Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0C06314g8.853ON98398352770.0
SAKL0D01078g8.853ON93694019400.0
AFR448W8.853ON81782218110.0
YMR287C (DSS1)8.853ON96994516740.0
ZYRO0C14938g8.853ON96694316300.0
TDEL0B002208.853ON93597716250.0
Smik_13.5038.853ON96995516200.0
Suva_13.4778.853ON96995015960.0
Skud_13.4608.853ON96994115930.0
KNAG0E011408.853ON92995915340.0
CAGL0M07051g8.853ON92392815240.0
KLTH0C03674g8.853ON94891115070.0
Kwal_27.102138.853ON93693615020.0
KAFR0L019708.853ON93297214740.0
NCAS0C003008.853ON94092214151e-180
Kpol_237.48.853ON91691913811e-175
NDAI0K003208.853ON96294413811e-175
TPHA0I003508.853ON94393713091e-164
TBLA0B029208.853ON1029102112201e-150
CAGL0H04411g1.367ON10074061631e-10
KLLA0A10835g1.367ON10084731585e-10
KAFR0C045301.367ON10003591513e-09
Ecym_27151.367ON9883501513e-09
TDEL0D023801.367ON9973591461e-08
SAKL0D10186g1.367ON9884061462e-08
KLTH0H13420g1.367ON9863751433e-08
TBLA0D050701.367ON9974611424e-08
KNAG0C019501.367ON9963611381e-07
NDAI0H035601.367ON10123611362e-07
AEL031C1.367ON9973611353e-07
YOL021C (DIS3)1.367ON10014921326e-07
TPHA0A023201.367ON10153591326e-07
ZYRO0G01166g1.367ON9933601327e-07
Kpol_1043.421.367ON9883641301e-06
NCAS0D005901.367ON9983591282e-06
Smik_15.1451.367ON10014921282e-06
Skud_15.1371.367ON10304541263e-06
Suva_15.1471.367ON10014941264e-06
Kwal_34.162451.367ON9863501211e-05
NDAI0C040505.307ON1260364950.014
Suva_2.4595.307ON1258334920.040
TBLA0C012201.366ON751162880.095
YDR293C (SSD1)5.307ON1250331880.10
Smik_4.5425.307ON1251331840.35
TDEL0E032005.307ON1257433800.88
NDAI0A025907.234ON1158153772.1
Skud_4.5555.307ON1252333762.6
KLLA0E12673g5.342ON26663743.1
ZYRO0G16852g5.307ON1273370728.4
SAKL0G08228g5.377ON71776718.4
TBLA0A028705.307ON1313323728.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C06314g
         (983 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C06314g Chr3 complement(556468..559419) [2952 bp, 983 aa] {...  2037   0.0  
SAKL0D01078g Chr4 (78360..81170) [2811 bp, 936 aa] {ON} similar ...   751   0.0  
AFR448W Chr6 (1244187..1246640) [2454 bp, 817 aa] {ON} Syntenic ...   702   0.0  
YMR287C Chr13 complement(842436..845345) [2910 bp, 969 aa] {ON} ...   649   0.0  
ZYRO0C14938g Chr3 complement(1159657..1162557) [2901 bp, 966 aa]...   632   0.0  
TDEL0B00220 Chr2 complement(40373..43180) [2808 bp, 935 aa] {ON}...   630   0.0  
Smik_13.503 Chr13 complement(825111..828020) [2910 bp, 969 aa] {...   628   0.0  
Suva_13.477 Chr13 complement(824387..827296) [2910 bp, 969 aa] {...   619   0.0  
Skud_13.460 Chr13 complement(815990..818899) [2910 bp, 969 aa] {...   618   0.0  
KNAG0E01140 Chr5 complement(222456..225245) [2790 bp, 929 aa] {O...   595   0.0  
CAGL0M07051g Chr13 complement(716775..719546) [2772 bp, 923 aa] ...   591   0.0  
KLTH0C03674g Chr3 complement(317119..319965) [2847 bp, 948 aa] {...   585   0.0  
Kwal_27.10213 s27 complement(243200..246010) [2811 bp, 936 aa] {...   583   0.0  
KAFR0L01970 Chr12 complement(372452..375250) [2799 bp, 932 aa] {...   572   0.0  
