Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0C16687g7.340ON39839821340.0
SAKL0F10978g7.340ON4053964933e-57
ACL159W7.340ON4134164915e-57
Ecym_45197.340ON4324144612e-52
Kwal_56.246047.340ON3813744293e-48
KLTH0H01474g7.340ON3813913935e-43
TPHA0D045507.340ON4374282482e-22
NCAS0A140707.340ON1731301172e-06
TDEL0F017104.26ON785293860.050
KNAG0A040308.486ON20876800.16
TBLA0D013508.694ON135289760.91
TBLA0A016058.486ON22428731.2
KAFR0C051007.37ON705128741.5
TPHA0H016805.414ON989121731.9
Kpol_1036.523.186ON59180712.9
NDAI0E031208.486ON23961694.2
KAFR0H004905.648ON72872704.8
Kpol_218.25.506ON125173695.7
Suva_2.397.401ON151665696.7
TDEL0D039303.231ON48440687.1
NDAI0C052108.486ON25551677.7
NDAI0F012306.278ON1110556710.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C16687g
         (398 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C16687g Chr3 (1461624..1462820) [1197 bp, 398 aa] {ON} cons...   826   0.0  
SAKL0F10978g Chr6 complement(859590..860807) [1218 bp, 405 aa] {...   194   3e-57
ACL159W Chr3 (77497..78738) [1242 bp, 413 aa] {ON} NOHBY310; No ...   193   5e-57
Ecym_4519 Chr4 (1034982..1036280) [1299 bp, 432 aa] {ON} similar...   182   2e-52
Kwal_56.24604 s56 (1071942..1073087) [1146 bp, 381 aa] {ON} [con...   169   3e-48
KLTH0H01474g Chr8 complement(134657..135802) [1146 bp, 381 aa] {...   155   5e-43
TPHA0D04550 Chr4 (993082..994395) [1314 bp, 437 aa] {ON} Anc_7.340    100   2e-22
NCAS0A14070 Chr1 (2767470..2767991) [522 bp, 173 aa] {ON} Anc_7....    50   2e-06
TDEL0F01710 Chr6 (318461..320818) [2358 bp, 785 aa] {ON} Anc_4.2...    38   0.050
KNAG0A04030 Chr1 (542889..543515) [627 bp, 208 aa] {ON} Anc_8.48...    35   0.16 
TBLA0D01350 Chr4 (333044..337102) [4059 bp, 1352 aa] {ON} Anc_8....    34   0.91 
TBLA0A01605 Chr1 (376599..377273) [675 bp, 224 aa] {ON}                33   1.2  
KAFR0C05100 Chr3 (1011347..1013464) [2118 bp, 705 aa] {ON} Anc_7...    33   1.5  
TPHA0H01680 Chr8 (384306..387275) [2970 bp, 989 aa] {ON} Anc_5.4...    33   1.9  
Kpol_1036.52 s1036 complement(140685..142460) [1776 bp, 591 aa] ...    32   2.9  
NDAI0E03120 Chr5 (662597..663316) [720 bp, 239 aa] {ON} Anc_8.48...    31   4.2  
KAFR0H00490 Chr8 complement(83827..86013) [2187 bp, 728 aa] {ON}...    32   4.8  
Kpol_218.2 s218 (1646..5401) [3756 bp, 1251 aa] {ON} (1646..5401...    31   5.7  
Suva_2.39 Chr2 (71933..76483) [4551 bp, 1516 aa] {ON} YBL079W (R...    31   6.7  
TDEL0D03930 Chr4 complement(716963..718417) [1455 bp, 484 aa] {O...    31   7.1  
NDAI0C05210 Chr3 complement(1209022..1209789) [768 bp, 255 aa] {...    30   7.7  
NDAI0F01230 Chr6 (299153..302485) [3333 bp, 1110 aa] {ON} Anc_6....    30   10.0 

>KLLA0C16687g Chr3 (1461624..1462820) [1197 bp, 398 aa] {ON}
           conserved hypothetical protein
          Length = 398

 Score =  826 bits (2134), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/398 (100%), Positives = 398/398 (100%)

Query: 1   MAQFRYRSGCGLESNFLDLNLCTKCHLISCQQCQDFEVVGKYCSQCGKDASKNDAVYCHK 60
           MAQFRYRSGCGLESNFLDLNLCTKCHLISCQQCQDFEVVGKYCSQCGKDASKNDAVYCHK
Sbjct: 1   MAQFRYRSGCGLESNFLDLNLCTKCHLISCQQCQDFEVVGKYCSQCGKDASKNDAVYCHK 60

Query: 61  NCFQCPCCAMSLQIISNKDENNTDHRSYSFKCQGCNWSYCTPVVPKIKSLTKYIIELEYS 120
           NCFQCPCCAMSLQIISNKDENNTDHRSYSFKCQGCNWSYCTPVVPKIKSLTKYIIELEYS
Sbjct: 61  NCFQCPCCAMSLQIISNKDENNTDHRSYSFKCQGCNWSYCTPVVPKIKSLTKYIIELEYS 120

