Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0C16731g7.342ON47844813390.0
SAKL0F10934g7.342ON4981325631e-65
KLTH0H01430g7.342ON5021325561e-64
Kwal_56.246107.342ON5081325412e-62
TDEL0C020507.342ON5011315263e-60
NCAS0H006707.342ON4831325201e-59
CAGL0A03872g7.342ON5101325212e-59
ZYRO0F11550g7.342ON5381315222e-59
Kpol_2001.707.342ON5331325142e-58
Smik_4.757.342ON4601325084e-58
Skud_4.947.342ON4471315074e-58
Ecym_47317.342ON5141325115e-58
YDL161W (ENT1)7.342ON4541325059e-58
Smik_12.2647.342ON6121325113e-57
Suva_10.3007.342ON6181325113e-57
YLR206W (ENT2)7.342ON6131325096e-57
Suva_4.837.342ON4621325007e-57
Skud_12.2707.342ON6261325098e-57
TBLA0E004807.342ON5991355052e-56
KAFR0B008907.342ON4141284914e-56
ACL157C7.342ON5151324975e-56
KAFR0L014607.342ON5501324987e-56
TPHA0D045607.342ON4871334922e-55
NDAI0D006107.342ON4861324895e-55
KNAG0C038007.342ON4471284752e-53
KNAG0B026507.342ON6461314212e-44
TBLA0E020407.342ON7011303597e-36
KLTH0D16896g4.346ON4011302013e-16
Kwal_47.168574.346ON3821302004e-16
SAKL0G17952g4.346ON4151302006e-16
KNAG0M003804.346ON4031301989e-16
NDAI0D032004.346ON4351301943e-15
TDEL0D007104.346ON3751301908e-15
TBLA0E047604.346ON4261321909e-15
KLLA0B04587g4.346ON4001301909e-15
Kpol_1001.24.346ON4181321909e-15
KAFR0B067404.346ON3991301881e-14
Suva_12.2164.346ON4101301872e-14
ZYRO0B14784g4.346ON4241311837e-14
NCAS0A062104.346ON4231121837e-14
Skud_10.3494.346ON4101301802e-13
YJR125C (ENT3)4.346ON4081301792e-13
Smik_10.4184.346ON4091301792e-13
CAGL0H04323g4.346ON4121121783e-13
TPHA0B004004.346ON3991321765e-13
AER155C4.346ON3641311747e-13
Ecym_11334.346ON3921311605e-11
SAKL0H25762g4.17ON2621111494e-10
Kwal_55.206114.17ON2541111478e-10
TBLA0B062204.346ON3391131401e-08
KLTH0E05874g4.17ON2551121301e-07
Ecym_84074.17ON2541141231e-06
TBLA0G006504.17ON4231151213e-06
ZYRO0G07876g4.17ON2591001141e-05
TDEL0G017404.17ON2571321132e-05
ACL061C4.17ON2341051061e-04
KLLA0D03949g4.17ON2251021052e-04
YHR161C (YAP1801)5.84ON637981027e-04
CAGL0E03806g4.17ON26098990.001
SAKL0H02530g5.84ON669106980.002
Smik_12.194.17ON24797960.002
TBLA0H012108.335ON49198970.002
Skud_8.2255.84ON62198950.005
AGR046C8.335ON38797910.012
Smik_8.2455.84ON62798920.012
KAFR0B058008.335ON38297910.013
NCAS0B036608.335ON416112900.016
Kpol_1036.768.335ON368120890.020
TPHA0A015008.335ON407121860.053
ZYRO0F13684g8.335ON40797860.056
SAKL0H15290g8.335ON393120840.092
KNAG0A051008.335ON42197840.10
KLLA0D16654g8.335ON39997830.13
TBLA0A040408.335ON415112820.16
NDAI0J009308.335ON418112820.17
CAGL0E01199g8.335ON41297810.20
TDEL0F045908.335ON36197810.22
Kpol_344.88.335ON384115770.57
NDAI0H002804.17ON310107760.75
KNAG0J028704.17ON329119760.78
TPHA0C007408.335ON38597760.79
Kwal_YGOB_27.112618.335ON404112751.1
Suva_2.3158.335ON40397751.2
Smik_4.3988.335ON41697731.9
Skud_4.4128.335ON40697731.9
YDR153C (ENT5)8.335ON41197732.0
Kwal_27.11263singletonOFF275105722.5
KAFR0C037702.669ON63766723.2
Ecym_42648.335ON40869695.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C16731g
         (478 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]...   520   0.0  
SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some s...   221   1e-65
KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some s...   218   1e-64
Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]...   213   2e-62
TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.3...   207   3e-60
NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342    204   1e-59
CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {...   205   2e-59
ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {...   205   2e-59
Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa] ...   202   2e-58
Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W (...   200   4e-58
Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W (...   199   4e-58
Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar...   201   5e-58
YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}  ENT1Epsin-...   199   9e-58
Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206...   201   3e-57
Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206...   201   3e-57
YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}  ENT2Epsin...   200   6e-57
Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W (...   197   7e-57
Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206...   200   8e-57
TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}...   199   2e-56
KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.3...   193   4e-56
ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON} Syn...   196   5e-56
KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {...   196   7e-56
TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {O...   194   2e-55
NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.3...   192   5e-55
KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.3...   187   2e-53
KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.3...   166   2e-44
TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {O...   142   7e-36
KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]...    82   3e-16
Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125...    82   4e-16
SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]...    82   6e-16
KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.34...    81   9e-16
NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {O...    79   3e-15
TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.3...    78   8e-15
TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa] ...    78   9e-15
KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} simila...    78   9e-15
Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..931...    78   9e-15
KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON} Anc_4...    77   1e-14
Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {...    77   2e-14
ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]...    75   7e-14
NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa] ...    75   7e-14
Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {...    74   2e-13
YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON} ...    74   2e-13
Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {...    74   2e-13
CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} simila...    73   3e-13
TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346...    72   5e-13
AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON} S...    72   7e-13
Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar t...    66   5e-11
SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some ...    62   4e-10
Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {O...    61   8e-10
TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON} Anc_4...    59   1e-08
KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {O...    55   1e-07
Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to...    52   1e-06
TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.1...    51   3e-06
ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {O...    49   1e-05
TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17...    48   2e-05
ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON} Sy...    45   1e-04
KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar...    45   2e-04
YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}  ...    44   7e-04
CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar...    43   0.001
SAKL0H02530g Chr8 (250148..252157) [2010 bp, 669 aa] {ON} weakly...    42   0.002
Smik_12.19 Chr12 complement(50134..50877) [744 bp, 247 aa] {ON} ...    42   0.002
TBLA0H01210 Chr8 (269471..270946) [1476 bp, 491 aa] {ON} Anc_8.3...    42   0.002
Skud_8.225 Chr8 complement(391820..393685) [1866 bp, 621 aa] {ON...    41   0.005
AGR046C Chr7 complement(800910..802073) [1164 bp, 387 aa] {ON} S...    40   0.012
Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON...    40   0.012
KAFR0B05800 Chr2 complement(1200666..1201814) [1149 bp, 382 aa] ...    40   0.013
NCAS0B03660 Chr2 complement(653627..654877) [1251 bp, 416 aa] {O...    39   0.016
Kpol_1036.76 s1036 complement(205197..206303) [1107 bp, 368 aa] ...    39   0.020
TPHA0A01500 Chr1 (293819..295042) [1224 bp, 407 aa] {ON} Anc_8.3...    38   0.053
ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]...    38   0.056
SAKL0H15290g Chr8 (1322030..1323211) [1182 bp, 393 aa] {ON} simi...    37   0.092
KNAG0A05100 Chr1 (744989..746254) [1266 bp, 421 aa] {ON} Anc_8.3...    37   0.10 
KLLA0D16654g Chr4 complement(1413507..1414706) [1200 bp, 399 aa]...    37   0.13 
TBLA0A04040 Chr1 complement(1004703..1005950) [1248 bp, 415 aa] ...    36   0.16 
NDAI0J00930 Chr10 (209579..210835) [1257 bp, 418 aa] {ON} Anc_8....    36   0.17 
CAGL0E01199g Chr5 (108041..109279) [1239 bp, 412 aa] {ON} simila...    36   0.20 
TDEL0F04590 Chr6 complement(864567..865652) [1086 bp, 361 aa] {O...    36   0.22 
Kpol_344.8 s344 complement(20765..21919) [1155 bp, 384 aa] {ON} ...    34   0.57 
NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON} ...    34   0.75 
KNAG0J02870 Chr10 (549107..550096) [990 bp, 329 aa] {ON} Anc_4.1...    34   0.78 
TPHA0C00740 Chr3 (144476..145633) [1158 bp, 385 aa] {ON} Anc_8.3...    34   0.79 
Kwal_YGOB_27.11261 s27 complement(716644..717033,717035..717859)...    33   1.1  
Suva_2.315 Chr2 complement(560767..560940,560968..561033,561037....    33   1.2  
Smik_4.398 Chr4 complement(724753..726003) [1251 bp, 416 aa] {ON...    33   1.9  
Skud_4.412 Chr4 complement(736255..737475) [1221 bp, 406 aa] {ON...    33   1.9  
YDR153C Chr4 complement(766736..767971) [1236 bp, 411 aa] {ON}  ...    33   2.0  
Kwal_27.11263 s27 complement(717032..717859) [828 bp, 275 aa] {O...    32   2.5  
KAFR0C03770 Chr3 complement(768537..770450) [1914 bp, 637 aa] {O...    32   3.2  
Ecym_4264 Chr4 complement(558142..559368) [1227 bp, 408 aa] {ON}...    31   5.9  

>KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]
           {ON} some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 478

 Score =  520 bits (1339), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/448 (61%), Positives = 277/448 (61%)

Query: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60
           MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD
Sbjct: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60

Query: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120
           KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG
Sbjct: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120

Query: 121 EIVRVKAKELTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQRALXXXXXXX 180
           EIVRVKAKELTA                                     QRAL       
Sbjct: 121 EIVRVKAKELTALLRDEERLKEERMMRLKGRKRGGRKNRRDDNEDDDDLQRALEESRITA 180

Query: 181 XXXXXXXKQLMMQGDDSSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPMYYDI 240
                  KQLMMQGDDSS                                    PMYYDI
Sbjct: 181 EEEERRRKQLMMQGDDSSLQAALELSKEEEELRRLQQLQAQQQAALWQQQQQQQPMYYDI 240

Query: 241 FGNPISXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 300
           FGNPIS                                                      
Sbjct: 241 FGNPISAEEYLQYQQQQMLAQQQQEQYMAEQQYLAAQQQYLAQQQMLAQQQQQLLAQQQQ 300

Query: 301 XXXXXXXXTGSNNPFALNRPPSPQXXXXXXXPDFTXXXXXXXXXXXXXXXQEFKPVPKQR 360
                   TGSNNPFALNRPPSPQ       PDFT               QEFKPVPKQR
Sbjct: 301 QQFQMPLQTGSNNPFALNRPPSPQEIEEIEEPDFTPVQLPPSPSPAAVPQQEFKPVPKQR 360

Query: 361 TGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYKQITNDAP 420
           TGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYKQITNDAP
Sbjct: 361 TGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYKQITNDAP 420

Query: 421 KHNPFLTSQYTGIPSSAIAPSYTGYGFG 448
           KHNPFLTSQYTGIPSSAIAPSYTGYGFG
Sbjct: 421 KHNPFLTSQYTGIPSSAIAPSYTGYGFG 448

>SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 498

 Score =  221 bits (563), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 118/132 (89%), Gaps = 1/132 (0%)

Query: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60
           MSKA LR+AKN+VNGYS  QVLVR+ATSN+  GP+VDQL+ELAE+T+DNVEFFEIMDMLD
Sbjct: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60

Query: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120
           KRLNDKG+NWRHVAKSLT LD+LVR GSENCV W +ENLYIIKTLREF H DE   +D+G
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMG-VDHG 119

Query: 121 EIVRVKAKELTA 132
           +I+RVKAKELT+
Sbjct: 120 QIIRVKAKELTS 131

 Score =  167 bits (424), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 82/140 (58%), Positives = 98/140 (70%), Gaps = 3/140 (2%)