NCAS0C00300 Chr3 (39415..42237) [2823 bp, 940 aa] {ON} Anc_8.853...   549   e-180
Kpol_237.4 s237 complement(4514..7264) [2751 bp, 916 aa] {ON} co...   536   e-175
NDAI0K00320 Chr11 (60516..63404) [2889 bp, 962 aa] {ON} Anc_8.85...   536   e-175
TPHA0I00350 Chr9 complement(65929..68760) [2832 bp, 943 aa] {ON}...   508   e-164
TBLA0B02920 Chr2 complement(671467..674556) [3090 bp, 1029 aa] {...   474   e-150
CAGL0H04411g Chr8 complement(415101..418124) [3024 bp, 1007 aa] ...    67   1e-10
KLLA0A10835g Chr1 (938712..941738) [3027 bp, 1008 aa] {ON} highl...    65   5e-10
KAFR0C04530 Chr3 (904255..907257) [3003 bp, 1000 aa] {ON} Anc_1....    63   3e-09
Ecym_2715 Chr2 complement(1383023..1385989) [2967 bp, 988 aa] {O...    63   3e-09
TDEL0D02380 Chr4 complement(463000..465993) [2994 bp, 997 aa] {O...    61   1e-08
SAKL0D10186g Chr4 (852303..855269) [2967 bp, 988 aa] {ON} highly...    61   2e-08
KLTH0H13420g Chr8 (1172833..1175793) [2961 bp, 986 aa] {ON} high...    60   3e-08
TBLA0D05070 Chr4 (1255978..1258971) [2994 bp, 997 aa] {ON} Anc_1...    59   4e-08
KNAG0C01950 Chr3 (377736..380726) [2991 bp, 996 aa] {ON} Anc_1.3...    58   1e-07
NDAI0H03560 Chr8 (869622..872660) [3039 bp, 1012 aa] {ON} Anc_1....    57   2e-07
AEL031C Chr5 complement(574534..577527) [2994 bp, 997 aa] {ON} S...    57   3e-07
YOL021C Chr15 complement(282421..285426) [3006 bp, 1001 aa] {ON}...    55   6e-07
TPHA0A02320 Chr1 complement(485855..488902) [3048 bp, 1015 aa] {...    55   6e-07
ZYRO0G01166g Chr7 complement(91672..94653) [2982 bp, 993 aa] {ON...    55   7e-07
Kpol_1043.42 s1043 (83527..86493) [2967 bp, 988 aa] {ON} (83527....    55   1e-06
NCAS0D00590 Chr4 complement(98734..101730) [2997 bp, 998 aa] {ON...    54   2e-06
Smik_15.145 Chr15 complement(248837..251842) [3006 bp, 1001 aa] ...    54   2e-06
Skud_15.137 Chr15 complement(241849..244941) [3093 bp, 1030 aa] ...    53   3e-06
Suva_15.147 Chr15 complement(255214..258219) [3006 bp, 1001 aa] ...    53   4e-06
Kwal_34.16245 s34 complement(260089..263049) [2961 bp, 986 aa] {...    51   1e-05
NDAI0C04050 Chr3 complement(921707..925489) [3783 bp, 1260 aa] {...    41   0.014
Suva_2.459 Chr2 complement(810378..814154) [3777 bp, 1258 aa] {O...    40   0.040
TBLA0C01220 Chr3 complement(263093..265348) [2256 bp, 751 aa] {O...    39   0.095
YDR293C Chr4 complement(1045640..1049392) [3753 bp, 1250 aa] {ON...    39   0.10 
Smik_4.542 Chr4 complement(977225..980980) [3756 bp, 1251 aa] {O...    37   0.35 
TDEL0E03200 Chr5 (603078..606851) [3774 bp, 1257 aa] {ON} Anc_5....    35   0.88 
NDAI0A02590 Chr1 (576657..580133) [3477 bp, 1158 aa] {ON} Anc_7....    34   2.1  
Skud_4.555 Chr4 complement(988201..991959) [3759 bp, 1252 aa] {O...    34   2.6  
KLLA0E12673g Chr5 complement(1126397..1127197) [801 bp, 266 aa] ...    33   3.1  
ZYRO0G16852g Chr7 complement(1381740..1385561) [3822 bp, 1273 aa...    32   8.4  
SAKL0G08228g Chr7 complement(700095..702248) [2154 bp, 717 aa] {...    32   8.4  
TBLA0A02870 Chr1 complement(688551..692492) [3942 bp, 1313 aa] {...    32   8.5  