Query: 121 TDTHRRFESLRQFYHTRNTLNSLSLKPESLKFDALDPSNLNSWWKRLANGEPLWKLINEE 180
           TDTHRRFESLRQFYHTRNTLNSLSLKPESLKFDALDPSNLNSWWKRLANGEPLWKLINEE
Sbjct: 121 TDTHRRFESLRQFYHTRNTLNSLSLKPESLKFDALDPSNLNSWWKRLANGEPLWKLINEE 180

Query: 181 NAIPFDELKQENKHWLPSLCKLRPKYNYFCPYCKRCMTRMDPTPDTVKWVKTPPIYSGIP 240
           NAIPFDELKQENKHWLPSLCKLRPKYNYFCPYCKRCMTRMDPTPDTVKWVKTPPIYSGIP
Sbjct: 181 NAIPFDELKQENKHWLPSLCKLRPKYNYFCPYCKRCMTRMDPTPDTVKWVKTPPIYSGIP 240

Query: 241 RISVISSYQCTQLYKEFDHDNNLMLLIENTRQDSNATLKINAEESLLVPNHELSIFAAIK 300
           RISVISSYQCTQLYKEFDHDNNLMLLIENTRQDSNATLKINAEESLLVPNHELSIFAAIK
Sbjct: 241 RISVISSYQCTQLYKEFDHDNNLMLLIENTRQDSNATLKINAEESLLVPNHELSIFAAIK 300

Query: 301 TNQKRKDNLEQLQDVLHSLPTHMLNTSPDSDKLLRVENTRRLGLLNKRLSSDNLRIIDEG 360
           TNQKRKDNLEQLQDVLHSLPTHMLNTSPDSDKLLRVENTRRLGLLNKRLSSDNLRIIDEG
Sbjct: 301 TNQKRKDNLEQLQDVLHSLPTHMLNTSPDSDKLLRVENTRRLGLLNKRLSSDNLRIIDEG 360

Query: 361 TGWIVIPLMIINRKPRYEIDIFVHFEDWDLSMSAFIDL 398
           TGWIVIPLMIINRKPRYEIDIFVHFEDWDLSMSAFIDL
Sbjct: 361 TGWIVIPLMIINRKPRYEIDIFVHFEDWDLSMSAFIDL 398

>SAKL0F10978g Chr6 complement(859590..860807) [1218 bp, 405 aa] {ON}
           conserved hypothetical protein
          Length = 405

 Score =  194 bits (493), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 124/396 (31%), Positives = 202/396 (51%), Gaps = 29/396 (7%)

Query: 19  LNLCTKCHLISCQQCQDFEVVGKYCSQCGKDASKNDAVYCHKNCFQCPCCAMSLQIISNK 78
           LNLC  C+ +SC QCQ FE V KYC  C +  S+ D  +C KNCFQCP C + L I S  
Sbjct: 19  LNLCQACYRVSCTQCQLFEPVLKYCPLCMEVPSRADQTHCTKNCFQCPRCKLGLVISSGS 78

Query: 79  -DENNTDHRSYSFKCQGCNWSYCTPVVPKIKSLTKYIIELEYST-DTHRRFESLRQFYHT 136
            D+ N   + Y FKC GC+W Y TP V KI+SLTKYI  L+ +     RRFE L + YH+
Sbjct: 79  CDDGN---KKYVFKCMGCHWDYKTPSVGKIRSLTKYIKSLKANECLLSRRFEVLERHYHS 135

Query: 137 RNTLN--SLSLKPESLKFDALDPSNLNSWWKRLANGEPLWKLINEENAIPFDELKQENKH 194
           +  L    L+  P  +  D    ++  +  +RL+ G+ L++L++E   +P ++    +  
Sbjct: 136 KRQLLDWGLTKTPLKIPLDGSLVADRRNVLQRLSQGDKLFELLDEPCPMPLND--TSDAL 193

Query: 195 WLPSLCKLRPKYNYFCPYCKRCMTRMDPTPDTVKWVKTPPIYSGIPRISVISSYQCTQLY 254
            LP    LR KY Y CPYC   + + +  P ++K+  T      +P +S+      +Q+ 
Sbjct: 194 ELPLQMHLRCKYKYSCPYCLNTLLKPETQPKSLKFYTTSFAVKYLPALSLAPR---SQID 250

Query: 255 KEFDHDNNLMLLIENTRQDSNATLKINAEESLLVPNHELSIFAAIKTNQKRKD-NLEQLQ 313
            +   D    L+I N        + ++  + L +P  E+ I A        +D  L+ ++
Sbjct: 251 NKVYDDTRFALVINNPTSSEEMHITMSGSDGLFIPITEVRIRAVTPVTPSHQDHGLKTIE 310

Query: 314 DVLHSLPTHMLNTSPDSDKLLRVENTRRLGLLNKRLSS-------------DNLRIIDEG 360
             + S+PT+ L       KL RVE T+RLG  N  + S             ++ +++D+G
Sbjct: 311 QFILSVPTYKLTA---DTKLSRVERTKRLGKKNLNVYSTANNSSTSLLEDLEDYKLLDQG 367