Query: 309 TGSNNPFALNRPPSPQXXXXXXXPDFTXXXXXXXXXXXXXXXQEFKPVPKQRTGNQSISD 368
           TGSNNPFAL R    +        +                 Q   P    RTGNQSIS 
Sbjct: 327 TGSNNPFALGRQEPDEEQITPKVSESVATTAGTTTATTTTQQQALNPT---RTGNQSISQ 383

Query: 369 KFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYKQITNDAPKHNPFLTS 428
           K+++LNNLLASGTG+DTFGNTG+TR+PAQHT+TG FINSQGTGYKQ+TND PK+NPFL +
Sbjct: 384 KYNDLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQVTNDQPKNNPFLAA 443

Query: 429 QYTGIPSSAIAPSYTGYGFG 448
           QYTG+PS+++ PSYTGYGFG
Sbjct: 444 QYTGLPSTSVVPSYTGYGFG 463

>KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 502

 Score =  218 bits (556), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 100/132 (75%), Positives = 117/132 (88%), Gaps = 1/132 (0%)

Query: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60
           MSK+ +R AKN+VNGYS  QVL+R ATSND DGPS+D ++E+AER++D+V FFEIMDMLD
Sbjct: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60

Query: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120
           KRLNDKG+NWRHVAKSLT LD+LVRCGSE+CV W KENLYIIKTLREFTH DE T +D G
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDE-TGVDQG 119

Query: 121 EIVRVKAKELTA 132
           +IVRVKA+ELTA
Sbjct: 120 QIVRVKARELTA 131

 Score =  157 bits (398), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 88/150 (58%), Positives = 105/150 (70%), Gaps = 10/150 (6%)

Query: 309 TGSNNPFALN-RPPS---PQXXXXXXXPDFTXXXXXXXXXXXXXXXQEFKPVPKQ----- 359
           TGSNNPFA N + PS   P        P  T               Q+ + +P+Q     
Sbjct: 328 TGSNNPFAKNAQQPSAEDPSKYAAASSPQRTQQLSPQLQPQPEQFQQQQQQIPQQPLKQT 387

Query: 360 RTGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYKQITN-D 418
           RTGNQS++DKFS+LNNLLASGTG+DTFGNTG+TR+PAQHTKTGTFINSQGTGYKQ++N  
Sbjct: 388 RTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVSNMP 447

Query: 419 APKHNPFLTSQYTGIPSSAIAPSYTGYGFG 448
             KHNPFL  QYTG+PS+++ PSYTGYGFG
Sbjct: 448 QGKHNPFLGQQYTGLPSTSVVPSYTGYGFG 477

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 11/12 (91%), Positives = 12/12 (100%)

Query: 235 PMYYDIFGNPIS 246
           PMYYD+FGNPIS
Sbjct: 240 PMYYDVFGNPIS 251

>Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]
           {ON} YDL161W (ENT1) - Ent1p [contig 161] FULL
          Length = 508

 Score =  213 bits (541), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 115/132 (87%), Gaps = 1/132 (0%)

Query: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60
           MSK+ +R AKN+VNGYS  QVL+R ATSND +GPS+D ++E+AER++D+V FFEIMDMLD
Sbjct: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60

Query: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120
           KRLNDKG+NWRHVAKSLT LD+LVRCGSE+CV W KENLY+IKTLREF H DE   ID G
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELG-IDQG 119

Query: 121 EIVRVKAKELTA 132
           +IVRVKA+ELTA
Sbjct: 120 QIVRVKARELTA 131

 Score =  155 bits (391), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 70/89 (78%), Positives = 81/89 (91%), Gaps = 1/89 (1%)

Query: 360 RTGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYKQITNDA 419
           RTGNQSI++K SELNNLLASGTG+DTFGNTG+TR+PAQHTKTG FINSQGTGYKQ+++  
Sbjct: 396 RTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQGTGYKQVSS-T 454

Query: 420 PKHNPFLTSQYTGIPSSAIAPSYTGYGFG 448
           PKHNPFL  QYTG+PS+ + PSYTGYGFG
Sbjct: 455 PKHNPFLGQQYTGLPSTNVVPSYTGYGFG 483

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 11/12 (91%), Positives = 12/12 (100%)

Query: 235 PMYYDIFGNPIS 246
           PMYYD+FGNPIS
Sbjct: 242 PMYYDVFGNPIS 253

>TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.342
           YLR206W
          Length = 501

 Score =  207 bits (526), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 94/131 (71%), Positives = 116/131 (88%), Gaps = 1/131 (0%)

Query: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60
           MSK F+RSAKN+V GYS AQVLVR+AT+N+ +GPSVD+L+ELAE+T+D+VEFFEIMDM+D
Sbjct: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60

Query: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120
           KRLNDKG+ WRH+AKSLT LD+LVR GSENCV WC+ENLY+IKTL EF + D+   +D G
Sbjct: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNDDD-GGVDQG 119

Query: 121 EIVRVKAKELT 131
           +I+RVKAKELT
Sbjct: 120 QIIRVKAKELT 130

 Score =  149 bits (375), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 98/154 (63%), Gaps = 18/154 (11%)

Query: 309 TGSNNPFALNRPPSPQXXXXXXXP--DFTXXXXXXXXXXXXXXXQEF------------K 354
           TGSNNPFALN     Q       P  +FT                +             K
Sbjct: 328 TGSNNPFALNNLQLQQARPAQSSPVPNFTSTQAQSPPKPQPQAQPQKQAPLPQQPQQALK 387

Query: 355 PVPKQRTGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYKQ 414
           PV   RTG+ ++++K+ ELN LLA+GTGIDTFGNTG+ R+PAQHTKTGTFINSQGTGY+Q
Sbjct: 388 PV---RTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQ 444

Query: 415 ITNDAPKHNPFLTSQYTGIPSSAIAPSYTGYGFG 448
           +T + PK NPFL SQYTGIPSS I P++TGYGFG
Sbjct: 445 VTGE-PKKNPFLQSQYTGIPSSNIVPAHTGYGFG 477

>NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342
          Length = 483

 Score =  204 bits (520), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 110/132 (83%), Gaps = 1/132 (0%)

Query: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60
           MSK F+RSAKN+V GYS  QVLVR ATSND   PS + L ELA+R+FD+V+FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60

Query: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120
           KRLNDKG+ WRHVAKSLT LD+LVR GSENCV WCKENLYIIKTLREF H D+    D G
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDD-GGADQG 119

Query: 121 EIVRVKAKELTA 132
           +I+RVKAKELT+
Sbjct: 120 QIIRVKAKELTS 131

 Score =  150 bits (379), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 69/89 (77%), Positives = 81/89 (91%), Gaps = 1/89 (1%)

Query: 360 RTGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYKQITNDA 419
           RTGNQSI+DK+S+LN LLA+GTGIDTFGNTGE R+PAQHT+TGTFINSQGTGY+Q+TND 
Sbjct: 370 RTGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTND- 428

Query: 420 PKHNPFLTSQYTGIPSSAIAPSYTGYGFG 448
           PK+NPFL SQYTG+PS+ I  + TGYGFG
Sbjct: 429 PKNNPFLNSQYTGLPSTNIVSTQTGYGFG 457

>CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|Q05785 Saccharomyces
           cerevisiae YLR206w ENT2
          Length = 510

 Score =  205 bits (521), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 108/132 (81%)

Query: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60
           M    +RSAKN+V GYS  QV+VR AT+ND   PSV  LE+LA++T+D VEFFEIMDMLD
Sbjct: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60

Query: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120
           KRLNDKG+ WRHVAKSLT LD+LVR GSENCV WCKENLYIIKTLREF H DE +  D G
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEG 120

Query: 121 EIVRVKAKELTA 132
           +I+RVKAKELT+
Sbjct: 121 QIIRVKAKELTS 132

 Score =  165 bits (418), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 77/91 (84%), Positives = 86/91 (94%), Gaps = 1/91 (1%)

Query: 358 KQRTGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYKQITN 417
           K RTGNQSISDK+SELNNLLASGTGIDTFGNTGE R+PAQHTKTGTFINSQGTGYKQ+TN
Sbjct: 360 KTRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTN 419

Query: 418 DAPKHNPFLTSQYTGIPSSAIAPSYTGYGFG 448
           + PK+NPFL+SQYTG+PS+ I PS+TGYGFG
Sbjct: 420 E-PKNNPFLSSQYTGLPSTNIVPSHTGYGFG 449

>ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {ON}
           some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 538

 Score =  205 bits (522), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 94/131 (71%), Positives = 112/131 (85%), Gaps = 1/131 (0%)

Query: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60
           M   F+RSAKN + GY+ AQVLVR AT+N+ +GPSVD L+ELA R++D+VEFFEIMDM+D
Sbjct: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60

Query: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120
           KRLNDKG+ WRHVAKSLT LD+LVR GSENCV WC+ENLYIIKTLREF H D+ T+ D G
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHDDDGTQ-DGG 119

Query: 121 EIVRVKAKELT 131
           +I+RVKAKELT
Sbjct: 120 QIIRVKAKELT 130

 Score =  153 bits (387), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 79/155 (50%), Positives = 98/155 (63%), Gaps = 16/155 (10%)

Query: 309 TGSNNPFALNRPPSPQXXXXXXXPDFTXXXXXXXXXXXXXXXQEFKPVPKQ--------- 359
           TGSNNPFALN  P           D                  +++P P+Q         
Sbjct: 358 TGSNNPFALNGMPLQSNSKPQAASDLAGLNNWGNNSTGQLEMPKYQPRPQQPQHNTAPEP 417

Query: 360 ------RTGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYK 413
                 RTGNQSISDK+++LN LLA  TG+DTFGN G+ R+PAQHTKTGTFINSQGTG+K
Sbjct: 418 QPMQPVRTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHTKTGTFINSQGTGFK 477

Query: 414 QITNDAPKHNPFLTSQYTGIPSSAIAPSYTGYGFG 448
           Q +N+ PK NPFL +Q+TGIP+S++ PS+TGYGFG
Sbjct: 478 QYSNE-PKKNPFLPTQFTGIPTSSVVPSHTGYGFG 511

>Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa]
           {ON} complement(192214..193815) [1602 nt, 534 aa]
          Length = 533

 Score =  202 bits (514), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 91/132 (68%), Positives = 114/132 (86%), Gaps = 1/132 (0%)

Query: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60
           M K F+RSAKN+V GYS  QV+VR+ATSND  GP +D L+ LAE+T+D+VEFFEIMDMLD
Sbjct: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60

Query: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120
           KRLNDKG+ W+H+AKSLT LD+LVR GSENCV WCKENLYII+TL+EF++ D+ ++ D G
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDD-SDHDQG 119

Query: 121 EIVRVKAKELTA 132
           +I+RVKAKELT+
Sbjct: 120 QIIRVKAKELTS 131

 Score =  157 bits (398), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 81/89 (91%), Gaps = 1/89 (1%)

Query: 360 RTGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYKQITNDA 419
           RTGNQ I+DKF ELN LLASGTGIDTFGNTGE R+PAQHTKTGTFINSQGTGY+Q+TND 
Sbjct: 384 RTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYRQVTND- 442

Query: 420 PKHNPFLTSQYTGIPSSAIAPSYTGYGFG 448
           PK+NPFL SQYTG+PS+ I PS+TGYGFG
Sbjct: 443 PKNNPFLNSQYTGLPSTNIVPSHTGYGFG 471

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 12/12 (100%), Positives = 12/12 (100%)

Query: 235 PMYYDIFGNPIS 246
           PMYYDIFGNPIS
Sbjct: 230 PMYYDIFGNPIS 241

>Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W
           (REAL)
          Length = 460

 Score =  200 bits (508), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 110/132 (83%), Gaps = 1/132 (0%)

Query: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60
           MSK F+RSAKNLV GYS  QVLVR+ATSND    S D L ELAE+++D+ +FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120
           KRLNDKG+ WRH+AK+LT LD+L+R GSENCV WCKENLYIIKTL+EF H D+   ID G
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDD-EGIDQG 119

Query: 121 EIVRVKAKELTA 132
           +IVRVK+KELTA
Sbjct: 120 QIVRVKSKELTA 131

 Score =  152 bits (383), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 67/95 (70%), Positives = 85/95 (89%), Gaps = 1/95 (1%)