>KLLA0C06314g Chr3 complement(556468..559419) [2952 bp, 983 aa] {ON}
           similar to uniprot|P39112 Saccharomyces cerevisiae
           YMR287C MSU1 RNase component of the mitochondrial
           degradosome along with the ATP-dependent RNA helicase
           Suv3p the degradosome associates with the ribosome and
           mediates turnover of aberrant or unprocessed RNAs
          Length = 983

 Score = 2037 bits (5277), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 983/983 (100%), Positives = 983/983 (100%)

Query: 1   MSSVFSIRRPRVAARFLAHRRYMHSGVPLFQARQSDTSGTNVTTESLQEDEEVIFFSQDK 60
           MSSVFSIRRPRVAARFLAHRRYMHSGVPLFQARQSDTSGTNVTTESLQEDEEVIFFSQDK
Sbjct: 1   MSSVFSIRRPRVAARFLAHRRYMHSGVPLFQARQSDTSGTNVTTESLQEDEEVIFFSQDK 60

Query: 61  DILPEVEIKPFRRTKAETLMRFNDRFVQPSIDWYRKVGKSHGENTDKDEFMHLLRNDISS 120
           DILPEVEIKPFRRTKAETLMRFNDRFVQPSIDWYRKVGKSHGENTDKDEFMHLLRNDISS
Sbjct: 61  DILPEVEIKPFRRTKAETLMRFNDRFVQPSIDWYRKVGKSHGENTDKDEFMHLLRNDISS 120

Query: 121 STLFEETLKWLSKDNYKLRNNTYNGYDTQEIEFYFDPSAIVSSTLMPGDICVLKNSPFEL 180
           STLFEETLKWLSKDNYKLRNNTYNGYDTQEIEFYFDPSAIVSSTLMPGDICVLKNSPFEL
Sbjct: 121 STLFEETLKWLSKDNYKLRNNTYNGYDTQEIEFYFDPSAIVSSTLMPGDICVLKNSPFEL 180

Query: 181 LVCVKTPSEAMDARFTFANTDGNVVYAWKTSVHLRFPTIFNTTELEILQREKLHGYSPVG 240
           LVCVKTPSEAMDARFTFANTDGNVVYAWKTSVHLRFPTIFNTTELEILQREKLHGYSPVG
Sbjct: 181 LVCVKTPSEAMDARFTFANTDGNVVYAWKTSVHLRFPTIFNTTELEILQREKLHGYSPVG 240

Query: 241 SVKNDKDVTFVIPTLPRRMLISNVTFRIADAAVQQLPIIKKKLELIHRYLQSGSSPWQIP 300
           SVKNDKDVTFVIPTLPRRMLISNVTFRIADAAVQQLPIIKKKLELIHRYLQSGSSPWQIP
Sbjct: 241 SVKNDKDVTFVIPTLPRRMLISNVTFRIADAAVQQLPIIKKKLELIHRYLQSGSSPWQIP 300

Query: 301 ILKLVEICSNLELSNNIEKSIATAFMKSGLSSDALYSLANSHFELSSKVPNKVECSRLLA 360
           ILKLVEICSNLELSNNIEKSIATAFMKSGLSSDALYSLANSHFELSSKVPNKVECSRLLA
Sbjct: 301 ILKLVEICSNLELSNNIEKSIATAFMKSGLSSDALYSLANSHFELSSKVPNKVECSRLLA 360