Query: 361 TGWIVIPLMIINRKPRYEIDIFVHFEDWDLSMSAFI 396
           +GW ++P+ ++N    + + I V  + + ++M+  I
Sbjct: 368 SGWCIVPVNVLNNASVHSLFITVATQKFKVTMNCVI 403

>ACL159W Chr3 (77497..78738) [1242 bp, 413 aa] {ON} NOHBY310; No
           homolog in Saccharomyces cerevisiae
          Length = 413

 Score =  193 bits (491), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 135/416 (32%), Positives = 211/416 (50%), Gaps = 40/416 (9%)

Query: 3   QFRYRSGCGLESNFLDLNLCTKCHLISCQQCQDFEVVGKYCSQCGKDASKNDAVYCHKNC 62
           + RY+  C     + DLN C +CH ISC +CQ+FE V KYC +C ++  K D ++C++NC
Sbjct: 2   EVRYQCVCQQLVKWSDLNSCKECHSISCFRCQEFEPVLKYCPKCLEEPGKIDQIFCNRNC 61

Query: 63  FQCPCCAMSLQIISNKDENNTDHRSYSFKCQGCNWSYCTPVVPKIKSLTKYIIELEYSTD 122
           FQCP C +SL I S K     D +SY F C GC WS+ TP   KIKSLTKY++EL Y++ 
Sbjct: 62  FQCPRCNISLVISSEK--VTEDSKSYVFTCTGCKWSFTTPPTGKIKSLTKYVLEL-YNSK 118

Query: 123 THRRFESLRQFYHTRNTLNSLSLKPESLKFD----ALDPSNLNSWWKRLANGEPLWKLIN 178
             R +E +    H  N    L  +  + KFD    AL+ +   S+ +RLA GE L  LIN
Sbjct: 119 NSRAYELMT---HLHNKKQLLQWEGRAFKFDEIVNALEGNAPRSFVQRLAAGEKLHHLIN 175

Query: 179 EENAIPFDELKQENKHWL-PSLCKLRPKYNYFCPYCKRCMTRMDPTPDTVKWVKTPPIYS 237
           EE A P   L+Q+ +H L P    L+ +Y Y CP C   ++  D TP + K  K     +
Sbjct: 176 EELAQP---LQQDMEHVLYPKRTHLKCRYRYMCPKCHHTLSMPDQTPASSKLHKESFAMN 232

Query: 238 GIPRISVISSYQCTQLYKEFDHDNNLMLLIENTRQDSNATLKINAEESLLVPNHELSIFA 297
            +P I +    +   L  +      L +++ N          ++A ++L +P  + +I +
Sbjct: 233 VLPHIRI--ETEARALGVDTQDPTALAIIVMNPIPMRAVDFVLSASDTLFLPVRKFTIPS 290

Query: 298 A------IKTNQKRKDNLEQLQDVLHSLPTHMLNTSPDSDKLLRVENTRRLGLLNKRLSS 351
                  +  +Q +  NL+ L+  +  +PT ML    +  KL R E TRRLG   +   S
Sbjct: 291 VAPDDSQLDRSQGKDVNLQILEHYVKFIPTCMLG---NDHKLNRAERTRRLGNRFQFQGS 347

Query: 352 --------------DNLRIIDEGTGWIVIPLMIINRKPRYEIDIFVHFEDWDLSMS 393
                         +  R +D+G  W ++PL ++ R   + +++ V   DW ++++
Sbjct: 348 ASPTPPNPVDYDIEEEARPLDQGDAWCILPLKLL-RDGLHLLNVLVTIGDWQVNLN 402

>Ecym_4519 Chr4 (1034982..1036280) [1299 bp, 432 aa] {ON} similar to
           Ashbya gossypii ACL159W
          Length = 432

 Score =  182 bits (461), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 131/414 (31%), Positives = 212/414 (51%), Gaps = 37/414 (8%)

Query: 3   QFRYRSGCGLESNFLDLNLCTKCHLISCQQCQDFEVVGKYCSQCGKDASKNDAVYCHKNC 62
           + RY+  C     + DLN+C +C+ +SC +CQ FE V KYC +C ++  K D ++C++NC
Sbjct: 23  EVRYQCICKNLVKWSDLNICRECYSLSCFRCQGFEPVVKYCPKCLEEPGKMDQIFCNRNC 82

Query: 63  FQCPCCAMSLQIISNKDENNTDHRSYSFKCQGCNWSYCTPVVPKIKSLTKYIIELEYSTD 122
           FQCP C +SL I S K   ++D + Y F C GC W++ TP   KIKSLTKYI+EL YS+ 
Sbjct: 83  FQCPRCDISLVISSEK--MDSDKKCYLFNCTGCKWTFTTPPTGKIKSLTKYILEL-YSSK 139

