Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0C16753g5.353ON57572992e-37
CAGL0J10802g5.353ON57562732e-33
KAFR0C018405.353ON58572635e-32
NCAS0H016305.353ON58572628e-32
KLTH0H14894g5.353ON59572611e-31
TDEL0E027405.353ON58572593e-31
TBLA0H019605.353ON58572584e-31
KNAG0C054905.353ON56562566e-31
Kwal_34.159765.353ON59572551e-30
SAKL0G08800g5.353ON59572542e-30
TPHA0D020805.353ON59572532e-30
YHR072W-A (NOP10)5.353ON58572532e-30
Smik_8.1495.353ON58572523e-30
Ecym_81795.353ON58572514e-30
ZYRO0D10208g5.353ON64572481e-29
Kpol_1051.65.353ON58572472e-29
Suva_15.2635.353ON58572462e-29
Skud_8.1325.353ON58572453e-29
AGR354W5.353ON69562369e-28
KAFR0J029503.578ON119237564.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C16753g
         (57 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C16753g Chr3 (1465814..1465987) [174 bp, 57 aa] {ON} highly...   119   2e-37
CAGL0J10802g Chr10 complement(1055802..1055975) [174 bp, 57 aa] ...   109   2e-33
KAFR0C01840 Chr3 complement(368954..369130) [177 bp, 58 aa] {ON}...   105   5e-32
NCAS0H01630 Chr8 complement(313472..313648) [177 bp, 58 aa] {ON}...   105   8e-32
KLTH0H14894g Chr8 (1291716..1291895) [180 bp, 59 aa] {ON} highly...   105   1e-31
TDEL0E02740 Chr5 complement(529542..529718) [177 bp, 58 aa] {ON}...   104   3e-31
TBLA0H01960 Chr8 complement(463652..463828) [177 bp, 58 aa] {ON}...   103   4e-31
KNAG0C05490 Chr3 complement(1069102..1069272) [171 bp, 56 aa] {O...   103   6e-31
Kwal_34.15976 s34 complement(140610..140789) [180 bp, 59 aa] {ON...   102   1e-30
SAKL0G08800g Chr7 complement(754882..755061) [180 bp, 59 aa] {ON...   102   2e-30
TPHA0D02080 Chr4 (428268..428447) [180 bp, 59 aa] {ON} Anc_5.353...   102   2e-30
YHR072W-A Chr8 (241664..241840) [177 bp, 58 aa] {ON}  NOP10Const...   102   2e-30
Smik_8.149 Chr8 (217995..218168) [174 bp, 58 aa] {ON} YHR072W-A ...   101   3e-30
Ecym_8179 Chr8 complement(375457..375633) [177 bp, 58 aa] {ON} s...   101   4e-30
ZYRO0D10208g Chr4 (858591..858785) [195 bp, 64 aa] {ON} highly s...   100   1e-29
Kpol_1051.6 s1051 (11927..12103) [177 bp, 58 aa] {ON} (11927..12...   100   2e-29
Suva_15.263 Chr15 (443512..443685) [174 bp, 58 aa] {ON} YHR072W-...    99   2e-29
Skud_8.132 Chr8 (215139..215312) [174 bp, 58 aa] {ON} YHR072W-A ...    99   3e-29
AGR354W Chr7 (1386987..1387196) [210 bp, 69 aa] {ON} Syntenic ho...    96   9e-28
KAFR0J02950 Chr10 (559600..559642,559721..563256) [3579 bp, 1192...    26   4.8  

>KLLA0C16753g Chr3 (1465814..1465987) [174 bp, 57 aa] {ON} highly
          similar to uniprot|Q6Q547 Saccharomyces cerevisiae
          YHR072W-A NOP10 Constituent of small nucleolar
          ribonucleoprotein particles containing H/ACA-type
          snoRNAs which are required for pseudouridylation and
          processing of pre-18S rRNA,
          Length = 57

 Score =  119 bits (299), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 57/57 (100%), Positives = 57/57 (100%)

Query: 1  MHLMYTLDAQGKRIYTLKKMTEDNEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPN 57
          MHLMYTLDAQGKRIYTLKKMTEDNEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPN
Sbjct: 1  MHLMYTLDAQGKRIYTLKKMTEDNEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPN 57