Query: 361 VYWALLHQQGTQMWGEMTVHRGIFFPSAVTVLPLTKQHLHYHNIIHKLRQHGGVRINRIA 420
           VYWALLHQQGTQMWGEMTVHRGIFFPSAVTVLPLTKQHLHYHNIIHKLRQHGGVRINRIA
Sbjct: 361 VYWALLHQQGTQMWGEMTVHRGIFFPSAVTVLPLTKQHLHYHNIIHKLRQHGGVRINRIA 420

Query: 421 ALINENDLASLNKSFPYIVPLLRDYAAGNLEHNDTITSLISSLFRKLDEYKELNISRDVC 480
           ALINENDLASLNKSFPYIVPLLRDYAAGNLEHNDTITSLISSLFRKLDEYKELNISRDVC
Sbjct: 421 ALINENDLASLNKSFPYIVPLLRDYAAGNLEHNDTITSLISSLFRKLDEYKELNISRDVC 480

Query: 481 FDLLKRINPSEPPNPLLINHELQLPVNNERVKLEQKIYDLAVPPKIEHSAEIRTEYKDLI 540
           FDLLKRINPSEPPNPLLINHELQLPVNNERVKLEQKIYDLAVPPKIEHSAEIRTEYKDLI
Sbjct: 481 FDLLKRINPSEPPNPLLINHELQLPVNNERVKLEQKIYDLAVPPKIEHSAEIRTEYKDLI 540

Query: 541 CYCIDSPDAHEIDDAVSIKSLGGAKYRIYIHVADPASLFPEANEDGTTINSPVLDIAYQR 600
           CYCIDSPDAHEIDDAVSIKSLGGAKYRIYIHVADPASLFPEANEDGTTINSPVLDIAYQR
Sbjct: 541 CYCIDSPDAHEIDDAVSIKSLGGAKYRIYIHVADPASLFPEANEDGTTINSPVLDIAYQR 600

Query: 601 AFTTYLPDKVFPMLPTTYARSSDLGQFGKPTKAVTFSVDCTFSKSKGLCLLKDSLKVELS 660
           AFTTYLPDKVFPMLPTTYARSSDLGQFGKPTKAVTFSVDCTFSKSKGLCLLKDSLKVELS
Sbjct: 601 AFTTYLPDKVFPMLPTTYARSSDLGQFGKPTKAVTFSVDCTFSKSKGLCLLKDSLKVELS 660

Query: 661 VLHKSTRITYEAVDELLDEPTTKPKSGKHEDLKTLFYIAKALRRQRIVDGGAVVFENSST 720
           VLHKSTRITYEAVDELLDEPTTKPKSGKHEDLKTLFYIAKALRRQRIVDGGAVVFENSST
Sbjct: 661 VLHKSTRITYEAVDELLDEPTTKPKSGKHEDLKTLFYIAKALRRQRIVDGGAVVFENSST 720

Query: 721 GIVSLSPDDNSELVEVSFKDQIETKSTILVSELMILANSLTASYFEENQIPGIYRGYRPL 780
           GIVSLSPDDNSELVEVSFKDQIETKSTILVSELMILANSLTASYFEENQIPGIYRGYRPL
Sbjct: 721 GIVSLSPDDNSELVEVSFKDQIETKSTILVSELMILANSLTASYFEENQIPGIYRGYRPL 780

Query: 781 NVVEDATSVPEWVKAKTQENKIISKADIAKMKSFLTSSFYSSLPTPHDMLGTSHYLTITS 840
           NVVEDATSVPEWVKAKTQENKIISKADIAKMKSFLTSSFYSSLPTPHDMLGTSHYLTITS
Sbjct: 781 NVVEDATSVPEWVKAKTQENKIISKADIAKMKSFLTSSFYSSLPTPHDMLGTSHYLTITS 840