Query: 123 THRRFESLRQFYHTRNTLNSLSLKPESLKFD----ALDPSNLNSWWKRLANGEPLWKLIN 178
             R +E +    H  N    L  + ++ KFD    AL+ +   S  +RLA GE L +LI+
Sbjct: 140 NARAYELIT---HLHNKKQLLQWEGKAFKFDEIVSALEGNAPRSIVQRLAVGEKLHQLIS 196

Query: 179 EENAIPFDELKQENKHWLPSLCKLRPKYNYFCPYCKRCMTRMDPTPDTVKWVKTPPIYSG 238
           E+  +P  +    N+   P    L+ KY Y CP C   ++  D +P + +  K     + 
Sbjct: 197 EQIPLPLKD--DSNEVLYPKRLHLKCKYRYTCPQCNHTLSVPDDSPSSSRLHKESFAMNI 254

Query: 239 IPRISVISSYQCTQLYKEFDHDNNLMLLIENTRQDSNATLKINAEESLLVPNHELSIFAA 298
           +PRI +        L  +    +   +++ N     +    + A ++L +P  + +I A 
Sbjct: 255 LPRIRI--EKLAVALGMDHQDPSAFAIVVINPNPSRSIECTLTASDTLFMPIRKFNIPAV 312

Query: 299 ------IKTNQKRKDNLEQLQDVLHSLPTHMLNTSPDSDKLLRVENTRRLG----LLNKR 348
                 I  N  +  NL+ L+      PT+ML    +  K+ R E TRRLG      N  
Sbjct: 313 SVNDYKIIKNSGKDINLQILEQYAKFTPTYMLG---NDHKINRAERTRRLGSRFPFQNST 369

Query: 349 LSSDNL---------RIIDEGTGWIVIPLMIINRKPRYEIDIFVHFEDWDLSMS 393
            +S NL         + ID+G GW ++PL ++N K  + +++ V+ E +++ ++
Sbjct: 370 TNSINLLDYDIDEDAKAIDKGDGWCILPLKLLN-KGNHLLNLLVNIEGFEVRLN 422

>Kwal_56.24604 s56 (1071942..1073087) [1146 bp, 381 aa] {ON} [contig
           161] FULL
          Length = 381

 Score =  169 bits (429), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 105/374 (28%), Positives = 187/374 (50%), Gaps = 21/374 (5%)

Query: 15  NFLDLNLCTKCHLISCQQCQDFEVVGKYCSQCGKDASKNDAVYCHKNCFQCPCCAMSLQI 74
           +  DLNLC KCH +SC+ CQ  E++ K+C  C K A   + + C+KNCF+CP C +++ +
Sbjct: 15  SLYDLNLCRKCHRVSCRWCQKPELLIKFCPGCSKGAETKNQMSCNKNCFECPRCQLAVSV 74

Query: 75  ISNKDENNTDHRSYSFKCQGCNWSYCTPVVPKIKSLTKYIIELEYSTDTH-RRFESLRQF 133
              K  +    R +   C GC W Y TP + K + LT+++ EL+   D H +RF SLR+ 
Sbjct: 75  SMRKQGDGA--RCFELVCNGCLWKYTTPAMTKARPLTQFVKELQEKEDPHEQRFISLRKL 132

Query: 134 YHTRNTLNSLSLKPESLKFDALDPSNLNSWWKRLANGEPLWKLINEENAIPFDELKQENK 193
           Y  +    +L         D +DPS          N   L++L+NEE  +P  +    + 
Sbjct: 133 YRDKIQFQNLETT------DVIDPSFATKEVAERLNNMKLFELVNEEFPLPIHKGTFTSW 186

Query: 194 HWLPSLCKLRPKYNYFCPYCKRCMTRMDPTPDTVKWVKTPPIYSGIPRISVISSYQCTQL 253
           +  P    LR K+NY CP C   +T+  P P + +++        +P + V+S    + +
Sbjct: 187 NSFPRARALRGKFNYRCPACGEYLTKCHPDPKSSRFMLESFAMHQLPDLQVVSR---SLI 243

Query: 254 YKEFDHDNNLMLLIENTRQDSNAT-LKINAEESLLVPNHELSIFAAIKTNQKRKDNLEQL 312
             + D +N++ L+ + +     AT + I +  +  +P  + ++   I +  +     E +
Sbjct: 244 DPKIDDENSMALVFKASSSAHVATDITIVSCATAHIPVRQFTLTRDIPSRNELTQ--EAI 301

Query: 313 QDVLHSLPTHMLNTSPDSDKLLRVENTRRLGLLNKRLSSDNLRIIDEGTGWIVIPLMIIN 372
           + +   +PT  LNT   + K+L  E +RR   + +   ++   IID+G GW +IP+ I+ 
Sbjct: 302 KRLASEVPTFQLNT---NTKILAAEKSRRNSKVERTHKNE---IIDQGNGWCIIPMYILE 355

Query: 373 RKPRYEIDIFVHFE 386
             P +++ + +  E
Sbjct: 356 PTPTHKLQLTIPIE 369

>KLTH0H01474g Chr8 complement(134657..135802) [1146 bp, 381 aa] {ON}
           conserved hypothetical protein
          Length = 381