>CAGL0J10802g Chr10 complement(1055802..1055975) [174 bp, 57 aa]
          {ON} highly similar to uniprot|Q6Q547 Saccharomyces
          cerevisiae YHR072wa NOP10
          Length = 57

 Score =  109 bits (273), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 54/56 (96%)

Query: 1  MHLMYTLDAQGKRIYTLKKMTEDNEITKSAHPARFSPDDKYSRQRVTLKKRYNLLP 56
          MHLMYTLD +GKR+YTLKKMTE+ EITKSAHPARFSPDDKYSRQRVTLKKRYNLLP
Sbjct: 1  MHLMYTLDNEGKRVYTLKKMTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLP 56

>KAFR0C01840 Chr3 complement(368954..369130) [177 bp, 58 aa] {ON}
          Anc_5.353 YHR072W-A
          Length = 58

 Score =  105 bits (263), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 49/57 (85%), Positives = 52/57 (91%)

Query: 1  MHLMYTLDAQGKRIYTLKKMTEDNEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPN 57
          MHLMYTLD  GKR+YTLKK+TE+ EITKSAHPARFSPDDKYSRQRVTLKKRY LLP 
Sbjct: 1  MHLMYTLDKDGKRVYTLKKVTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYGLLPG 57

>NCAS0H01630 Chr8 complement(313472..313648) [177 bp, 58 aa] {ON}
          Anc_5.353 YHR072W-A
          Length = 58

 Score =  105 bits (262), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 50/57 (87%), Positives = 51/57 (89%)

Query: 1  MHLMYTLDAQGKRIYTLKKMTEDNEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPN 57
          MHLMYTL   GKRIYTLKK+TED EITKSAHPARFSPDDKYSRQRVTLKKRY LLP 
Sbjct: 1  MHLMYTLGQDGKRIYTLKKVTEDGEITKSAHPARFSPDDKYSRQRVTLKKRYGLLPT 57

>KLTH0H14894g Chr8 (1291716..1291895) [180 bp, 59 aa] {ON} highly
          similar to uniprot|Q6Q547 Saccharomyces cerevisiae
          YHR072W-A NOP10 Constituent of small nucleolar
          ribonucleoprotein particles containing H/ACA-type
          snoRNAs which are required for pseudouridylation and
          processing of pre-18S rRNA
          Length = 59

 Score =  105 bits (261), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 49/57 (85%), Positives = 51/57 (89%)

Query: 1  MHLMYTLDAQGKRIYTLKKMTEDNEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPN 57
          MHLMYTL   GKRIYTLKK TED EITKSAHPARFSPDDKYSRQRVTLKKRYN++P 
Sbjct: 1  MHLMYTLGPDGKRIYTLKKTTEDGEITKSAHPARFSPDDKYSRQRVTLKKRYNMIPG 57

>TDEL0E02740 Chr5 complement(529542..529718) [177 bp, 58 aa] {ON}
          Anc_5.353 YHR072W-A
          Length = 58

 Score =  104 bits (259), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 49/57 (85%), Positives = 51/57 (89%)

Query: 1  MHLMYTLDAQGKRIYTLKKMTEDNEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPN 57
          MHLMYTL   GKR+YTLKK TE+ EITKSAHPARFSPDDKYSRQRVTLKKRYNLLP 
Sbjct: 1  MHLMYTLGPDGKRVYTLKKTTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPT 57

>TBLA0H01960 Chr8 complement(463652..463828) [177 bp, 58 aa] {ON}
          Anc_5.353 YHR072W-A
          Length = 58

 Score =  103 bits (258), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 49/57 (85%), Positives = 50/57 (87%)

Query: 1  MHLMYTLDAQGKRIYTLKKMTEDNEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPN 57
          MHLMYTL   GKR+YTLKK TE  EITKSAHPARFSPDDKYSRQRVTLKKRYNLLP 
Sbjct: 1  MHLMYTLSQDGKRVYTLKKETESGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPG 57

>KNAG0C05490 Chr3 complement(1069102..1069272) [171 bp, 56 aa]
          {ON} Anc_5.353 YHR072W-A
          Length = 56

 Score =  103 bits (256), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 48/56 (85%), Positives = 51/56 (91%)