Query: 841 PLRRFPDLVNHLQLHRTLKGLPLLYKQSQLDGMVWHILTRDVTLKNASVDAQRYWTLRFL 900
           PLRRFPDLVNHLQLHRTLKGLPLLYKQSQLDGMVWHILTRDVTLKNASVDAQRYWTLRFL
Sbjct: 841 PLRRFPDLVNHLQLHRTLKGLPLLYKQSQLDGMVWHILTRDVTLKNASVDAQRYWTLRFL 900

Query: 901 KKEIEDPTKNNWKLQITSLTDNGYAHCVILDKAFAVGQLKINLNKNPPLVGDQISDCEIS 960
           KKEIEDPTKNNWKLQITSLTDNGYAHCVILDKAFAVGQLKINLNKNPPLVGDQISDCEIS
Sbjct: 901 KKEIEDPTKNNWKLQITSLTDNGYAHCVILDKAFAVGQLKINLNKNPPLVGDQISDCEIS 960

Query: 961 NIQCLDGILQFEPTSRSKIQKKK 983
           NIQCLDGILQFEPTSRSKIQKKK
Sbjct: 961 NIQCLDGILQFEPTSRSKIQKKK 983

>SAKL0D01078g Chr4 (78360..81170) [2811 bp, 936 aa] {ON} similar to
           uniprot|P39112 Saccharomyces cerevisiae YMR287C MSU1
           RNase component of the mitochondrial degradosome along
           with the ATP-dependent RNA helicase Suv3p the
           degradosome associates with the ribosome and mediates
           turnover of aberrant or unprocessed RNAs
          Length = 936

 Score =  751 bits (1940), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/940 (40%), Positives = 580/940 (61%), Gaps = 46/940 (4%)

Query: 48  QEDEEVIFFSQDKDILPEVEIKPFRRTKAETLMRFNDRFVQPSIDWY-RKVGKSHGENTD 106
           +++ E IFFS  KD+ PEVEIK   + + ++  R+  R+  PS  W+ + V ++      
Sbjct: 24  KDNLEKIFFSHAKDLEPEVEIKQLSQVRQDSDNRYYHRYFTPSKIWFTQNVSRTQS---- 79

Query: 107 KDEFMHLLRNDISSSTLFEETLKWLSKDNYKLRNNTYNGYDTQEIEFYFDPSAIVSSTLM 166
              F H    D   S+           D Y L       YD     FY  PS ++++ L 
Sbjct: 80  ---FKHFFNLDPQRSS-----------DKYILPTLNERLYDKGSHTFYLSPSDLMNTPLK 125

Query: 167 PGDICVLKNSPFELLVCVKTPSEAMDARFTFANTDGNVVYAWKTSVHLRFPTIFNTTELE 226
            GD+ +L+++P +L +CV  P++ MD R+TFA+ DG + +A +T + LR P+        
Sbjct: 126 IGDLVLLRSNPTQLSMCVDLPTDIMDPRYTFASMDGGLQFAARTMIMLRIPSCHKQELDG 185

Query: 227 ILQREKLHGYSPVGSVKNDKDVTFVIPTLPRRMLISNVTFRIADAAVQQLPIIKKKLELI 286
           ++Q E+ H Y P+G VKN    T+V+P L R+++ S V F I   A  Q+PI+ KKLEL+
Sbjct: 186 LVQLERKHSYEPIGVVKNSPTHTYVLPILARQLITSYVPFEITKKAWNQVPIVSKKLELL 245

Query: 287 HRYLQSGSSPWQIPILKLVEICSNLELSNNIEKS-------IATAFMKSGLSSDALYSLA 339
           HR+LQ  + PWQI I  L E+  NL+L   + K        +++ F K GL S+ LY L 
Sbjct: 246 HRFLQRSTGPWQISIFTLCELVQNLDLQRALSKQDGSLQDYMSSLFQKVGLDSN-LYCLG 304