 Score =  155 bits (393), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 104/391 (26%), Positives = 191/391 (48%), Gaps = 21/391 (5%)

Query: 9   GCGLESNFL-DLNLCTKCHLISCQQCQDFEVVGKYCSQCGKDASKNDAVYCHKNCFQCPC 67
            C  E N +  LN+C KCH +SC  CQ  E++ KYC  C + A     + C  NC +CP 
Sbjct: 8   SCSTEPNSIYKLNICAKCHRVSCNWCQKPELLIKYCPGCFRVAESEGQLRCVHNCLECPR 67

Query: 68  CAMSLQIISNKDENNTDHRSYSFKCQGCNWSYCTPVVPKIKSLTKYIIELEYSTDTH-RR 126
           C + L +  + ++  + H+ +   C GC+W Y TP V  +K+LT  + EL    D + +R
Sbjct: 68  CELILSV--SMEKLASGHKRFEMVCNGCSWRYKTPEVSTLKTLTGCVEELRKKEDPYTQR 125

Query: 127 FESLRQFYHTRNTLNSLSLKPESLKFDALDPSNLNSWWKRLANGEPLWKLINEENAIPFD 186
           F SLR+FY  +  L  +    E  +  A         + RL N   L+K+INEE  I F 
Sbjct: 126 FNSLREFYGFKRELQYMEEGGEVSESIA-----SKELFDRL-NETKLYKMINEECPIEFK 179

Query: 187 ELKQENKHWLPSLCKLRPKYNYFCPYCKRCMTRMDPTPDTVKWVKTPPIYSGIPRISVIS 246
           + K      LP   +LR K++Y CP C   +T+  P P + +++        +P + ++ 
Sbjct: 180 DTKDSGDIALPLPLRLRAKFDYRCPSCGEWLTKSHPDPRSSRFLLESFAAHMLPSLEIVH 239

Query: 247 SYQCTQLYKEFDHDNNLMLLIENTRQ-DSNATLKINAEESLLVPNHELSIFAAIKTNQKR 305
               +++      +N + L+   + Q D+   + I    ++ +P  + ++  A     K 
Sbjct: 240 R---SKVEPSVSDENAMALVFTASDQSDTPVEITILGSATIHIPVRQFTL--AYDGPVKC 294

Query: 306 KDNLEQLQDVLHSLPTHMLNTSPDSDKLLRVENTRRLGLLNKRLSSDNLRIIDEGTGWIV 365
           +  +E ++ ++  +PT+ LN++ +   +L  E +RRL         +N+  ID+G+GW +
Sbjct: 295 ESTMETIKRLVTRVPTYQLNSNTN---ILATEKSRRLTRPETAPHKNNM--IDQGSGWCI 349

Query: 366 IPLMIINRKPRYEIDIFVHFEDWDLSMSAFI 396
           +P+ I+     + I + +  +   +++ A +
Sbjct: 350 LPMYILEPAKTHRIQLTIPIKGVYVTLQAVL 380

>TPHA0D04550 Chr4 (993082..994395) [1314 bp, 437 aa] {ON} Anc_7.340
          Length = 437

 Score =  100 bits (248), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 103/428 (24%), Positives = 183/428 (42%), Gaps = 64/428 (14%)

Query: 15  NFLDLNLCTKCHLISCQQCQDFEVVGKYCSQCGKDASKNDAV------------------ 56
           +F  LNLC KCH ISC  CQ F+   K+C  C ++    D                    
Sbjct: 27  DFSRLNLCRKCHKISCDSCQLFQDYEKFCPYCCRNNKVPDCADGSRLSFEERYCQEICYD 86

Query: 57  -YCHKNCFQCPCC--AMSLQIISNKDENNTDHRSYSFKCQGCNWSYCTPVVPKIKSLTKY 113
            YC   CFQCP C  +++L +  N+   + + ++ SF+C  C+WS+ T +   +K L+K+
Sbjct: 87  EYCTNGCFQCPKCNNSLALSLCKNERLKDPNGKTISFQCYCCSWSWSTELPGNVKLLSKH 146

Query: 114 IIELEYSTD-THRRFESLRQFY-----HTRNTLNSLSLKPESLKFDALDPS----NLNSW 163
           I  L  + D   +RF+ L   Y        N   S S+K   LK   L  +    ++ + 
Sbjct: 147 IFSLHLNLDPKFQRFKQLSNIYLNDSSDCSNNDPSYSVKDIYLKQGDLQSARGLLDIINN 206

Query: 164 WKRLANGEPLWKLINEENAIPFDELKQENKHWLPSLCKLRPKYNYFCPYCKRCMTR---- 219
            K  +       L+N++   P   L  +    LP L KL  K+ Y CP+C+  + +    
Sbjct: 207 KKETSFNTSSTVLLNDQ--FPHQNLYDDTNTSLPELSKLVMKFEYKCPHCEETILKPSSE 264

Query: 220 ---MDPTPDTVKWVKTPPIYSGIPRISVISSYQCTQLYKEFDHDNNLMLLIENTRQDSNA 276
               D T ++  + + P I      +S I            D   +L+L+++N   + N 
Sbjct: 265 LYSSDNTYESFAFTQLPTI-----EVSAIK-----------DLKQDLVLIMKNIEDNLND 308