Query: 1  MHLMYTLDAQGKRIYTLKKMTEDNEITKSAHPARFSPDDKYSRQRVTLKKRYNLLP 56
          MHLMYTLD +GKRIYTLKK T D EITKSAHPARFSPDDKYSRQRVTLKKR+ +LP
Sbjct: 1  MHLMYTLDNEGKRIYTLKKATADGEITKSAHPARFSPDDKYSRQRVTLKKRFGMLP 56

>Kwal_34.15976 s34 complement(140610..140789) [180 bp, 59 aa] {ON}
          YHR072W-A (NOP10) - Component of H/ACA-box snoRNPs
          [contig 272] FULL
          Length = 59

 Score =  102 bits (255), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 50/57 (87%)

Query: 1  MHLMYTLDAQGKRIYTLKKMTEDNEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPN 57
          MHLMYTL   GKRIYTLKK TE  EITKSAHPARFSPDDKYSRQRVTLKKRYN++P 
Sbjct: 1  MHLMYTLGPDGKRIYTLKKTTESGEITKSAHPARFSPDDKYSRQRVTLKKRYNMIPG 57

>SAKL0G08800g Chr7 complement(754882..755061) [180 bp, 59 aa] {ON}
          highly similar to uniprot|Q6Q547 Saccharomyces
          cerevisiae YHR072W-A NOP10 Constituent of small
          nucleolar ribonucleoprotein particles containing
          H/ACA-type snoRNAs, which are required for
          pseudouridylation and processing of pre-18S rRNA
          Length = 59

 Score =  102 bits (254), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 51/57 (89%)

Query: 1  MHLMYTLDAQGKRIYTLKKMTEDNEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPN 57
          MHLMYTL   GKRIYTLKK TE+ EITKSAHPARFSPDDKYSRQRVTLKKR+N+LP 
Sbjct: 1  MHLMYTLGPDGKRIYTLKKNTEEGEITKSAHPARFSPDDKYSRQRVTLKKRFNMLPG 57

>TPHA0D02080 Chr4 (428268..428447) [180 bp, 59 aa] {ON} Anc_5.353
          YHR072W-A
          Length = 59

 Score =  102 bits (253), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 51/57 (89%)

Query: 1  MHLMYTLDAQGKRIYTLKKMTEDNEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPN 57
          MHLM+TL   GKRIYTLKK TE  EITKSAHPARFSPDDKYSRQRVTLKKR++LLPN
Sbjct: 1  MHLMFTLGPDGKRIYTLKKETEQGEITKSAHPARFSPDDKYSRQRVTLKKRFSLLPN 57

>YHR072W-A Chr8 (241664..241840) [177 bp, 58 aa] {ON}
          NOP10Constituent of small nucleolar ribonucleoprotein
          particles containing H/ACA-type snoRNAs, which are
          required for pseudouridylation and processing of
          pre-18S rRNA
          Length = 58

 Score =  102 bits (253), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 50/57 (87%)

Query: 1  MHLMYTLDAQGKRIYTLKKMTEDNEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPN 57
          MHLMYTL   GKRIYTLKK+TE  EITKSAHPARFSPDDKYSRQRVTLKKR+ L+P 
Sbjct: 1  MHLMYTLGPDGKRIYTLKKVTESGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPG 57

>Smik_8.149 Chr8 (217995..218168) [174 bp, 58 aa] {ON} YHR072W-A
          (REAL)
          Length = 58

 Score =  101 bits (252), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 50/57 (87%)

Query: 1  MHLMYTLDAQGKRIYTLKKMTEDNEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPN 57
          MHLMYTL   GKRIYTLKK+TE  EITKSAHPARFSPDDKYSRQRVTLKKR+ L+P 
Sbjct: 1  MHLMYTLGPDGKRIYTLKKVTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPG 57

>Ecym_8179 Chr8 complement(375457..375633) [177 bp, 58 aa] {ON}
          similar to Ashbya gossypii AGR354W
          Length = 58

 Score =  101 bits (251), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 50/57 (87%)

Query: 1  MHLMYTLDAQGKRIYTLKKMTEDNEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPN 57
          MHLM+TL   GKRIYTLKK TED EITK AHPARFSPDDKYSRQRVTLKKR+N+LP 
Sbjct: 1  MHLMFTLGPDGKRIYTLKKATEDGEITKPAHPARFSPDDKYSRQRVTLKKRFNMLPT 57

