A      
Sbjct: 590 -----------------------------SRNPRLRVAYFTQHHVDSMDLNTSAVDWMST 620

Query: 592 AFISKFPNGYETIIGPRG----------ALLSGGQKQRIAIARALLNKPKILILDEATSA 641
            F  K    Y   +G  G           LLSGGQK R+A A   LN P IL+LDE ++ 
Sbjct: 621 TFPGKTDEEYRRHLGAFGITGSLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNH 680

Query: 642 LDVESEGAI-----NYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKF 696
           LD     A+      +T G LM S ++++I      + I  SEN  V   +G++ +   +
Sbjct: 681 LDTAGLDALMDALKKFTGGVLMVSHDISVIDGV--CNEIWVSENGTVKRFEGTIFDYKNY 738

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 612 LSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAH 670
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y L   +K+   T++ ++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATVVVVSH 422

>KLTH0H13442g Chr8 complement(1175860..1178118) [2259 bp, 752 aa]
           {ON} highly similar to uniprot|P43535 Saccharomyces
           cerevisiae YFR009W GCN20 Positive regulator of the Gcn2p
           kinase activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 59/240 (24%), Positives = 97/240 (40%), Gaps = 48/240 (20%)

Query: 472 VEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKI 531
           ++ Q VSF +   +   + KD+N  ++  S + IVG +G GK+T+  +L+    P  G +
Sbjct: 532 IQLQDVSFGFDPSQL--LLKDVNLDVQMDSRIAIVGANGCGKTTLLKILMEQLRPLQGYV 589

Query: 532 LVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCH 591
                                        S   R  + Y         ++ + A     +
Sbjct: 590 -----------------------------SRNPRLRVAYFTQHHVDSMDLNASAVDWMSN 620

Query: 592 AFISKFPNGYETIIGP----------RGALLSGGQKQRIAIARALLNKPKILILDEATSA 641
            F  +    Y   +G           R  LLSGGQK R+A A   LN P IL+LDE ++ 
Sbjct: 621 TFPGRTDEEYRRHLGAFGITGSLGLQRMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNH 680

Query: 642 LDVESEGAI-----NYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKF 696
           LD     A+      +T G LM S ++++I      + I  SEN  V   +G++ +   +
Sbjct: 681 LDTAGLDALMDALKKFTGGVLMVSHDISVIDGV--CNEIWVSENGTVRRFEGTIFDYKNY 738

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 612 LSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAH 670
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y L   +K+   T++ ++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATVVVVSH 422

>ZYRO0D11836g Chr4 (993707..998095) [4389 bp, 1462 aa] {ON} similar to
            uniprot|Q04182 Saccharomyces cerevisiae YDR406W PDR15 ATP
            binding cassette (ABC) transporter of the plasma membrane
            general stress response factor implicated in cellular
            detoxification target of Pdr1p Pdr3p and Pdr8p
            transcription regulators promoter contains a PDR
            responsive element
          Length = 1462

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 118/233 (50%), Gaps = 19/233 (8%)

Query: 485  KTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNP--TSGKILVDGQDITKLS 542
            +T +I  +++  ++PG+   ++G +G GK+T+   L +       +G I VDG    KL 
Sbjct: 833  ETRRILDNIDGWVKPGTLTALMGATGAGKTTLLDSLAQRVTTGVLTGSIFVDG----KLR 888

Query: 543  SKSLRRQLGVVQQEPI-LMSGTIRENITY-GVSRQPSMEEIRSVAKKCFCHAFIS--KFP 598
             +S  R +G  QQ+ + L + T+RE++ +  + RQP  + + +  K+ +    I+  +  
Sbjct: 889  DESFARSIGYCQQQDLHLTTATVRESLLFSAMLRQP--KSVPASEKRKYVEEVINVLEME 946

Query: 599  NGYETIIGPRGALLSGGQKQRIAIARALLNKPKILI-LDEATSALDVESEGAINYTLGRL 657
               + I+G  G  L+  Q++R+ I   L  KP +L+ LDE TS LD ++  +I   + +L
Sbjct: 947  PYADAIVGVAGEGLNVEQRKRLTIGVELAAKPNLLLFLDEPTSGLDSQTAWSICQLMKKL 1006