Query: 277 TLK---INAEESLLVPNHELSIFAAIKTNQKRKDNLEQLQDVLHSLPTHMLNTSPD-SDK 332
            ++   I ++   L  N  + + +     Q +     +L   L  LP+  LN   + ++K
Sbjct: 309 FVQAEIITSDNIQLSQNKFIFMKSTGDKLQDKSKYYAELMSYLEGLPSFDLNLCDNVNNK 368

Query: 333 LLRVENTRRLGLLNKRLSSDN----LRIIDEGTGWIVIPLMIINRKPRYEIDIFVHFEDW 388
            +R+E  RRL   N     +N    +   +E   +IV P+ I+      ++ +   F+ +
Sbjct: 369 FVRIEKQRRLAKNNNIAVMNNANSPMNYKEESDRYIVSPIKILTETALNKLLVKYKFKTY 428

Query: 389 DLSMSAFI 396
           ++S+   +
Sbjct: 429 EVSLECIL 436

>NCAS0A14070 Chr1 (2767470..2767991) [522 bp, 173 aa] {ON} Anc_7.340
          Length = 173

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 64/130 (49%), Gaps = 7/130 (5%)

Query: 22  CTKCHLISCQQCQDFEVVGKYCSQCGKDASKNDA-VYCHKNCFQCPCCAMSLQIISNKDE 80
           C  CH  +C  C+ F+ + + C QC       D    C  +CFQCP C  +L ++  K  
Sbjct: 17  CKVCHNTTCPDCELFQPLQRECPQCQTITMHMDEDTRCKNDCFQCPNCETALTVLLAK-- 74

Query: 81  NNTDHRSYSFKCQGCNWSYCTP--VVPKIKSLTKYIIELEYSTDT-HRRFESLRQFYHTR 137
            ++  + Y F C+ C++ Y TP   V   +S+++ +  L  + +  + RF+ L++     
Sbjct: 75  -SSRKKRYKFTCKHCDYDYVTPSMSVTDERSISQIVDHLNETLNVEYLRFQELKKNIELG 133

Query: 138 NTLNSLSLKP 147
             ++++ + P
Sbjct: 134 GGIDNVVVLP 143

>TDEL0F01710 Chr6 (318461..320818) [2358 bp, 785 aa] {ON} Anc_4.26
           YLL032C
          Length = 785

 Score = 37.7 bits (86), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 64/293 (21%), Positives = 113/293 (38%), Gaps = 57/293 (19%)

Query: 49  DASKNDAVYCHKNCFQCPCCAMSLQIISNKDENNTDHRSYSFKCQGCNWSYCTPVVPKIK 108
           + SK+ AV     CF     ++  Q+I   D  N  H S ++K Q    S   P      
Sbjct: 156 EGSKSGAVPRFVECFDLEAYSLLPQVIG-VDMANLRHVSSTYKTQVRVPSLILP------ 208

Query: 109 SLTKYIIELEYSTDTHRRFESLRQFYHTRNTLNSLSLKPESLKFDALDPSNLNSWWKRLA 168
                             F+  +   H    ++SL L  +    + ++ S  + ++ +L+
Sbjct: 209 ------------------FKDRKAQIHLSGEIHSLVLSAKDALMEIMERSQSSIYYFKLS 250

Query: 169 NGEPLWKLINEENAIPFDELKQENKHWLPSLCKLRPKYNYFCPYCKRCMTRMDP---TPD 225
           N  P  KL+  +N  P +            + +L  KY  F      C+    P     +
Sbjct: 251 NVSP-GKLLFIKNYYPSE------------MARLMIKYRSFIRVTDSCIEFQSPCLTLLN 297

Query: 226 TVKWVKTPPIYSGIPRISVISSYQCTQLYKEFDH-DNNLMLLIENTRQDSNATLKI-NAE 283
           +V  V T  +   I  + +        L+ +F   D+ + L+I N +  S   +KI N E
Sbjct: 298 SVIKVFTINVLHQIVEVQI-------TLHSDFAFTDDMVRLIISNEKGGSLNAMKITNHE 350

Query: 284 ESLLVPNHELSIFAAIKTNQKRKDNLEQLQDVLHSLPTHMLNTSPDSDKLLRV 336
           + LL+  +  ++   +  N+K  D +  L  +L +LP       P+S K LR 
Sbjct: 351 DQLLLIGNHSTMHDNLAANKKNSDIIYHLAMILRALP-------PNSLKQLRA 396

>KNAG0A04030 Chr1 (542889..543515) [627 bp, 208 aa] {ON} Anc_8.486
           YDR253C
          Length = 208

 Score = 35.4 bits (80), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 35/76 (46%), Gaps = 7/76 (9%)