Query: 354 KPVPKQRTGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYK 413
           +P+ + RTGNQS++DK+++LN LLA+GTGIDTFGN G+ RVPAQHTKTGTFINSQGTGYK
Sbjct: 345 EPLTQTRTGNQSMTDKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYK 404

Query: 414 QITNDAPKHNPFLTSQYTGIPSSAIAPSYTGYGFG 448
           Q++ND PK+NPFL+ QYTG+PS+ + P+ TGYGFG
Sbjct: 405 QVSND-PKYNPFLSGQYTGLPSTNVVPTQTGYGFG 438

>Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W
           (REAL)
          Length = 447

 Score =  199 bits (507), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 93/131 (70%), Positives = 109/131 (83%), Gaps = 1/131 (0%)

Query: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60
           MSK F+RSAKNLV GYS  QVLVR+ATSND    S D L ELAE+++D+ +FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120
           KRLNDKG+ WRH+AK+LT LD+L+R GSENCV WCKENLYIIKTL+EF H D+   +D G
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDD-EGVDQG 119

Query: 121 EIVRVKAKELT 131
           +IVRVKAKELT
Sbjct: 120 QIVRVKAKELT 130

 Score =  152 bits (385), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 83/94 (88%), Gaps = 1/94 (1%)

Query: 355 PVPKQRTGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYKQ 414
           P+ + RTGNQS++DK+ +LN LLA+GTGIDTFGN G++RVPAQHTKTGTFINSQGTGY+Q
Sbjct: 333 PLTQTRTGNQSMTDKYGKLNELLATGTGIDTFGNVGDSRVPAQHTKTGTFINSQGTGYRQ 392

Query: 415 ITNDAPKHNPFLTSQYTGIPSSAIAPSYTGYGFG 448
           ++ND PK NPFL SQYTG+PS+ I P+ TGYGFG
Sbjct: 393 VSND-PKQNPFLNSQYTGLPSTNIVPTQTGYGFG 425

>Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar to
           Ashbya gossypii ACL157C
          Length = 514

 Score =  201 bits (511), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 91/132 (68%), Positives = 111/132 (84%)

Query: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60
           MSK  LRSAKN++NGYSQAQVLVR+ATSND+ GPS+DQ+EELAERT+  VEFFEIM MLD
Sbjct: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60

Query: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120
           +RLNDK +NWRHVAKSLT  D+LVR G+E CV W +EN++II+ L EF H DE +  D+G
Sbjct: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120

Query: 121 EIVRVKAKELTA 132
           +++RVKAKEL A
Sbjct: 121 QLIRVKAKELIA 132

 Score =  152 bits (384), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 80/89 (89%)

Query: 360 RTGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYKQITNDA 419
           RTGNQSISDK+ ELN LLA+GTGIDTFGNTG+ R+ +QHTKT TFINS GTG+KQ++N+ 
Sbjct: 404 RTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVSNEP 463

Query: 420 PKHNPFLTSQYTGIPSSAIAPSYTGYGFG 448
           PKHNPFLT+QYTG+PS+ I PS+TGYGFG
Sbjct: 464 PKHNPFLTTQYTGLPSTNIVPSHTGYGFG 492

>YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}
           ENT1Epsin-like protein involved in endocytosis and actin
           patch assembly and functionally redundant with Ent2p;
           binds clathrin via a clathrin-binding domain motif at
           C-terminus
          Length = 454

 Score =  199 bits (505), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 110/132 (83%), Gaps = 1/132 (0%)

Query: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60
           MSK F+RSAKNLV GYS  QVLVR+ATSND    S D L ELAE+++D+ +FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120
           KRLNDKG+ WRH+AK+LT +D+L+R GSENCV WC+ENLYIIKTL+EF H D+   ID G
Sbjct: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDD-EGIDQG 119

Query: 121 EIVRVKAKELTA 132
           +IVRVKAKELTA
Sbjct: 120 QIVRVKAKELTA 131

 Score =  152 bits (383), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 84/94 (89%), Gaps = 1/94 (1%)

Query: 354 KPVPKQRTGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYK 413
           +P+ + RTGNQS++DK+S+LN LLA+GTGIDTFGN GE R+PAQHTKTGTFINSQGTGY+
Sbjct: 339 EPLIQNRTGNQSMTDKYSKLNELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYR 398

Query: 414 QITNDAPKHNPFLTSQYTGIPSSAIAPSYTGYGF 447
           Q+++D P HNPFL SQYTG+PS+++ P+ TGYGF
Sbjct: 399 QVSDD-PNHNPFLNSQYTGLPSTSVVPTQTGYGF 431

>Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206W
           (REAL)
          Length = 612

 Score =  201 bits (511), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 111/132 (84%), Gaps = 1/132 (0%)

Query: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60
           MSK F+RSAKN++ GYS  QVLVR AT+ND   PS+D L++LA+R++D+V+FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120
           KRLNDKG+ WRHVAKSLT LD+LVR GSENCV WC+EN Y+IKTLREF H +E +  D G
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENE-SGFDEG 119

Query: 121 EIVRVKAKELTA 132
           +I+RVKAKEL +
Sbjct: 120 QIIRVKAKELVS 131

 Score =  151 bits (382), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 84/94 (89%), Gaps = 1/94 (1%)

Query: 355 PVPKQRTGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYKQ 414
           P+ + RTGNQSISDK+++LN LLA+GTG DTFGNTGE R+PAQHTKTGTFINSQGTGYKQ
Sbjct: 425 PLKQTRTGNQSISDKYNDLNTLLATGTGTDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 484

Query: 415 ITNDAPKHNPFLTSQYTGIPSSAIAPSYTGYGFG 448
           + N+ PK+NPFL++QYTG+PS+ I P+ TGYGFG
Sbjct: 485 VINE-PKNNPFLSNQYTGLPSTNIVPTQTGYGFG 517

>Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206W
           (REAL)
          Length = 618

 Score =  201 bits (511), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 91/132 (68%), Positives = 111/132 (84%), Gaps = 1/132 (0%)

Query: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60
           MSK F+RSAKN+V GYS  QVLVR AT+ND   PS+D L++LA+R++D+V+FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120
           KRLNDKG+ WRHVAKSLT LD+LVR GSENCV WC+EN Y+IKTLREF H +E +  D G
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENE-SGFDEG 119

Query: 121 EIVRVKAKELTA 132
           +I+RVKAKEL +
Sbjct: 120 QIIRVKAKELVS 131

 Score =  152 bits (385), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 85/94 (90%), Gaps = 1/94 (1%)

Query: 355 PVPKQRTGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYKQ 414
           P+ + RTGNQSISDK+++LN LLA+GTG DTFGNTGE+R+PAQHTKTGTFINSQGTGYKQ
Sbjct: 433 PLTQTRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQ 492

Query: 415 ITNDAPKHNPFLTSQYTGIPSSAIAPSYTGYGFG 448
           + N+ PK+NPFL SQYTG+PS++I P+ TGYGFG
Sbjct: 493 VVNE-PKNNPFLNSQYTGLPSTSIVPTQTGYGFG 525

>YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}
           ENT2Epsin-like protein required for endocytosis and
           actin patch assembly and functionally redundant with
           Ent1p; contains clathrin-binding motif at C-terminus
          Length = 613

 Score =  200 bits (509), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 111/132 (84%), Gaps = 1/132 (0%)

Query: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60
           MSK F+RSAKN++ GYS  QVLVR AT+ND   PS+D L++LA+R++D+V+FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120
           KRLNDKG+ WRHVAKSLT LD+LVR GSENCV WC+EN Y+IKTLREF H +E +  D G
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENE-SGFDEG 119

Query: 121 EIVRVKAKELTA 132
           +I+RVKAKEL +
Sbjct: 120 QIIRVKAKELVS 131

 Score =  156 bits (395), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 72/94 (76%), Positives = 86/94 (91%), Gaps = 1/94 (1%)

Query: 355 PVPKQRTGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYKQ 414
           P+ + RTGNQSISDK+S+LN LLA+GTGIDTFGNTGE R+PAQHTKTGTFINSQGTGYKQ
Sbjct: 424 PLKQTRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 483

Query: 415 ITNDAPKHNPFLTSQYTGIPSSAIAPSYTGYGFG 448
           +TN+ PK+NPFL++QYTG+PS+ I P+ TGYGFG
Sbjct: 484 VTNE-PKNNPFLSNQYTGLPSTNIVPTQTGYGFG 516

>Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W
           (REAL)
          Length = 462

 Score =  197 bits (500), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 92/132 (69%), Positives = 109/132 (82%), Gaps = 1/132 (0%)

Query: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60
           MSK  +RSAKNLV GYS  QVLVR+ATSND +  S D L ELAE+++D+ +FFEIMDMLD
Sbjct: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120
           KRLNDKG+ WRH+AK+LT LD+L+R GSENCV WCKENLYIIKTL+EF H D+    D G
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDD-EGTDQG 119

Query: 121 EIVRVKAKELTA 132
           +IVRVKAKELT+
Sbjct: 120 QIVRVKAKELTS 131

 Score =  155 bits (393), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 99/139 (71%), Gaps = 4/139 (2%)

Query: 311 SNNPFAL-NRPPSPQXXXXXXXPDFTXXXXXXXXXXXXXXXQEFKPVPKQRTGNQSISDK 369
           SNNPFA  N+  SPQ          T               Q+ +P+ + RTGNQS++DK
Sbjct: 305 SNNPFAKPNQEASPQRQDQPSMN--TSSMPQQQQQQQQQQQQQQEPLTQTRTGNQSMTDK 362

Query: 370 FSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYKQITNDAPKHNPFLTSQ 429
           +S+LN LL +GTGIDTFGN G+TRVPAQHTKTGTFINSQGTGY+Q++ND PKHNPFL SQ
Sbjct: 363 YSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYRQVSND-PKHNPFLNSQ 421

Query: 430 YTGIPSSAIAPSYTGYGFG 448
           YTG+PS+ + P+ TGYGFG
Sbjct: 422 YTGLPSTNVVPAQTGYGFG 440

>Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206W
           (REAL)
          Length = 626

 Score =  200 bits (509), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 110/132 (83%), Gaps = 1/132 (0%)

Query: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60
           M K F+RSAKN+V GYS  QVLVR AT+ND   PS+D L++LA+R++D+V+FFEIMDMLD
Sbjct: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120
           KRLNDKG+ WRHVAKSLT LD+LVR GSENCV WC+EN Y+IKTLREF H +E +  D G
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENE-SGFDEG 119

Query: 121 EIVRVKAKELTA 132
           +I+RVKAKEL +
Sbjct: 120 QIIRVKAKELVS 131

 Score =  151 bits (382), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 86/94 (91%), Gaps = 1/94 (1%)

Query: 355 PVPKQRTGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYKQ 414
           P+ + RTGNQSISDK+++LN LLA+GTG+DTFGNTGE R+PAQHTKTGTFINSQGTGYKQ
Sbjct: 450 PLEQTRTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 509

Query: 415 ITNDAPKHNPFLTSQYTGIPSSAIAPSYTGYGFG 448
           +T++ PK+NPFL++QYTG+PS+ I P+ TGYGFG
Sbjct: 510 VTSE-PKNNPFLSNQYTGLPSTNIVPTQTGYGFG 542

>TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}
           Anc_7.342 YLR206W
          Length = 599

 Score =  199 bits (505), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 90/135 (66%), Positives = 112/135 (82%), Gaps = 3/135 (2%)

Query: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60
           MSK FLRS KN+V GYS  Q+LVR AT+ND++ PS+D L+++AE+T+D+V+FFEIMDMLD
Sbjct: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEF---TEI 117
           KRLNDKG+ W+HVAKSLT LD+L+R GSENCVFWCKENLY+IKTL+EF   D     T  
Sbjct: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120

Query: 118 DNGEIVRVKAKELTA 132
           D G+IVRV+A ELT+
Sbjct: 121 DQGQIVRVRATELTS 135

 Score =  156 bits (394), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 81/156 (51%), Positives = 100/156 (64%), Gaps = 17/156 (10%)