>ZYRO0D10208g Chr4 (858591..858785) [195 bp, 64 aa] {ON} highly
          similar to uniprot|Q6Q547 Saccharomyces cerevisiae
          YHR072W-A NOP10
          Length = 64

 Score =  100 bits (248), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 46/57 (80%), Positives = 50/57 (87%)

Query: 1  MHLMYTLDAQGKRIYTLKKMTEDNEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPN 57
          MHLMYTL   GKR YTL+K+TE+ EITKSAHPARFSPDDKYSRQRVTLK+RY LLP 
Sbjct: 1  MHLMYTLGPDGKRAYTLQKVTEEGEITKSAHPARFSPDDKYSRQRVTLKRRYGLLPG 57

>Kpol_1051.6 s1051 (11927..12103) [177 bp, 58 aa] {ON}
          (11927..12103) [177 nt, 59 aa]
          Length = 58

 Score = 99.8 bits (247), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 46/57 (80%), Positives = 50/57 (87%)

Query: 1  MHLMYTLDAQGKRIYTLKKMTEDNEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPN 57
          MHLMYTL   GKR+YTLKK TE+ EITKSAHPARFSPDDK+SRQRVTLKKR+ LLP 
Sbjct: 1  MHLMYTLGPDGKRVYTLKKTTEEGEITKSAHPARFSPDDKHSRQRVTLKKRFGLLPT 57

>Suva_15.263 Chr15 (443512..443685) [174 bp, 58 aa] {ON} YHR072W-A
          (REAL)
          Length = 58

 Score = 99.4 bits (246), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 49/57 (85%)

Query: 1  MHLMYTLDAQGKRIYTLKKMTEDNEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPN 57
          MHLMYTL   GKRIYTLKK TE  EITKSAHPARFSPDDKYSRQRVTLKKR+ L+P 
Sbjct: 1  MHLMYTLGPDGKRIYTLKKNTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPG 57

>Skud_8.132 Chr8 (215139..215312) [174 bp, 58 aa] {ON} YHR072W-A
          (REAL)
          Length = 58

 Score = 99.0 bits (245), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 46/57 (80%), Positives = 49/57 (85%)

Query: 1  MHLMYTLDAQGKRIYTLKKMTEDNEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPN 57
          MHLMYTL   GKRIYTL K+TE  EITKSAHPARFSPDDKYSRQRVTLKKR+ L+P 
Sbjct: 1  MHLMYTLGPDGKRIYTLDKVTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPG 57

>AGR354W Chr7 (1386987..1387196) [210 bp, 69 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YHR072W-A (NOP10)
          Length = 69

 Score = 95.5 bits (236), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 43/56 (76%), Positives = 50/56 (89%)

Query: 1  MHLMYTLDAQGKRIYTLKKMTEDNEITKSAHPARFSPDDKYSRQRVTLKKRYNLLP 56
          MHLMYTL   GKR+YTL+K+T   EITKSAHPARFSPDDKYSRQRVTLK+R+++LP
Sbjct: 13 MHLMYTLGPDGKRVYTLEKVTPSGEITKSAHPARFSPDDKYSRQRVTLKRRFDMLP 68

>KAFR0J02950 Chr10 (559600..559642,559721..563256) [3579 bp, 1192
           aa] {ON} Anc_3.578 YGL251C
          Length = 1192

 Score = 26.2 bits (56), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 3/37 (8%)

Query: 23  DNEITKSAHPARFSPDD---KYSRQRVTLKKRYNLLP 56
           D + T+ +H  +F  DD     S++R+T+KK++ L P
Sbjct: 74  DQDDTQISHDVQFKNDDFINNNSKRRLTIKKKHELTP 110

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.131    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 6,283,259
Number of extensions: 194493
Number of successful extensions: 590
Number of sequences better than 10.0: 20
Number of HSP's gapped: 590
Number of HSP's successfully gapped: 20
Length of query: 57
Length of database: 53,481,399
Length adjustment: 30
Effective length of query: 27
Effective length of database: 50,041,419
Effective search space: 1351118313
Effective search space used: 1351118313
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)