Query: 21  LCTKCHL--ISCQQCQDFE-----VVGKYCSQCGKDASKNDAVYCHKNCFQCPCCAMSLQ 73
           +C KCH+  + C   +  E     V+   CSQCGK  ++ DA+  H N   C      + 
Sbjct: 129 VCAKCHMNFLRCSDLRRHEKIHLPVLPNICSQCGKGFARKDALKRHVNTLACKRNKKKIA 188

Query: 74  IISNKDENNTDHRSYS 89
            + + + N T+  + S
Sbjct: 189 SLVSNESNRTNSHTSS 204

>TBLA0D01350 Chr4 (333044..337102) [4059 bp, 1352 aa] {ON} Anc_8.694
            YPL167C
          Length = 1352

 Score = 33.9 bits (76), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 19/89 (21%), Positives = 39/89 (43%), Gaps = 17/89 (19%)

Query: 16   FLDLNLCTKCHLISCQQCQDFEVVGKYCSQCGKDASKNDAVYCHKNCFQCPCCAMSLQII 75
            F +  LC  C + S ++  D     ++C +C +D  K                 + + ++
Sbjct: 1243 FFESALCVHCRVRSRKKDVDGVGWSQFCDECSQDRQK-----------------LCVDLL 1285

Query: 76   SNKDENNTDHRSYSFKCQGCNWSYCTPVV 104
            + K    T H   ++KC+GCN++Y   ++
Sbjct: 1286 TQKRNLETKHACVNWKCRGCNFAYTGDIL 1314

>TBLA0A01605 Chr1 (376599..377273) [675 bp, 224 aa] {ON}
          Length = 224

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 19/28 (67%), Gaps = 1/28 (3%)

Query: 39  VGKY-CSQCGKDASKNDAVYCHKNCFQC 65
           VG + CSQCGKD ++ D++  H N  QC
Sbjct: 163 VGPHICSQCGKDFARKDSLKRHANTMQC 190

>KAFR0C05100 Chr3 (1011347..1013464) [2118 bp, 705 aa] {ON} Anc_7.37
           YOR354C
          Length = 705

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 28/128 (21%), Positives = 63/128 (49%), Gaps = 6/128 (4%)

Query: 275 NATLKINAEESLLVPNHELSIFAA--IKTNQKRKDNLEQLQDVLHSLPTHMLNTSPD--S 330
           N  L++++ + ++    EL +     + +++   D  +  +D  ++L +  +N+ P+   
Sbjct: 199 NQILQLDSNQQIMANLTELPVIKVEELISSRLEDDEKDTARDNFNNLVSQYMNSHPNWLP 258

Query: 331 DKLLRVENTRRLGLLNKRLSSDNLRIIDEGTGWIVIPLMIINRKPRYEIDIFVHFEDWDL 390
           DK+    + R+L  L+    S++++  D GT   ++   +    PRY IDI+  F+D  +
Sbjct: 259 DKIQNTYSLRKLRSLHNLAKSNDIK--DTGTVLKLMERALDLASPRYSIDIYSQFKDSVV 316

Query: 391 SMSAFIDL 398
            +S   D 
Sbjct: 317 DLSTLNDF 324

>TPHA0H01680 Chr8 (384306..387275) [2970 bp, 989 aa] {ON} Anc_5.414
           YDR356W
          Length = 989

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 57/121 (47%), Gaps = 20/121 (16%)

Query: 138 NTLNSLSLKPESLKFDALDP--SNL---NSWWKRLANGEPLWK-LINE--ENAIPFDELK 189
           +TLNS+++  ESL+FD + P  SN    NS   R  + E + + L+NE  ENA   + LK
Sbjct: 61  DTLNSVNMFNESLEFDEVIPELSNTILSNSDINRRDSNEIIGRNLVNELKENASTSNPLK 120

Query: 190 QENKHWLPSLCK----LRPKYNYFCPYCKRCMTRMDPTPDTVKWVKTPPIYSGIPRISVI 245
            E +  + SL K    L+ K      Y    M + +         KT P+   I  + V+
Sbjct: 121 -EQQEQIQSLIKENYNLKAKVTSLLKYLNTVMNKGE-------LQKTLPLLDEINELKVL 172

Query: 246 S 246
           S
Sbjct: 173 S 173

>Kpol_1036.52 s1036 complement(140685..142460) [1776 bp, 591 aa]
           {ON} complement(140685..142460) [1776 nt, 592 aa]
          Length = 591

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 36/80 (45%), Gaps = 14/80 (17%)

Query: 167 LANGEP--LWKLINEENAIPFDELKQENKHWLPSLCKLRP--------KYNYFC----PY 212
           L+ G P     + NE+  +PF+ELK++   + P  C +RP        K  Y       Y
Sbjct: 471 LSEGIPDEFQGMSNEDRFLPFEELKEKYDSFCPYQCLIRPSQSDRDFSKRVYVANCGHTY 530

Query: 213 CKRCMTRMDPTPDTVKWVKT 232
           C RC  R+  + +  K  K+
Sbjct: 531 CGRCYRRIQNSKEKSKLPKS 550

>NDAI0E03120 Chr5 (662597..663316) [720 bp, 239 aa] {ON} Anc_8.486
           YDR253C
          Length = 239