Query: 309 TGSNNPFALNRPPSPQ-------XXXXXXXPDFTXXXXXXXXXXXXXXXQEFK------- 354
           TG+NNPF+L+   +PQ              PD +                  K       
Sbjct: 404 TGTNNPFSLSNINNPQQQQPPLMSSSSTTLPDLSSFKQSTSVPPATQSSYTTKTNASSLP 463

Query: 355 --PVPKQRTGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGY 412
             P+P+ RTGNQ ISDK++ LN LLA+GTGIDTFGNTG+ R+PAQHT TGTFINSQGTGY
Sbjct: 464 PQPIPQMRTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQGTGY 523

Query: 413 KQITNDAPKHNPFLTSQYTGIPSSAIAPSYTGYGFG 448
           KQ  ND PK+NPF+++QYTG+PS+ + PSYTGYGFG
Sbjct: 524 KQYIND-PKNNPFMSNQYTGLPSTNVVPSYTGYGFG 558

>KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.342
           YLR206W
          Length = 414

 Score =  193 bits (491), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 105/128 (82%), Gaps = 1/128 (0%)

Query: 5   FLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDKRLN 64
            LRSAKNLV GYS  Q LVR ATSN  D P +DQL ELAE T++N+EFFEIMDMLDKR+N
Sbjct: 1   MLRSAKNLVKGYSSTQKLVRDATSNSHDNPPIDQLSELAEMTYNNMEFFEIMDMLDKRIN 60

Query: 65  DKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNGEIVR 124
            KG+ W+HV KSL  LD+LVR GSENCV WCKENLYIIKTLREFT+ DE + +D G++VR
Sbjct: 61  SKGKYWKHVIKSLIVLDYLVRFGSENCVIWCKENLYIIKTLREFTYEDE-SGMDQGQMVR 119

Query: 125 VKAKELTA 132
           V+AKELT+
Sbjct: 120 VRAKELTS 127

 Score =  149 bits (377), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 81/140 (57%), Positives = 92/140 (65%), Gaps = 15/140 (10%)

Query: 309 TGSNNPFALNRPPSPQXXXXXXXPDFTXXXXXXXXXXXXXXXQEFKPVPKQRTGNQSISD 368
           TGSNNPFALN     Q        D T                   P+ + RTG+QSISD
Sbjct: 278 TGSNNPFALNNKKLQQHTPEPSVIDTTLNTQA--------------PLKQTRTGSQSISD 323

Query: 369 KFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYKQITNDAPKHNPFLTS 428
           K+S LN LLA+GTGIDTFGNTG  R+PAQHTKTGTFINSQGTGYKQ++ +   +N FL S
Sbjct: 324 KYSALNTLLATGTGIDTFGNTGNQRIPAQHTKTGTFINSQGTGYKQVSTNG-FNNVFLNS 382

Query: 429 QYTGIPSSAIAPSYTGYGFG 448
           QYTG+PSS I PS TGYGFG
Sbjct: 383 QYTGLPSSNIVPSQTGYGFG 402

>ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR206W
           (ENT2) and YDL161W (ENT1)
          Length = 515

 Score =  196 bits (497), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 88/132 (66%), Positives = 110/132 (83%)

Query: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60
           MSK  LRSAKN+VNGYS AQ+LVR+ATSN++ GPS+DQ+EELAER++  VEFFEI+ MLD
Sbjct: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60

Query: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120
           KRL+DK ++WRHVAKSLT  DFLVR G+E CV W +ENLY+ + L EF H DE T +D+G
Sbjct: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120

Query: 121 EIVRVKAKELTA 132
           +I+RVKA+EL A
Sbjct: 121 QIIRVKARELVA 132

 Score =  159 bits (402), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 70/89 (78%), Positives = 83/89 (93%)

Query: 360 RTGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYKQITNDA 419
           RTGNQSI+DK+SELN LLASGTG+DTFGNTG+TR+PAQHTKTGTFINSQGTGYKQ+ N+ 
Sbjct: 402 RTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVGNEP 461

Query: 420 PKHNPFLTSQYTGIPSSAIAPSYTGYGFG 448
           PKHNPF+ +QYTG+PS+ + PS+TGYGFG
Sbjct: 462 PKHNPFIATQYTGLPSTNMVPSHTGYGFG 490

>KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {ON}
           Anc_7.342 YLR206W
          Length = 550

 Score =  196 bits (498), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 111/132 (84%), Gaps = 1/132 (0%)

Query: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60
           MSK F+RSAKN++ GYS  QVLVR ATSND    ++D L+++A R++D+V+FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNVMKGYSSTQVLVRDATSNDNRVTNIDTLDDIASRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120
           KRLNDKG+ W+H+ KSLT LD+LVR GSENCV WCKENLY+IKTLREF + D+ T ID G
Sbjct: 61  KRLNDKGKYWKHIVKSLTVLDYLVRFGSENCVLWCKENLYVIKTLREFRYEDD-TGIDQG 119

Query: 121 EIVRVKAKELTA 132
           +I+RVKAKELT+
Sbjct: 120 QIIRVKAKELTS 131

 Score =  153 bits (387), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 80/89 (89%)

Query: 360 RTGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYKQITNDA 419
           RTGN+ I++K+SELNNLLA GTG+DTFGNTG+ R+PAQHTKTGTFINSQGTGYKQ+TN+ 
Sbjct: 389 RTGNEEITEKYSELNNLLAQGTGVDTFGNTGQERIPAQHTKTGTFINSQGTGYKQVTNER 448

Query: 420 PKHNPFLTSQYTGIPSSAIAPSYTGYGFG 448
            K+NPFL +QYTG+PSS I PS TGYGFG
Sbjct: 449 SKNNPFLNTQYTGLPSSNIVPSSTGYGFG 477

>TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {ON}
           Anc_7.342 YLR206W
          Length = 487

 Score =  194 bits (492), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 111/133 (83%), Gaps = 1/133 (0%)

Query: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60
           MS  F+RS KN+V GYS  QVLVR+AT+N+  GP++D L ++AE+T+D+ +FFEIMDMLD
Sbjct: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60

Query: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFT-EIDN 119
           KRLNDKG+ W+H+AKSLT LD+LVR GSENCV WCKENLY+IKTL EF + DE +  +D 
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120

Query: 120 GEIVRVKAKELTA 132
           G+I+RVKAKELTA
Sbjct: 121 GQIIRVKAKELTA 133

 Score =  142 bits (359), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 82/162 (50%), Positives = 103/162 (63%), Gaps = 34/162 (20%)

Query: 309 TGSNNPFALNRPPSPQXX--XXXXXPDFTXXXXXXXXXXXXXXXQEFKP--VPKQ----- 359
           TGSNNPFALN   +           PDFT               Q ++P  +P+Q     
Sbjct: 313 TGSNNPFALNNQQTNNNNVQAASELPDFTKPQA-----------QSYQPAKLPEQIEIQQ 361

Query: 360 -------------RTGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFIN 406
                        RTGN+ +++K++ELN LLASGTGIDTFGNTGETR+PAQHT+TGTFIN
Sbjct: 362 PVQQPVQQPLQQNRTGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFIN 421

Query: 407 SQGTGYKQITNDAPKHNPFLTSQYTGIPSSAIAPSYTGYGFG 448
           SQGTGY+Q + ++ K NPFL++QYTG+PSS I P+ TGYGFG
Sbjct: 422 SQGTGYRQQSGES-KVNPFLSNQYTGLPSSNIIPTQTGYGFG 462

>NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.342
           YDL161W
          Length = 486

 Score =  192 bits (489), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 108/132 (81%), Gaps = 2/132 (1%)

Query: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60
           MSK F+RSAKN++ GYS  QVLVR ATSND   PS + L E+++R+FD+V+FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60

Query: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120
           KRLNDKG+ W+H+AKSLT LD+LVR GSENCV WCK+NLYIIKTL+EF   D+   +D  
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDD--NVDES 118

Query: 121 EIVRVKAKELTA 132
            I+RVKAKELTA
Sbjct: 119 SIIRVKAKELTA 130

 Score =  157 bits (396), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 72/88 (81%), Positives = 80/88 (90%)

Query: 360 RTGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYKQITNDA 419
           RTGNQSISDK++ELNNLLASGTGIDTFGNTG+ R+PAQHT+TGTFINSQGTGYKQI ND 
Sbjct: 369 RTGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIVNDP 428

Query: 420 PKHNPFLTSQYTGIPSSAIAPSYTGYGF 447
            K NPFL +QYTG+PSS I PS+TGYGF
Sbjct: 429 VKKNPFLNNQYTGLPSSNIVPSHTGYGF 456

>KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.342
           YLR206W
          Length = 447

 Score =  187 bits (475), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 108/128 (84%), Gaps = 1/128 (0%)

Query: 5   FLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDKRLN 64
            LRSAKN+V GYS  +VLVR AT+N+   PS + L++LA++++++VEFFEI+DMLDKR+N
Sbjct: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60

Query: 65  DKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNGEIVR 124
           DKG+ WRHVAK+LT LD+LVR GSENCV WC+ENLYIIKTLREF+H D   E D G+I+R
Sbjct: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGE-DEGKIIR 119

Query: 125 VKAKELTA 132
           VKAKELT+
Sbjct: 120 VKAKELTS 127

 Score =  157 bits (397), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 82/140 (58%), Positives = 96/140 (68%), Gaps = 10/140 (7%)

Query: 309 TGSNNPFALNRPPSPQXXXXXXXPDFTXXXXXXXXXXXXXXXQEFKPVPKQRTGNQSISD 368
           TGSNNPFALN    P        P  T                + KP+ + R+GNQ+ISD
Sbjct: 297 TGSNNPFALNNATQP------SAPASTTAARPAAIETPAT---QTKPLTQTRSGNQAISD 347

Query: 369 KFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYKQITNDAPKHNPFLTS 428
           K+S LNNLLASGTGIDTFGNTGE R+PAQHT+TGTFINSQGTGY+Q+ ND  K NPFL  
Sbjct: 348 KYSALNNLLASGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVNND-DKPNPFLNG 406

Query: 429 QYTGIPSSAIAPSYTGYGFG 448
           QYTG+PS+ I P+ TG+GFG
Sbjct: 407 QYTGLPSTNIVPTQTGFGFG 426

>KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.342
           YLR206W
          Length = 646

 Score =  166 bits (421), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 73/131 (55%), Positives = 100/131 (76%)

Query: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60
           MS+ F+RSAKN++ GYS  QVLVR AT+ND   P +D LE++A  +FD+V+FFEIMD+L+
Sbjct: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60

Query: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120
           KRLND G+ WRH+ KSLT LD+LVR GSE+C  W +++L+++K LR F   D+    D G
Sbjct: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120

Query: 121 EIVRVKAKELT 131
           +IVRVKA++L 
Sbjct: 121 QIVRVKARDLV 131

 Score =  145 bits (366), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 64/97 (65%), Positives = 81/97 (83%), Gaps = 2/97 (2%)

Query: 354 KPVPKQRTGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYK 413
           +P+P+  TGNQ +++K+SELNNLLA GTG+DTFGN G  R+PAQHT+TGTFINSQGTG+K
Sbjct: 489 QPMPRMNTGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFK 548

Query: 414 QITNDA--PKHNPFLTSQYTGIPSSAIAPSYTGYGFG 448
           Q+ ++   P  NPFL SQYTG+PS+ I P+YTGYGFG
Sbjct: 549 QVNSEGKDPNSNPFLNSQYTGLPSTGIVPAYTGYGFG 585

>TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {ON}
           Anc_7.342 YLR206W
          Length = 701

 Score =  142 bits (359), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 66/130 (50%), Positives = 93/130 (71%), Gaps = 1/130 (0%)

Query: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60
           MS  F+RS KN+  GYS  QVLVR AT+N+  G S+D L++L E ++D  EF +I  +LD
Sbjct: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60

Query: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120
           +R++DK + WRHVAKSLT +D+LVR GSE CV W ++N   ++ LR+F ++D    ID G
Sbjct: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDS-AGIDQG 119

Query: 121 EIVRVKAKEL 130
           +++RVKA EL
Sbjct: 120 QLIRVKAAEL 129

 Score =  108 bits (269), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 60/75 (80%), Gaps = 1/75 (1%)

Query: 361 TGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYKQITNDAP 420
           TGN  IS K+S LN LLA GTGIDTFGN G TR+PAQHTKTGTFINSQGTGYKQ+T+ + 
Sbjct: 596 TGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQVTSSSS 655