Query: 658  MKSKELTIISIAHRLST--IRRSENVIVLGIDGSVVEMGKFKDLYANHDSALH 708
                +  + +I H+ S   I+  + ++ L   G  V  G   DL  +  S +H
Sbjct: 1007 ANRGQAILCTI-HQPSAMLIQEFDRLLFLQKGGQTVYFG---DLGKDCKSMIH 1055

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 74/186 (39%), Gaps = 29/186 (15%)

Query: 482 PTRKTN--QIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDIT 539
           PTRK++  QI K ++  ++PG  + ++G  G G +T   LL    + T G  +     I+
Sbjct: 113 PTRKSDIFQILKPMDGALDPGEVLVVLGRPGSGCTT---LLKSIASNTHGFNIAKDSTIS 169

Query: 540 K--LSSKSLRR-----------------QLGVVQQEPILMSGTIRENITYGVSRQPSMEE 580
              LS K + R                  L V Q    +      +N   GV R+     
Sbjct: 170 YSGLSPKDINRHFRGEVVYNAETDIHLPHLTVYQTLLTVSRLKTPQNRIKGVDRETWARH 229

Query: 581 IRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATS 640
           +  V    +  +       G + + G     +SGG+++R++IA   +   K    D AT 
Sbjct: 230 MTDVVMATYGLSHTKNTKVGGDLVRG-----VSGGERKRVSIAEVTICGSKFQCWDNATR 284

Query: 641 ALDVES 646
            LD  +
Sbjct: 285 GLDAAT 290

>Kwal_23.5161 s23 (1040608..1045077) [4470 bp, 1489 aa] {ON} YDR011W
            (SNQ2) - ABC transporter [contig 8] FULL
          Length = 1489

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 116/233 (49%), Gaps = 14/233 (6%)

Query: 470  GKVEFQHVSFSYPTR-KTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLL-RYYNPT 527
            G   ++ V+F+ P +  T ++  +++    PGS   ++G SG GK+T+ + L  R     
Sbjct: 843  GVFVWKEVNFTIPYKGSTRKLLDNVSGYCAPGSLTALMGESGAGKTTLLNTLAQRNVGII 902

Query: 528  SGKILVDGQDITKLSSKSLRRQLGVVQQEPI-LMSGTIRENITYGVS-RQPSMEEIRSVA 585
            +G +LV+G+ I      S  R+ G VQQ+ + +   T+RE+  +    R+P  + I    
Sbjct: 903  TGDMLVNGKPI----DASFERRTGYVQQQDVHVKEMTVRESFQFAARMRRP--QSIPESE 956

Query: 586  KKCFCHAFIS--KFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILI-LDEATSAL 642
            K  +    I      +  E +IG  G  L+  Q+++++I   L  KP +L+ LDE TS L
Sbjct: 957  KLAYVEKIIEILDMEDYAEALIGDVGYGLNVEQRKKVSIGVELAAKPDLLLFLDEPTSGL 1016

Query: 643  DVESEGAINYTLGRLMKSKELTIISIAHRLSTI-RRSENVIVLGIDGSVVEMG 694
            D +S  AI   + RL ++ +  + +I    +T+    + +++L   G  V  G
Sbjct: 1017 DSQSSWAIVQLMRRLAEAGQSILCTIHQPSATLFEEFDRLLLLKKGGQTVYFG 1069

 Score = 39.3 bits (90), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 56/232 (24%), Positives = 92/232 (39%), Gaps = 31/232 (13%)

Query: 484 RKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLL---LRYYNPTSGKILVDG----Q 536
           R    I ++ +    PG  V ++G  G G S+    +    R +    G I  DG    +
Sbjct: 161 RGNRDIVRNASLLARPGDMVLVLGRPGAGCSSFLKTIAGETRNFEEVRGSISYDGIPQEE 220

Query: 537 DITKLSSKSLRR--------QLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKC 588
            + K  +  +           L V Q     +S T       G SR   +  +R +    
Sbjct: 221 MMKKYKTDVIYNGEMDVHFPHLTVQQTLDFALSCTTPRVRLDGASRSEYITAMRELYGTI 280