 Score = 31.2 bits (69), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 28/61 (45%), Gaps = 14/61 (22%)

Query: 8   SGCGLESNFL---DLNLCTKCHLISCQQCQDFEVVGKYCSQCGKDASKNDAVYCHKNCFQ 64
           S C LE  FL   DL    K HL+         V+   CSQCGK  ++ DA+  H N   
Sbjct: 161 SKCELE--FLRTSDLRRHEKAHLL---------VLPNICSQCGKGFARKDALKRHFNTMT 209

Query: 65  C 65
           C
Sbjct: 210 C 210

>KAFR0H00490 Chr8 complement(83827..86013) [2187 bp, 728 aa] {ON}
           Anc_5.648 YKR067W
          Length = 728

 Score = 31.6 bits (70), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 5/72 (6%)

Query: 271 RQDSNATLKINAEESLLVPNHELSIFAAIKTNQKRKDNLEQLQDVLHSLPTHMLNTSPDS 330
           RQ   +   +   E ++V NHE+ +  A    +     L+++QD L S+  +    +PD 
Sbjct: 300 RQKFRSRAVVEYGEPIIV-NHEMGLAYANHPRETVSKLLDKIQDALFSVTVN----APDY 354

Query: 331 DKLLRVENTRRL 342
           D L+ ++  RRL
Sbjct: 355 DTLMTIQAVRRL 366

>Kpol_218.2 s218 (1646..5401) [3756 bp, 1251 aa] {ON} (1646..5401)
           [3756 nt, 1252 aa]
          Length = 1251

 Score = 31.2 bits (69), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 33/73 (45%)

Query: 84  DHRSYSFKCQGCNWSYCTPVVPKIKSLTKYIIELEYSTDTHRRFESLRQFYHTRNTLNSL 143
           D + Y  K  G N  Y T +   +      ++  E  T T+ + + L+  +    T++SL
Sbjct: 708 DIQVYGIKLSGNNAKYATIINCDLSENNPMVLSAESFTSTYLKIKLLKPTFEKHFTISSL 767

Query: 144 SLKPESLKFDALD 156
           SL    LK+D  +
Sbjct: 768 SLSIMGLKYDDFE 780

>Suva_2.39 Chr2 (71933..76483) [4551 bp, 1516 aa] {ON} YBL079W
           (REAL)
          Length = 1516

 Score = 31.2 bits (69), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 7/65 (10%)

Query: 160 LNSWWKRLANGEPLWKLINEENAIPFDELKQENKHWLPSLCKLRPKYNYFCPYCKRCM-- 217
           LN  W  + N   LW + N+      D++K    H +  +  +RPK N F P  K+ +  
Sbjct: 184 LNRCWITIDNKLILWNIDNDNEYQVIDDMK----HTIRKVALVRPKPNTFVPTVKQLLLI 239

Query: 218 -TRMD 221
            T MD
Sbjct: 240 CTTMD 244

>TDEL0D03930 Chr4 complement(716963..718417) [1455 bp, 484 aa] {ON}
           Anc_3.231 YBR030W
          Length = 484

 Score = 30.8 bits (68), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 25/40 (62%), Gaps = 3/40 (7%)

Query: 162 SWWKRLANGEPLW-KLINEENAIPFDELKQENKHWLPSLC 200
           +WW+++  G PLW +  +++   P +EL+QE   WL  +C
Sbjct: 353 AWWRKI--GYPLWFRSTHKQETEPDEELEQELPPWLSEMC 390

>NDAI0C05210 Chr3 complement(1209022..1209789) [768 bp, 255 aa] {ON}
           Anc_8.486
          Length = 255

 Score = 30.4 bits (67), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 7/51 (13%)

Query: 22  CTKCHLISCQQCQ-------DFEVVGKYCSQCGKDASKNDAVYCHKNCFQC 65
           CT+C LI  +             ++   CSQCGK  ++ DA+  H N   C
Sbjct: 156 CTQCSLIFSRSSDLRRHEKTHLPILPNICSQCGKGFARKDALKRHFNTLTC 206

>NDAI0F01230 Chr6 (299153..302485) [3333 bp, 1110 aa] {ON} Anc_6.278
           YMR190C
          Length = 1110

 Score = 30.4 bits (67), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 27/55 (49%), Gaps = 3/55 (5%)

Query: 181 NAIPFDELKQENKHWLPSLCKLRPKYNYFCPYCKRCMTRMDPTPDTVKWVKTPPI 235
           N + FD L+++N H   + C L+ K +      ++  T +DP   T K +  P +
Sbjct: 108 NQLSFDALEKDNSH---TFCDLKAKIDLLEEQIRKLSTNIDPYTITTKALNPPTV 159

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.135    0.432 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,614,978
Number of extensions: 2268640
Number of successful extensions: 7343
Number of sequences better than 10.0: 50
Number of HSP's gapped: 7573
Number of HSP's successfully gapped: 50
Length of query: 398
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 286
Effective length of database: 40,638,807
Effective search space: 11622698802
Effective search space used: 11622698802
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)