Query: 421 KHNPFLTSQYTGIPS 435
              P L +QYTG+P+
Sbjct: 656 P-IPLLPTQYTGLPA 669

>KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 401

 Score = 82.0 bits (201), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 45/130 (34%), Positives = 75/130 (57%), Gaps = 2/130 (1%)

Query: 2   SKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDK 61
           +K + R A+N+V  Y++ +  VR AT+N+  G S   +E++++ T++  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNMVFNYTEMEAKVREATNNEPWGASSTLMEQISQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120
           R  +K    WR + K+L  LD+L+R G+E  +   + NL +IK L  F + D     D G
Sbjct: 75  RFTEKTASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYIDSQGR-DQG 133

Query: 121 EIVRVKAKEL 130
             VR +A EL
Sbjct: 134 INVRNRAHEL 143

>Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125C
           (ENT3) - Ent3p [contig 219] FULL
          Length = 382

 Score = 81.6 bits (200), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 75/130 (57%), Gaps = 2/130 (1%)

Query: 2   SKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDK 61
           +K + R A+N+V  Y++ +  VR AT+N+  G S   +E++A+ T++  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQIAQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120
           R  +K    WR + K+L  LD+L+R G+E  +   + NL +IK L  F + D     D G
Sbjct: 75  RFTEKTASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYIDSQGR-DQG 133

Query: 121 EIVRVKAKEL 130
             VR +A EL
Sbjct: 134 INVRNRAHEL 143

>SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 415

 Score = 81.6 bits (200), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 45/130 (34%), Positives = 76/130 (58%), Gaps = 2/130 (1%)

Query: 2   SKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDK 61
           +K + R A+N+V  Y++ +  VR AT+N+  G S   +E+++  T++  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQISAGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120
           R  +K    WR + K+L  L++L++ GSE  +   + NL +IK L  F +TD     D G
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLIKHGSERFIDDSRANLTLIKMLESFHYTDSQGR-DQG 133

Query: 121 EIVRVKAKEL 130
             VR +A+EL
Sbjct: 134 INVRNRAQEL 143

>KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.346
           YJR125C
          Length = 403

 Score = 80.9 bits (198), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 45/130 (34%), Positives = 76/130 (58%), Gaps = 2/130 (1%)

Query: 2   SKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDK 61
           +K + R A+N+V  +++ +  VR AT+N+  G S   +E++A+ T++  E  E+M ML +
Sbjct: 15  AKKYFRKAQNVVFNFTEMESKVREATNNEPWGASSTLMEQIAQGTYNYKEREEVMMMLMR 74

Query: 62  RLNDK-GRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120
           R  +K G  WR + K+L  LD+L+R GSE  +   +  L I++ L  F + D     D G
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIRRGSEKFIDDVRAALRIVRLLESFHYIDSQGR-DQG 133

Query: 121 EIVRVKAKEL 130
             VR +AK++
Sbjct: 134 VNVRNRAKQI 143

>NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {ON}
           Anc_4.346
          Length = 435

 Score = 79.3 bits (194), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 45/130 (34%), Positives = 77/130 (59%), Gaps = 2/130 (1%)

Query: 2   SKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDK 61
           +K + R A+N+V  Y++ +  VR AT+N+  G S   +E++A+ T++  E +EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMESKVREATNNEPWGASSTLMEQIAQGTYNVRERYEIVGMIFR 74

Query: 62  RLNDK-GRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120
           R  +K G  WR + K+L  LD+L++ GSE  +   + +L +I+ L  F + D     D G
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSEPFIDDVRSSLKLIQMLETFHYIDSEGR-DQG 133

Query: 121 EIVRVKAKEL 130
             VR +AK L
Sbjct: 134 INVRNRAKLL 143

>TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.346
           YJR125C
          Length = 375

 Score = 77.8 bits (190), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 45/130 (34%), Positives = 75/130 (57%), Gaps = 2/130 (1%)

Query: 2   SKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDK 61
           +K + R A+N+V  Y+  +  VR AT+N+  G S   +E++++ T++  E  EI+ M+ +
Sbjct: 15  AKKYFRRAQNVVFNYTDMEAKVREATNNEPWGASTTLMEQISQGTYNMREREEILGMIFR 74

Query: 62  RLNDKGRN-WRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120
           RL +K  N WR + K+L  LD+L+R  SE  +   + ++ +IK L  F + D     D G
Sbjct: 75  RLTEKRANEWRQIYKALQLLDYLIRHASERFIDDTRSSISLIKMLESFHYIDSQGR-DQG 133

Query: 121 EIVRVKAKEL 130
             VR +AK L
Sbjct: 134 INVRNRAKAL 143

>TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa]
           {ON} Anc_4.346 YJR125C
          Length = 426

 Score = 77.8 bits (190), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 76/132 (57%), Gaps = 2/132 (1%)

Query: 2   SKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDK 61
           +K + R A+N+V  Y+  +  VR AT+N+  G S   +E++A+ T++  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTDMEAKVREATNNEPWGASSTLMEQIAQGTYNPREREEILSMILR 74

Query: 62  RLNDKGRN-WRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120
           R  +K  N WR + K+L  L++L+  G+E  +   + +L +I+ L  F + D     D G
Sbjct: 75  RFTEKSGNLWRQIYKALQLLEYLITHGAERFIDEARSSLGLIRMLESFHYVDSEGR-DQG 133

Query: 121 EIVRVKAKELTA 132
             VR +A+ +T+
Sbjct: 134 ANVRSRAQAMTS 145

>KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125C ENT3
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p
          Length = 400

 Score = 77.8 bits (190), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 44/130 (33%), Positives = 74/130 (56%), Gaps = 2/130 (1%)

Query: 2   SKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDK 61
           +K + R A+N+V  Y++ +  VR AT+N+  G S   +E +A+ T++  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEHIAQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120
           R  +K    WR + K+L  L++LV+ GSE  +   + NL ++K L  F + D     D G
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLVKHGSERFIDDVRTNLNLVKMLESFHYIDSQGR-DQG 133

Query: 121 EIVRVKAKEL 130
             VR +A +L
Sbjct: 134 INVRNRASQL 143

>Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..9313)
           [1257 nt, 419 aa]
          Length = 418

 Score = 77.8 bits (190), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 77/132 (58%), Gaps = 2/132 (1%)

Query: 2   SKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDK 61
           +K + R A+N++  Y++ +  VR AT+N+  G S   +E++++ T++  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVMFNYTEMEGKVREATNNEPWGASSTLMEQISQGTYNIREREEILSMIFR 74

Query: 62  RLNDK-GRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120
           R  +K    WR + K+L  L++L++ GSE  +   + +L +IK L  F + D     D G
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLIKHGSERFIDDVRSSLSLIKMLESFHYIDSQGR-DQG 133

Query: 121 EIVRVKAKELTA 132
             VR KA+ LTA
Sbjct: 134 INVRNKAQSLTA 145

>KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON}
           Anc_4.346 YJR125C
          Length = 399

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 76/130 (58%), Gaps = 2/130 (1%)

Query: 2   SKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDK 61
           +K + R A+N+V  Y++ +  VR AT+N+  G S   +E++A+ T++  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNLREREEILGMIFR 74

Query: 62  RLNDK-GRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120
           R  +K G  WR + KSL  LD+L+R GSE  +   + ++ +I+ L  F + D     D G
Sbjct: 75  RFTEKAGSEWRQIYKSLQLLDYLIRRGSERFIDDVRSSIRLIELLETFHYIDSQGR-DQG 133

Query: 121 EIVRVKAKEL 130
             VR +AK L
Sbjct: 134 INVRNRAKAL 143

>Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 76/130 (58%), Gaps = 2/130 (1%)

Query: 2   SKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDK 61
           +K + R A+N+V  Y++ +  VR AT+N+  G S   ++++++ T++  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120
           R  +K G  WR + K+L  LD+L++ GSE  +   + ++ +IK L  F +TD     D G
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILESFHYTDSQGR-DQG 133

Query: 121 EIVRVKAKEL 130
             VR + K L
Sbjct: 134 INVRTRVKAL 143

>ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 424

 Score = 75.1 bits (183), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 76/131 (58%), Gaps = 2/131 (1%)

Query: 2   SKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDK 61
           +K + R A+N+V  Y++ +  VR AT+N+  G S   +E +A+ T++  E  EI+ M+ +
Sbjct: 50  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGTSSTLMEYIAQGTYNLREREEILGMIFR 109

Query: 62  RLNDKGRN-WRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120
           R  +K  N WR + K+L  L++L++ GSE  +   + ++ ++K L  F + D     D G
Sbjct: 110 RFTEKTANEWRQIYKALQLLEYLIKHGSERFIDDTRCSISLLKMLESFHYVDSQGR-DQG 168

Query: 121 EIVRVKAKELT 131
             VR +AK LT
Sbjct: 169 INVRTRAKALT 179

>NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa]
           {ON} Anc_4.346
          Length = 423

 Score = 75.1 bits (183), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 69/112 (61%), Gaps = 1/112 (0%)

Query: 2   SKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDK 61
           +K + R A+N+V  Y++ +  VR AT+N+  G S   +E++A+ T++  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNIREREEILSMIFR 74

Query: 62  RLNDK-GRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTD 112
           R  +K G  WR + K+L  LD+L++ GSE  +   + ++ ++K L+ F + D
Sbjct: 75  RFTEKTGSEWRQIYKALQLLDYLIKHGSEKFIDDVRSSVAVLKLLQTFHYID 126

>Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 75/130 (57%), Gaps = 2/130 (1%)

Query: 2   SKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDK 61
           +K + R A+N+V  Y++ +  VR AT+N+  G S   ++++++ T++  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120
           R  +K G  WR + K+L  LD+L++ GSE  +   + ++ +IK L  F + D     D G
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILETFHYIDSQGR-DQG 133

Query: 121 EIVRVKAKEL 130
             VR + K L
Sbjct: 134 INVRTRVKTL 143

>YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON}
           ENT3Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes; associates with the clathrin
           adaptor Gga2p
          Length = 408

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 75/130 (57%), Gaps = 2/130 (1%)

Query: 2   SKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDK 61
           +K + R A+N+V  Y++ +  VR AT+N+  G S   ++++++ T++  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120
           R  +K G  WR + K+L  LD+L++ GSE  +   + ++ +I+ L  F + D     D G
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDSQGR-DQG 133

Query: 121 EIVRVKAKEL 130
             VR + K L
Sbjct: 134 INVRTRVKAL 143

>Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {ON}
           YJR125C (REAL)
          Length = 409

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 75/130 (57%), Gaps = 2/130 (1%)

Query: 2   SKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDK 61
           +K + R A+N+V  Y++ +  VR AT+N+  G S   ++++++ T++  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120
           R  +K G  WR + K+L  LD+L++ GSE  +   + ++ +I+ L  F + D     D G
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDSQGR-DQG 133

Query: 121 EIVRVKAKEL 130
             VR + K L
Sbjct: 134 INVRTRVKAL 143

>CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125c ENT3
           cytoskeletal adaptor
          Length = 412

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 67/112 (59%), Gaps = 1/112 (0%)

Query: 2   SKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDK 61
           +K + R A+N+V  Y+  +  VR AT+N+  G S   +E++A+ T++  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVYNYTDMESKVREATNNEPWGASSTLMEQIAQGTYNIREREEILGMIFR 74

Query: 62  RLNDK-GRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTD 112
           R  +K G  WR + K+L  L++L++ GSE  +   + ++ I+K L  F + D
Sbjct: 75  RFTEKSGSEWRQIYKALQLLEYLIKHGSERFIDDTRNSISIVKLLESFHYID 126

>TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346
           YJR125C
          Length = 399

 Score = 72.4 bits (176), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 43/132 (32%), Positives = 74/132 (56%), Gaps = 2/132 (1%)

Query: 2   SKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDK 61
           +K + R A+N++  Y+  +  VR AT+N+  G S   ++++A+ T++  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVMFNYTDMEAKVREATNNEPWGASSTLMKQIAQGTYNIREREEILGMVFR 74