Query: 589 FC--HAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALD--- 643
           F   H + +K  N +      RG  +SGG+++R++IA AL  +  I   D AT  LD   
Sbjct: 281 FGLRHTYNTKVGNDF-----VRG--VSGGERKRVSIAEALAARGSIYCWDNATRGLDAST 333

Query: 644 -VESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMG 694
            +E   AI  T+  L KS  + +++I      I    + + +  DG  +  G
Sbjct: 334 ALEFAQAIR-TMTNLQKS--IALVTIYQASENIYECFDKVTVLYDGRQIFFG 382

>ZYRO0D11858g Chr4 (998646..1003157) [4512 bp, 1503 aa] {ON} highly
            similar to gnl|GLV|CAGL0M01760g Candida glabrata
            CAGL0M01760g and similar to YOR153W uniprot|P33302
            Saccharomyces cerevisiae YOR153W PDR5 Short- lived
            membrane ABC (ATP-binding cassette) transporter actively
            exports various drugs expression regulated by Pdr1p also
            involved in steroid transport cation resistance and
            cellular detoxification during exponential growth
          Length = 1503

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 60/220 (27%), Positives = 112/220 (50%), Gaps = 16/220 (7%)

Query: 485  KTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYN--PTSGKILVDGQDITKLS 542
            +T +I  +++  ++PG+   ++G SG GK+T+   L         +G I V+G    KL 
Sbjct: 862  ETRRILNNVDGWVKPGTLTALMGSSGAGKTTLLDCLAERVTMGVITGDIFVNG----KLR 917

Query: 543  SKSLRRQLGVVQQEPI-LMSGTIRENITY-GVSRQPSMEEIRSVAKKCFCHAFIS--KFP 598
             +S  R +G  QQ+ + L + T+RE++ +  + RQP  + + +  K+ +    I   +  
Sbjct: 918  DESFPRSIGYCQQQDLHLKTATVRESLLFSAMLRQP--KSVPASEKRKYVEEVIKILEME 975

Query: 599  NGYETIIGPRGALLSGGQKQRIAIARALLNKPKILI-LDEATSALDVESEGAINYTLGRL 657
               + I+G  G  L+  Q++R+ I   L+ KPK+L+ LDE TS LD ++  +I   + +L
Sbjct: 976  PYADAIVGVAGEGLNVEQRKRLTIGVELVAKPKLLVFLDEPTSGLDSQTAWSICQLMKKL 1035

Query: 658  MKSKELTIISIAHRLSTIRRSE--NVIVLGIDGSVVEMGK 695
                +  + +I H+ S +   E   ++ L   G  V  G+
Sbjct: 1036 SNHGQAILCTI-HQPSAMLMQEFDRLLFLQKGGKTVYFGE 1074

 Score = 33.9 bits (76), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 50/215 (23%), Positives = 89/215 (41%), Gaps = 33/215 (15%)

Query: 457 IKSTTGKAFKPLNGKVEFQHVSFSY----PTRKTN--QIFKDLNFTIEPGSNVCIVGPSG 510
           I ++   A++     + ++ +S+ Y    PT+ +N  QI K ++  ++P   + ++G  G
Sbjct: 113 IGASVDVAYQTTVDNLPWKFLSWVYRSLAPTKASNSFQILKPMDGIVKPSELLVVLGRPG 172

Query: 511 RGKSTIASLLLRYYNPTSGKILVDGQDITK--LSSKSLRRQL-GVVQQEP----ILMSGT 563
            G +T   LL    + T G  + +   I+   LS K + +   G V   P     L   T
Sbjct: 173 SGCTT---LLKSISSNTHGFKITEDSTISYSGLSPKDINKHFRGEVVYNPEADIHLPHLT 229

Query: 564 IRE------------NITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGAL 611
           + E            N   GV R+     I  VA   +  +       G + + G     
Sbjct: 230 VYETLVTVARLKTAQNRIRGVDRESWARHITEVAMATYGLSHTRNTKVGGDLVRG----- 284