Query: 62  RLNDK-GRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120
           R  +K    WR + KSL   D+L++ GSE  +   + ++ +IK L  F + D     D G
Sbjct: 75  RYTEKTASEWRQIYKSLQLTDYLIKHGSERFIDDVRTSISLIKMLESFHYIDSQGR-DQG 133

Query: 121 EIVRVKAKELTA 132
             VR KA+ L A
Sbjct: 134 INVRNKAQSLVA 145

>AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR125C
           (ENT3)
          Length = 364

 Score = 71.6 bits (174), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 73/131 (55%), Gaps = 2/131 (1%)

Query: 2   SKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDK 61
           +K + R A+N++  Y+  +  VR AT+N+  G S   + ++A+ T++  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVMLNYTGMEAKVREATNNEPWGASSTLMTQIAQGTYNFREREEILAMILR 74

Query: 62  RLNDKGRN-WRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120
           R  +K  N WR + KS+  L++LV+ GSE  +   + NL +I+ L  F + D     D G
Sbjct: 75  RFLEKSANEWRQIYKSMQLLEYLVKHGSERFIDDVRSNLNLIRMLETFHYIDSQGR-DQG 133

Query: 121 EIVRVKAKELT 131
             VR + K L 
Sbjct: 134 INVRNRTKALV 144

>Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar to
           Ashbya gossypii AER155C
          Length = 392

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 69/131 (52%), Gaps = 2/131 (1%)

Query: 2   SKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDK 61
           +K + R A+N+V  Y+  +  VR AT+N+  G     + ++A+ T++  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTGMEAKVREATNNESWGAPSSLMAQIAQGTYNYRERKEILGMIFR 74

Query: 62  RLNDK-GRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120
           R  +K    WR + KS+  L++L+  GSE  +   +  L +IK L  F + D     D G
Sbjct: 75  RFVEKTASEWRQIYKSVQLLEYLIYHGSEGFIDDVRSGLNLIKMLESFHYIDSQGR-DQG 133

Query: 121 EIVRVKAKELT 131
             VR + + L 
Sbjct: 134 INVRNRTQALV 144

>SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some
           similarities with uniprot|Q07872 Saccharomyces
           cerevisiae YLL038C ENT4 Protein of unknown function
           contains an N-terminal epsin-like domain
          Length = 262

 Score = 62.0 bits (149), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 62/111 (55%), Gaps = 8/111 (7%)

Query: 4   AFLRSAKNLVNGYSQAQVLVRSATSNDK-DGPSVDQLEELAERTFDNVEFFEIMDMLDKR 62
           +F+RS +N+  G S  +V V+ AT +D+  G +   + E++  T+      EI  ++ +R
Sbjct: 2   SFIRSVRNM--GQSTTEVKVKKATDDDEYSGATGALMNEISVLTYSAKTLREITQVIHRR 59

Query: 63  LN-----DKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREF 108
           L+        RN  H+ K+LT + +L+  GS + V W ++  Y++ TLREF
Sbjct: 60  LSGNYRKSSHRNAVHILKTLTLISYLINNGSNDFVSWIRQYAYLVDTLREF 110

>Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {ON}
           YLL038C (ENT4) - Ent4p [contig 144] FULL
          Length = 254

 Score = 61.2 bits (147), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 63/111 (56%), Gaps = 8/111 (7%)

Query: 4   AFLRSAKNLVNGYSQAQVLVRSATSNDK-DGPSVDQLEELAERTFDNVEFFEIMDMLDKR 62
           + L++ +N+  G S  +V  R+AT++D+ +G +   + EL+  T+      EI  ++ KR
Sbjct: 2   SLLKTVRNI--GQSSTEVKTRNATNDDEHNGATGSLMNELSVLTYSPRTLREITQVIRKR 59

Query: 63  LNDKGR-----NWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREF 108
           L+   R     N  H+ K+LT + +L+  GS+  V W +  LY+I TL+EF
Sbjct: 60  LSGNSRMSSHKNAVHLLKTLTLIAYLINNGSDEFVVWIRSYLYLIDTLKEF 110

>TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON}
           Anc_4.346 YJR125C
          Length = 339

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/113 (34%), Positives = 60/113 (53%), Gaps = 1/113 (0%)

Query: 2   SKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDK 61
           +K F R A+N +   +  +  VR AT+ND  G SV  + ++   TF+  +  +I++ML  
Sbjct: 15  AKKFFRMAENFLFNLTDMESKVREATNNDPWGTSVILMAQINAGTFEINQRADIINMLLN 74

Query: 62  RLNDK-GRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDE 113
           R  +K G  WR + KS+  L +L+  GS   V   K NL +IK L  F   D+
Sbjct: 75  RFLEKNGSQWRQIYKSVLLLQYLLINGSTEFVSEVKLNLTLIKNLMLFEFIDD 127

>KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 255

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 62/112 (55%), Gaps = 8/112 (7%)

Query: 4   AFLRSAKNLVNGYSQAQVLVRSATSNDK-DGPSVDQLEELAERTFDNVEFFEIMDMLDKR 62
           + LR+ ++   G SQ ++  ++AT++D+  G +   + E++  T+ +    EI  ++ KR
Sbjct: 2   SLLRTVRSF--GQSQTEIKTKNATNDDEYSGATGSLMNEISVLTYSSRTLREITAVVRKR 59

Query: 63  LNDKGR-----NWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFT 109
           L+   R     N  H+ K+LT   +L+  GS   V W +  +Y+I +L+EFT
Sbjct: 60  LSGNNRKSSHKNAVHILKTLTLTAYLINNGSNEFVAWIRSYVYLIDSLKEFT 111

>Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to
           Ashbya gossypii ACL061C
          Length = 254

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 59/114 (51%), Gaps = 8/114 (7%)

Query: 5   FLRSAKNLVNGYSQAQVLVRSATSN-DKDGPSVDQLEELAERTFDNVEFFEIMDMLDKRL 63
           FL S ++L  G S   V V+ AT + + +G     + E+A  T+      EI  +L KRL
Sbjct: 3   FLSSVRHL--GSSSTTVKVKKATDDSEHNGAYGSLMNEIAILTYSPNTLREITQVLKKRL 60

Query: 64  -----NDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTD 112
                    +   ++ K+LT + FLV  GSE C+ W + +L +I++ ++FT  D
Sbjct: 61  VGNYKKTPSKRAVNLLKTLTLIRFLVINGSEECIAWLRRHLVLIRSFQDFTLRD 114

>TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.17
           YLL038C
          Length = 423

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 57/115 (49%), Gaps = 8/115 (6%)

Query: 4   AFLRSAKNLVNGYSQAQVLVRSATS-NDKDGPSVDQLEELAERTFDNVEFFEIMDMLDKR 62
           A   S +N V   S  ++ VR+AT  N+  G +   + E++  T+      EI+ +L KR
Sbjct: 2   AIFESVRNFVQ--SPTELKVRTATDDNENSGATGTLMNEISVLTYSTKTNKEIVTVLKKR 59

Query: 63  LNDKG-----RNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTD 112
           L   G     RN  H+ K+LT + +L+  GS   + W  EN  + + ++ F  +D
Sbjct: 60  LTGYGKKSSHRNCIHIIKTLTLIAYLMNNGSLEFIRWINENQLLFEVMKNFEVSD 114

>ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 259

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 52/100 (52%), Gaps = 6/100 (6%)

Query: 13  VNGYSQAQVLVRSATSND-KDGPSVDQLEELAERTFDNVEFFEIMDMLDKRLNDKGR--- 68
           V G S  ++ VR AT+ D K G +   + E++  T+      EI  +L +RL+  GR   
Sbjct: 9   VFGPSSTELKVRKATNEDEKTGATGTLMNEISVLTYSPKTVREITQVLKRRLSSYGRRTS 68

Query: 69  --NWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLR 106
             N  H+ K+LT + +L+  GSE  V W + NL   + L+
Sbjct: 69  HKNSIHIVKALTLILYLINNGSEEFVAWVRGNLIYFECLK 108

>TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17
           YLL038C
          Length = 257

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 66/132 (50%), Gaps = 9/132 (6%)

Query: 5   FLRSAKNLVNGYSQAQVLVRSAT-SNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDKRL 63
            L S + LV   S  ++ V+ AT  N+  G +   + E++  T+      EI+ ++ KRL
Sbjct: 3   LLDSVRTLVQ--STTELKVKQATDENESSGATGTLMNEISVLTYSPKTLKEIVQVVRKRL 60

Query: 64  NDKGRN-----WRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEID 118
              GR        H+ K+LT + +L+  GS + + W + N+ ++  L+EF   D   E  
Sbjct: 61  MGHGRRNSHKICIHLVKTLTLVTYLMNNGSNDFIAWVRGNMALVDCLKEFNVQDRNDE-K 119

Query: 119 NGEIVRVKAKEL 130
            G+ +R  +++L
Sbjct: 120 IGQQIRAMSQDL 131

>ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL038C
           (ENT4)
          Length = 234

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 52/105 (49%), Gaps = 6/105 (5%)

Query: 15  GYSQAQVLVRSATS-NDKDGPSVDQLEELAERTFDNVEFFEIMDMLDKRLNDKG-----R 68
           G S     VR AT  N+  G S   + E+   T+      ++  +L KRL+        +
Sbjct: 11  GSSPTAAKVRKATDDNEFVGASSALISEITILTYSCKTLLDVTRVLKKRLSGNANKSSHK 70

Query: 69  NWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDE 113
           N  H+ K+LT  ++L+  GSE+ V W +    +++ L++FT  +E
Sbjct: 71  NAVHILKALTLTNYLIANGSEDFVQWLQGCAVLLRRLKDFTTGNE 115

>KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038C ENT4
           Protein of unknown function contains an N- terminal
           epsin- like domain
          Length = 225

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 53/102 (51%), Gaps = 8/102 (7%)

Query: 15  GYSQAQVLVRSAT-SNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDKRLNDKGRNWR-- 71
           G S  Q+ V+ AT SN+  G +   + EL+  T+      EI +++ KRL +     +  
Sbjct: 11  GQSTTQLKVKQATDSNESYGATGTLMNELSVLTYSEKSANEIYEVIRKRLMNGSSRLKNS 70

Query: 72  -----HVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREF 108
                 V K+LT +++L+  GSE  V W + +L  I+ L+++
Sbjct: 71  HDSVVQVLKTLTLIEYLLYNGSEEFVLWMRRHLAYIEALKDY 112

>YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}
           YAP1801Protein involved in clathrin cage assembly; binds
           Pan1p and clathrin; homologous to Yap1802p, member of
           the AP180 protein family
          Length = 637

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 46/98 (46%), Gaps = 14/98 (14%)

Query: 22  LVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDKRLNDKGRNWRHVAKSLTCLD 81
           LV+ AT      P    L+ +   T +  +F+EI+  LD R+ND    W  V KSL  + 
Sbjct: 7   LVKGATKIKSAPPKQKYLDPILLGTSNEEDFYEIVKGLDSRINDTA--WTIVYKSLLVVH 64

Query: 82  FLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDN 119
            ++R GS++              LR ++   EF +I+N
Sbjct: 65  LMIREGSKDVA------------LRYYSRNLEFFDIEN 90

>CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038c ENT4
          Length = 260

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 51/98 (52%), Gaps = 6/98 (6%)

Query: 17  SQAQVLVRSATS-NDKDGPSVDQLEELAERTFDNVEFFEIMDMLDKRLN-----DKGRNW 70
           S  ++ VR AT  N+  G +   + E++  T+      +++ ++ KRL+     +  R  
Sbjct: 13  SPTELKVRQATDDNELAGATGTLMNEISVLTYSKKTLKDVIQVIRKRLSGVNKRNSHRTC 72

Query: 71  RHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREF 108
            HV K+LT + +L+  GS + + W K + Y+I+ L  F
Sbjct: 73  LHVLKTLTLVSYLLNNGSNDFIAWLKSSKYVIEYLSSF 110

>SAKL0H02530g Chr8 (250148..252157) [2010 bp, 669 aa] {ON} weakly
           similar to uniprot|P53309 Saccharomyces cerevisiae
           YGR241C YAP1802 Yeast Assembly Polypeptide, member of
           AP180 protein family, binds Pan1p and clathrin; member
           of clathrin assembly polypeptide AP180 family and weakly
           similar to uniprot|P38856 Saccharomyces cerevisiae
           YHR161C YAP1801 Yeast Assembly Polypeptide member of
           AP180 protein family binds Pan1p and clathrin clathrin
           assembly protein
          Length = 669

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 49/106 (46%), Gaps = 8/106 (7%)

Query: 22  LVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDKRLNDKGRNWRHVAKSLTCLD 81
           LV+ AT      P    ++ +   T D+ EF EIM  L+ R+ND    W  V KSL  + 
Sbjct: 7   LVKGATKIKMAPPKQKYIDPILLGTSDSSEFMEIMKALESRINDTA--WTIVYKSLIVIH 64

Query: 82  FLVRCGSENCVFWCKENLYIIKTLREFTHTDEF-TEIDNGEIVRVK 126
            ++R G  +         Y+   L  F   D F +++ +G++  +K
Sbjct: 65  LMMRDGDRDVTIK-----YLSHHLEFFQLRDVFHSKLSSGDLQALK 105

>Smik_12.19 Chr12 complement(50134..50877) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 49/97 (50%), Gaps = 7/97 (7%)

Query: 23  VRSATSNDK-DGPSVDQLEELAERTFDNVEFFEIMDMLDKRL------NDKGRNWRHVAK 75
           V+ AT+ D+  G +   + E++  T+      EI+ ++ KRL       +  RN   V K
Sbjct: 19  VKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVVRKRLLLGQNRRNSHRNCIQVMK 78

Query: 76  SLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTD 112
           +LT + +L+  GS   + W K N+ +++ L +F   D
Sbjct: 79  TLTLVSYLMNNGSNEFIKWLKSNMILVEILEDFQVQD 115

>TBLA0H01210 Chr8 (269471..270946) [1476 bp, 491 aa] {ON} Anc_8.335
           YDR153C
          Length = 491

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 46/98 (46%), Gaps = 22/98 (22%)

Query: 7   RSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEE-LAERTFDNVEFFEIMDMLDKRLND 65
           R A+N++  Y   Q+ +R AT+ D  GP+   L++ L +R  + V   +I+D + KRL D
Sbjct: 21  RYAQNMIIAYEPYQIDIRQATNTDSWGPTKKHLDQILLDR--NKVPLRKIVDYIMKRLMD 78

Query: 66  K-------------------GRNWRHVAKSLTCLDFLV 84
                               G  WR V KSL  L FL+
Sbjct: 79  HINTRPRNLYDRARKDYVNYGTEWRVVFKSLIVLKFLL 116

>Skud_8.225 Chr8 complement(391820..393685) [1866 bp, 621 aa] {ON}
           YHR161C (REAL)
          Length = 621

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 43/98 (43%), Gaps = 14/98 (14%)

Query: 22  LVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDKRLNDKGRNWRHVAKSLTCLD 81
           LV+ AT      P    L+ +   T    +F+EI+  LD R+ND    W  V K+L  + 
Sbjct: 7   LVKGATKIKSAPPKQKYLDPILLATGSEEDFYEIVKALDSRVNDTA--WTIVYKTLLVVH 64

Query: 82  FLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDN 119
            ++R G ++              LR ++   EF  I+N
Sbjct: 65  LMMREGKKDVA------------LRYYSRNLEFFSIEN 90

>AGR046C Chr7 complement(800910..802073) [1164 bp, 387 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR153C
           (ENT5)
          Length = 387

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 44/97 (45%), Gaps = 20/97 (20%)

Query: 7   RSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDKRLNDK 66
           R A+N++  Y   QV VR AT+ D  GP+  Q+ ++  R  ++V  + I +   KRL D 
Sbjct: 21  RFAQNVIIQYEPYQVDVRRATNTDSWGPTPKQMLKVM-RHKNHVPMYLITEYTMKRLVDH 79

Query: 67  -------------------GRNWRHVAKSLTCLDFLV 84
                              G  WR V K L  L+FL+
Sbjct: 80  MAKRPKNLYEKARKQYVNYGHEWRVVLKCLVVLEFLI 116

>Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON}
           YHR161C (REAL)
          Length = 627

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 45/98 (45%), Gaps = 14/98 (14%)

Query: 22  LVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDKRLNDKGRNWRHVAKSLTCLD 81
           LV+ AT      P    L+ +   T    +F+EI+  L+ R+ND    W  V KSL  + 
Sbjct: 7   LVKGATKIKSAPPKQKYLDPILLGTSSEEDFYEIVKGLNFRINDTA--WTIVYKSLLVVH 64

Query: 82  FLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDN 119
            ++R G+++              LR ++   EF +I+N
Sbjct: 65  LMIREGAKDVA------------LRYYSRNLEFFDIEN 90

>KAFR0B05800 Chr2 complement(1200666..1201814) [1149 bp, 382 aa]
           {ON} Anc_8.335 YDR153C
          Length = 382

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 44/97 (45%), Gaps = 20/97 (20%)

Query: 7   RSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDKRLNDK 66
           R A+N++  Y   Q+ VR AT+ D  GP+   LE++    F  V  + + + + KRL D 
Sbjct: 21  RFAQNVIVQYEPYQIDVRRATNTDAWGPTTKHLEKVMRNRF-QVPMYLVTEYILKRLIDH 79

Query: 67  -------------------GRNWRHVAKSLTCLDFLV 84
                              G  WR V K LT +++L+
Sbjct: 80  IATKPKNLYEKARKEYVNYGSEWRVVLKCLTVIEYLL 116

>NCAS0B03660 Chr2 complement(653627..654877) [1251 bp, 416 aa] {ON}
           Anc_8.335 YDR153C
          Length = 416

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 47/112 (41%), Gaps = 24/112 (21%)

Query: 7   RSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDKRLNDK 66
           R A+N++  Y   QV +R AT+ D  GP+   L ++    +  V  + +++   KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLSKVLRNRY-QVPLYLMVEYTLKRLVDH 79

Query: 67  -------------------GRNWRHVAKSLTCLDFLVRCGSE----NCVFWC 95
                              G  WR V K L  +DFL+   SE    N V  C
Sbjct: 80  IASRPKNFYEKARKEYVNYGAEWRVVLKCLVVIDFLILNVSEGDELNQVLSC 131

>Kpol_1036.76 s1036 complement(205197..206303) [1107 bp, 368 aa]
           {ON} complement(205197..206303) [1107 nt, 369 aa]
          Length = 368

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 57/120 (47%), Gaps = 25/120 (20%)

Query: 7   RSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDKRLNDK 66
           R A+N++  Y   Q+ +R+AT+ D  GP+   L+++    + +V  + + + + KRL D 
Sbjct: 21  RFAQNMIVQYEPYQIDIRTATNTDSWGPTSKHLQKVIRHKY-HVPVYLMTEYILKRLIDH 79

Query: 67  -------------------GRNWRHVAKSLTCLDFL---VRCGSE-NCVFWC-KENLYII 102
                              G  WR V K L  ++FL   V  G E + V  C K++++I+
Sbjct: 80  IASKPKNFYEKARKEYVNYGNEWRVVMKCLILIEFLLMNVSDGDELHQVLTCLKKHIHIL 139

>TPHA0A01500 Chr1 (293819..295042) [1224 bp, 407 aa] {ON} Anc_8.335
           YDR153C
          Length = 407

 Score = 37.7 bits (86), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 51/121 (42%), Gaps = 28/121 (23%)

Query: 7   RSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDKRLNDK 66
           R  +N++  Y   Q+ +R AT+ D  GP+   LE++    +  V  F + + + KR+ D 
Sbjct: 21  RFMQNMLVQYEPYQIDIRRATNTDSWGPTTKHLEKVIRNKY-QVPLFLMTEYILKRIIDH 79

Query: 67  -------------------GRNWRHVAKSLTCLDFL---VRCGSE-----NCVFWCKENL 99
                              G  WR + K L  L+FL   V  G E     NC+   K+ L
Sbjct: 80  IAKKPKNLYEKARKEYVNYGAEWRVILKCLVVLEFLMLHVEDGEELNQILNCLSTHKQIL 139

Query: 100 Y 100
           +
Sbjct: 140 F 140

>ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|Q6Q5U2 Saccharomyces
           cerevisiae YDR153C ENT5 Protein containing an N-terminal
           epsin-like domain involved in clathrin recruitment and
           traffic between the Golgi and endosomes associates with
           the clathrin adaptor Gga2p clathrin adaptor complex AP-1
           and clathrin
          Length = 407

 Score = 37.7 bits (86), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 43/97 (44%), Gaps = 20/97 (20%)

Query: 7   RSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDKRLNDK 66
           R A+N++  Y   QV VR AT+ D  GP+   LE++    +  V  + I +   KRL D 
Sbjct: 21  RFAQNMIVQYEPYQVDVRRATNTDSWGPTPKHLEKVLRNRY-QVPMYLITEYTLKRLIDH 79

Query: 67  -------------------GRNWRHVAKSLTCLDFLV 84
                              G  WR V K LT +++L+
Sbjct: 80  IATRPKNFYEKARKEYVNYGSEWRVVLKCLTVVEYLL 116

>SAKL0H15290g Chr8 (1322030..1323211) [1182 bp, 393 aa] {ON} similar
           to uniprot|Q6Q5U2 Saccharomyces cerevisiae YDR153C ENT5
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p clathrin adaptor complex AP-1 and clathrin
          Length = 393

 Score = 37.0 bits (84), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 49/120 (40%), Gaps = 28/120 (23%)

Query: 7   RSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDKRLNDK 66
           R A+N++  Y   QV +R AT+ D  GP+   L ++    F  V  + + + + KRL D 
Sbjct: 21  RFAQNMIVQYEPYQVDIRRATNTDSWGPTPKHLSKVMRNRF-QVPLYLMTEYILKRLVDH 79

Query: 67  -------------------GRNWRHVAKSLTCLDFL---VRCGSE-----NCVFWCKENL 99
                              G  WR V K L  L+ +   V  G+E     NC+   K  L
Sbjct: 80  IATRPKNLYEKARKQYVNYGNEWRVVLKCLVLLEHMLLNVDVGNELDQVVNCILTHKHIL 139

>KNAG0A05100 Chr1 (744989..746254) [1266 bp, 421 aa] {ON} Anc_8.335
           YDR153C
          Length = 421

 Score = 37.0 bits (84), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 43/97 (44%), Gaps = 20/97 (20%)

Query: 7   RSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDKRLNDK 66
           R A+N++  Y   QV +R AT+ D  GP+   L ++    +  V  + + + + KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLSKVLRHRY-QVPMYLMTEYILKRLVDH 79

Query: 67  -------------------GRNWRHVAKSLTCLDFLV 84
                              G  WR V K LT ++FL+
Sbjct: 80  IATRPKNLYEKARKDYVNYGAEWRVVLKCLTVIEFLM 116

>KLLA0D16654g Chr4 complement(1413507..1414706) [1200 bp, 399 aa]
           {ON} similar to uniprot|Q6Q5U2 Saccharomyces cerevisiae
           YDR153C ENT5 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p clathrin adaptor complex AP-1 and
           clathrin
          Length = 399

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 42/97 (43%), Gaps = 20/97 (20%)

Query: 7   RSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDKRLNDK 66
           R A+N++  Y   Q+ +R AT+ D  GP+   L ++    ++ V  F + +   KRL D 
Sbjct: 21  RFAQNVIVQYEPYQIDIRRATNTDSWGPTPKHLAKVMRHRYE-VSMFLMTEYTLKRLVDH 79

Query: 67  -------------------GRNWRHVAKSLTCLDFLV 84
                              G  WR V K L  L++L+
Sbjct: 80  MAKRPKNMYEKARKQYVNYGNEWRVVLKCLVLLEYLL 116

>TBLA0A04040 Chr1 complement(1004703..1005950) [1248 bp, 415 aa]
           {ON} Anc_8.335 YDR153C
          Length = 415

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 47/112 (41%), Gaps = 24/112 (21%)

Query: 7   RSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDKRLNDK 66
           R A+N++  Y   Q+ +R AT+ D  GP+   L ++    +  V  + + + + KR+ D 
Sbjct: 21  RFAQNVIVQYEPYQIDIRRATNTDAWGPTSKHLAKVLRNRY-QVPLYLMTEYILKRIVDH 79