Query: 612 LSGGQKQRIAIARALLNKPKILILDEATSALDVES 646
           +SGG+++R++IA   +   K    D AT  LD  +
Sbjct: 285 VSGGERKRVSIAEVTICGSKFQCWDNATRGLDAAT 319

>CAGL0M01760g Chr13 (203616..208115) [4500 bp, 1499 aa] {ON} highly
            similar to uniprot|P33302 Saccharomyces cerevisiae
            YOR153w PDR5 or uniprot|Q04182 Saccharomyces cerevisiae
            YDR406w PDR15 or uniprot|P51533 Saccharomyces cerevisiae
            YOR328w
          Length = 1499

 Score = 68.6 bits (166), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 81/309 (26%), Positives = 139/309 (44%), Gaps = 54/309 (17%)

Query: 484  RKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYN--PTSGKILVDGQDITKL 541
            ++T +I  +++  ++PG+   ++G SG GK+T+   L         +G++ VDG    K 
Sbjct: 870  KETRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGEVSVDG----KQ 925

Query: 542  SSKSLRRQLGVVQQEPI-LMSGTIRENITYGVS-RQP---SMEE----IRSVAKKCFCHA 592
               S  R +G  QQ+ + L + T+RE++ +    RQP   S+EE    +  V K      
Sbjct: 926  RDDSFARSIGYCQQQDLHLKTSTVRESLRFSAYLRQPADVSIEEKNQYVEDVIK------ 979

Query: 593  FISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILI-LDEATSALDVESEGAIN 651
             I +     + ++G  G  L+  Q++R+ I   L  KPK+L+ LDE TS LD ++  +I 
Sbjct: 980  -ILEMEQYADAVVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSIC 1038

Query: 652  YTLGRLMKSKELTIISIAHRLSTIRRSE--NVIVLGIDGSVVEMGKFK-------DLYAN 702
              + +L    +  + +I H+ S I   E   ++ L   G  V  G          D + +
Sbjct: 1039 QLMKKLANHGQAILCTI-HQPSAILMQEFDRLLFLQRGGKTVYFGDLGDGCKTMIDYFES 1097

Query: 703  HDSALHKLLTXXXXXXXXXXXXYAPPAITQESEPQTEENGKDDSGEDQNSDHEENSQDQN 762
            H S  HK                 PP     +E   E  G    G   N D+ E  ++ +
Sbjct: 1098 HGS--HK----------------CPPD-ANPAEWMLEVVGA-APGSHANQDYHEVWRNSD 1137

Query: 763  E-KRLQEEV 770
            E +++QEE+
Sbjct: 1138 EYQKVQEEL 1146

>Skud_6.95 Chr6 complement(175462..177720) [2259 bp, 752 aa] {ON}
           YFR009W (REAL)
          Length = 752

 Score = 67.8 bits (164), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 60/232 (25%), Positives = 101/232 (43%), Gaps = 52/232 (22%)

Query: 472 VEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKI 531
           ++ Q V F Y  +  N + +D+N  ++  S + +VG +G GK+T+  +++    P  G +
Sbjct: 532 IQLQDVFFGYDEK--NLLLEDVNLDVQMDSRIALVGANGCGKTTLLKIMMEQLRPLKGFV 589

Query: 532 LVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCH 591
                      S++ R ++G   Q  +                  SM+ + + A      
Sbjct: 590 -----------SRNPRLRIGYFTQHHV-----------------DSMD-LTTSAVDWMSR 620

Query: 592 AFISKFPNGYETIIGPRG----------ALLSGGQKQRIAIARALLNKPKILILDEATSA 641
           +F  K    Y   +G  G           LLSGGQK R+A A   LN P IL+LDE ++ 
Sbjct: 621 SFPGKTDEEYRRHLGSFGITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNH 680

Query: 642 LDVESEGAI-----NYTLGRLMKSKELTII-SIAHRL-----STIRRSENVI 682
           LD     A+     N+  G LM S ++++I S+   +      T++R E  I
Sbjct: 681 LDTTGLDALVDALKNFNGGVLMVSHDISVIDSVCKEIWVSEQGTVKRFEGTI 732

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 612 LSGGQKQRIAIARALLNKP