Query: 67  -------------------GRNWRHVAKSLTCLDFL---VRCGSE-NCVFWC 95
                              G  WR V K L  +DFL   V  G E N V  C
Sbjct: 80  IAVRPKNFYEKARKDYVNYGAEWRVVLKCLVVIDFLFLNVEEGEELNQVKSC 131

>NDAI0J00930 Chr10 (209579..210835) [1257 bp, 418 aa] {ON} Anc_8.335
           YDR153C
          Length = 418

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 49/112 (43%), Gaps = 24/112 (21%)

Query: 7   RSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDKRLNDK 66
           R A+N++  Y   QV +R AT+ D  GP+   L+++    +  V  + +++   KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLQKVLRNRY-QVPLYLMVEYTLKRLVDH 79

Query: 67  -------------------GRNWRHVAKSLTCLDFL---VRCGSE-NCVFWC 95
                              G  WR V K LT +++L   V  G E N V  C
Sbjct: 80  IAVKPKNFYERARKEYVNYGAEWRVVLKCLTVVEYLMLNVDDGDELNQVVRC 131

>CAGL0E01199g Chr5 (108041..109279) [1239 bp, 412 aa] {ON} similar
           to uniprot|Q03769 Saccharomyces cerevisiae YDR153c ENT5
          Length = 412

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 42/97 (43%), Gaps = 20/97 (20%)

Query: 7   RSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDKRLNDK 66
           R A+N++  Y   QV VR AT+ D  GP+   L ++    +  V  + I + + KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDVRRATNTDSWGPTPKHLAKVLRNRY-QVPLYLITEYILKRLIDH 79

Query: 67  -------------------GRNWRHVAKSLTCLDFLV 84
                              G  WR V K L  +++L+
Sbjct: 80  IAQRPKNLYEKARKDYVNYGSEWRVVLKCLVVIEYLL 116

>TDEL0F04590 Chr6 complement(864567..865652) [1086 bp, 361 aa] {ON}
           Anc_8.335 YDR153C
          Length = 361

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 42/97 (43%), Gaps = 20/97 (20%)

Query: 7   RSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDKRLNDK 66
           R A+N++  Y   Q+ +R AT+ D  GP+   LE++    +  V  + + +   KRL D 
Sbjct: 21  RFAQNMIVQYEPYQIDIRRATNTDAWGPTPKHLEKVLRNRY-QVPLYLLTEYTLKRLVDH 79

Query: 67  -------------------GRNWRHVAKSLTCLDFLV 84
                              G  WR V K L  ++FL+
Sbjct: 80  VATRPKNLYEKARKDYVNYGSEWRVVLKCLVVIEFLL 116

>Kpol_344.8 s344 complement(20765..21919) [1155 bp, 384 aa] {ON}
           complement(20765..21919) [1155 nt, 385 aa]
          Length = 384

 Score = 34.3 bits (77), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 52/115 (45%), Gaps = 24/115 (20%)

Query: 7   RSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFF--------EIMDM 58
           R  +N++  Y   Q+ +R AT+ D  GP+   L+++    + +V  +         I+D 
Sbjct: 21  RFMQNMIVQYEPYQIDIRRATNTDAWGPTTKHLQKVIRNKY-SVPLYLMTEYVLKRIVDH 79

Query: 59  LDKR---LNDKGRN--------WRHVAKSLTCLDFLVRCGSE----NCVFWCKEN 98
           L KR   L +K R         WR + K L  +++L+   SE    N V  C EN
Sbjct: 80  LAKRPKNLYEKARKEYVNYGSEWRIILKCLIVIEYLLLNVSEPEELNQVKSCLEN 134

>NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON}
           Anc_4.17 YLL038C
          Length = 310

 Score = 33.9 bits (76), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 23/107 (21%), Positives = 54/107 (50%), Gaps = 11/107 (10%)

Query: 8   SAKNLVNGYSQAQVLVRSATS-NDKDGPSVDQLEELAERTFDNVEFFEIMDMLDKRLNDK 66
           + KN V   ++++V  + AT  N+  G +   + E++  T+      +I+ ++ KRL+  
Sbjct: 6   TVKNFVQTPTESKV--KQATDDNETTGATGTLMNEISVLTYSPKTLKDIIQVIKKRLSSA 63

Query: 67  GRNWR--------HVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTL 105
             + +        ++ K+LT + +L+  GS   + W + N Y+++ +
Sbjct: 64  TSSNKKLSHKTSVYIIKTLTLISYLINNGSNEFIEWLRLNFYLVENI 110

>KNAG0J02870 Chr10 (549107..550096) [990 bp, 329 aa] {ON} Anc_4.17
           YLL038C
          Length = 329

 Score = 33.9 bits (76), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 53/119 (44%), Gaps = 13/119 (10%)

Query: 8   SAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDKR---LN 64
           S +N VN  ++ +V   +  S      +   + E++  T+      EI  +L KR   ++
Sbjct: 6   SVRNFVNSTTELKVKQATDDSEVLSSSTGTVMNEISVLTYSPKTLKEIQSVLRKRFHLMS 65

Query: 65  DKGRNWRH-----VAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLR-----EFTHTDE 113
              R   H     V K+LT + FL+  GS   V W K N+   + L+     EF+ TD+
Sbjct: 66  TLPRKVLHRSCLIVLKTLTLILFLLNNGSNAFVSWIKSNVGAFEPLQNVPITEFSFTDK 124

>TPHA0C00740 Chr3 (144476..145633) [1158 bp, 385 aa] {ON} Anc_8.335
           YDR153C
          Length = 385

 Score = 33.9 bits (76), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 42/97 (43%), Gaps = 20/97 (20%)

Query: 7   RSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDKRLNDK 66
           R  +N++  Y   Q+ VR A++ D  GP+   L+++    + +V  + I +   KRL D 
Sbjct: 21  RFMQNMIVQYEPYQIDVRRASNTDAWGPTSKHLQKVLRHKY-SVPLYLITEYTLKRLIDH 79

Query: 67  -------------------GRNWRHVAKSLTCLDFLV 84
                              G  WR V K L  LDFL+
Sbjct: 80  IATNSKNVYEKARKEYVNFGSEWRVVFKCLVILDFLL 116

>Kwal_YGOB_27.11261 s27 complement(716644..717033,717035..717859)
           [1215 bp, 404 aa] {ON} ANNOTATED BY YGOB -
          Length = 404

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 46/112 (41%), Gaps = 24/112 (21%)

Query: 7   RSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDKRLNDK 66
           R A+N++  Y   QV +R AT+ D  GP+   L ++    +  V    + +   KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKY-QVPLHLMTEYTLKRLVDH 79

Query: 67  -------------------GRNWRHVAKSLTCLDFL---VRCGSE-NCVFWC 95
                              G  WR V K L  L++L   V  GSE + V  C
Sbjct: 80  IASRPKNLYEKARKQYVNYGNEWRVVLKCLVVLEYLLLNVDSGSEVDQVIGC 131

>Suva_2.315 Chr2
           complement(560767..560940,560968..561033,561037..562005)
           [1209 bp, 403 aa] {ON} YDR153C (REAL)
          Length = 403

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 41/97 (42%), Gaps = 20/97 (20%)

Query: 7   RSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDKRLNDK 66
           R A+N++  Y   QV +R AT+ D  GP+   L ++    +  V  + + +   KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLAKVLRNRY-QVPLYLMTEYTLKRLVDH 79

Query: 67  -------------------GRNWRHVAKSLTCLDFLV 84
                              G  WR V K L  ++FL+
Sbjct: 80  IATRPKNLYEKARKDYVNYGSEWRVVLKCLVVVEFLL 116

>Smik_4.398 Chr4 complement(724753..726003) [1251 bp, 416 aa] {ON}
           YDR153C (REAL)
          Length = 416

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 41/97 (42%), Gaps = 20/97 (20%)

Query: 7   RSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDKRLNDK 66
           R A+N++  Y   Q+ +R AT+ D  GP+   L ++    +  V  + + +   KRL D 
Sbjct: 21  RFAQNVIVQYEPYQIDIRRATNTDAWGPTPKHLAKVLRNRY-QVPLYLMTEYTLKRLVDH 79

Query: 67  -------------------GRNWRHVAKSLTCLDFLV 84
                              G  WR V K L  ++FL+
Sbjct: 80  IATRPKNFYEKARKDYVNYGSEWRVVLKCLAVIEFLL 116

>Skud_4.412 Chr4 complement(736255..737475) [1221 bp, 406 aa] {ON}
           YDR153C (REAL)
          Length = 406

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 41/97 (42%), Gaps = 20/97 (20%)

Query: 7   RSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDKRLNDK 66
           R A+N++  Y   QV +R AT+ D  GP+   L ++    +  V  + + +   KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLAKVLRNRY-QVPLYLMTEYTLKRLVDH 79

Query: 67  -------------------GRNWRHVAKSLTCLDFLV 84
                              G  WR V K L  ++FL+
Sbjct: 80  IASRPKNLYEKARKDYVNYGSEWRVVLKCLVVVEFLL 116

>YDR153C Chr4 complement(766736..767971) [1236 bp, 411 aa] {ON}
           ENT5Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes; associates with the clathrin
           adaptor Gga2p, clathrin adaptor complex AP-1, and
           clathrin
          Length = 411

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 41/97 (42%), Gaps = 20/97 (20%)

Query: 7   RSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDKRLNDK 66
           R A+N++  Y   Q+ +R AT+ D  GP+   L ++    +  V  + + +   KRL D 
Sbjct: 21  RFAQNVIVQYEPYQIDIRRATNTDAWGPTPKHLAKVLRNRY-QVPLYLMTEYTLKRLVDH 79

Query: 67  -------------------GRNWRHVAKSLTCLDFLV 84
                              G  WR V K L  ++FL+
Sbjct: 80  IATRPKNLYEKARKDYVNYGSEWRVVLKCLVVIEFLL 116

>Kwal_27.11263 s27 complement(717032..717859) [828 bp, 275 aa] {OFF}
           YDR153C - Hypothetical ORF [contig 29] FULL
          Length = 275

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 43/105 (40%), Gaps = 23/105 (21%)

Query: 7   RSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDKRLNDK 66
           R A+N++  Y   QV +R AT+ D  GP+   L ++    +  V    + +   KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKY-QVPLHLMTEYTLKRLVDH 79

Query: 67  -------------------GRNWRHVAKSLTCLDFL---VRCGSE 89
                              G  WR V K L  L++L   V  GSE
Sbjct: 80  IASRPKNLYEKARKQYVNYGNEWRVVLKCLVVLEYLLLNVDSGSE 124

>KAFR0C03770 Chr3 complement(768537..770450) [1914 bp, 637 aa] {ON}
           Anc_2.669 YKL025C
          Length = 637

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 29/66 (43%), Gaps = 3/66 (4%)

Query: 370 FSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYK---QITNDAPKHNPFL 426
            S+L NLL S    D   +T    +P  + K        GT  +    + NDAPK N F+
Sbjct: 77  LSDLPNLLNSQPNKDIHTSTSTNSLPKFNAKVSASFTPMGTAQRPTSAVDNDAPKSNTFV 136

Query: 427 TSQYTG 432
           +  +T 
Sbjct: 137 SESFTS 142

>Ecym_4264 Chr4 complement(558142..559368) [1227 bp, 408 aa] {ON}
          similar to Ashbya gossypii AGR046C
          Length = 408

 Score = 31.2 bits (69), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 35/69 (50%), Gaps = 7/69 (10%)

Query: 7  RSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLDKRLNDK 66
          R A+N++  Y   QV +R AT+ D  GP+  QL ++    +  V  + I +   KRL D 
Sbjct: 21 RFAQNMIIQYEPYQVDIRRATNTDSWGPTPKQLAKVMRNRY-QVPMYLITEYTMKRLVD- 78

Query: 67 GRNWRHVAK 75
               H+AK
Sbjct: 79 -----HMAK 82

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,045,004
Number of extensions: 1136270
Number of successful extensions: 3623
Number of sequences better than 10.0: 96
Number of HSP's gapped: 3610
Number of HSP's successfully gapped: 126
Length of query: 478
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 365
Effective length of database: 40,524,141
Effective search space: 14791311465
Effective search space used: 14791311465
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)