Query: 340 NSHFELSSKVPNKVECSRLLAVYWALLHQQGTQMWGEMTVHRGIFFPSAVTVLPLTKQHL 399
             +  ++   PNK++ S  L+ YW+L+ QQ  Q+WG +  HRGI  P +VTVLPL  +HL
Sbjct: 305 EQNLHVNP--PNKIDASYFLSTYWSLVKQQELQIWGGIQTHRGILTPISVTVLPLNSEHL 362

Query: 400 HYHNIIHKLRQHGGVRINRIAALINENDLASLNKSFPYIVPLLRDYAAGNLEHNDTITSL 459
           +Y N++  L+Q     ++  A L+N+ +   +   FP ++ +L++YAAGN  +N  + +L
Sbjct: 363 YYENVVSTLKQDNYRMLDEFAELVNKKNYKPIQNRFPQLIQILKNYAAGNFNNNGAMITL 422

Query: 460 ISSLFRKLDEYKELNISRDVCFDLLKRINPSEPPNPLLINHELQLPVNNERVKLEQKIYD 519
           +S +FRKL  YKE + +RD+C +LL +I+P +  NPLL+N +L LP+ ++R  LEQ +YD
Sbjct: 423 VSKIFRKLHTYKERDTTRDMCHELLTQISPDKLINPLLLNKDLGLPMASQRSALEQVVYD 482

Query: 520 LAVPPKIEHSAEIRTEYKDLICYCIDSPDAHEIDDAVSIKSLGGAKYRIYIHVADPASLF 579
           ++ PP  E  + +R ++ D+  YCIDS  AHEIDD +SI++L   KYR++IH+ADPAS F
Sbjct: 483 ISKPPLTEDDSYVRHDFGDMPVYCIDSETAHEIDDGISIETLSEKKYRLHIHIADPASSF 542

Query: 580 -----PEANEDGTTINSPVLDIAYQRAFTTYLPDKVFPMLPTTYARSSDLGQFGKPTKAV 634
                PEA +D       VLDIA+QR+FTTYLPD V PMLP +Y R++DLG+ G  TK +
Sbjct: 543 AKSTDPEARDD-------VLDIAFQRSFTTYLPDMVLPMLPESYCRAADLGKDGNKTKTL 595

Query: 635 TFSVDCTFSKSKGLCLLKDSLKVELSVLHKSTRITYEAVDELLDEPTTKPKSGKHEDLKT 694
           +FS+D  F +   L LL D+ K+ L ++ +  R+TYE VD LL  P  +PK     DLK 
Sbjct: 596 SFSIDIYFHQGT-LRLLDDTFKMRLGLVSRFPRVTYEKVDILLQYPEKQPKEA--SDLKL 652

Query: 695 LFYIAKALRRQRIVDGGAVVF-ENSSTGIVSLSPDDNSELVEVSFKDQIETKSTILVSEL 753
           ++ +AK+LR +R+ +  A++F E  + G+V LSPD+  EL ++SF+DQ+E+KST+LVSE+
Sbjct: 653 MYEVAKSLRAKRVKNQDAIIFGEGFNKGLVKLSPDETGELTKISFEDQVESKSTVLVSEM 712

Query: 754 MILANSLTASYFEENQIPGIYRGYRPLNVVEDATSVPEWVKAKTQENKIISKADIAKMKS 813
           MILAN+LT  YF++N+IPG++R Y  L + + A      +K  T+  +  +  DI  + S
Sbjct: 713 MILANTLTGGYFKKNKIPGVFRCYNELQLKDRALKEYTKMKEMTKSGQFPTIRDINTISS 772

Query: 814 FLTSSFYSSLPTPHDMLGTSHYLTITSPLRRFPDLVNHLQLHRTLKGLPLLYKQSQLDGM 873
            L SSFY+  P  H+M+G S YLT+TSPLRRFPD++NHLQ+HR L+GLPL + Q ++DG+
Sbjct: 773 LLNSSFYTGKPKKHEMIGASEYLTVTSPLRRFPDMINHLQIHRHLRGLPLCFSQQEVDGI 832

Query: 874 VWHILTRDVTLKNASVDAQRYWTLRFLKKEIEDPTKNNWKLQITSLTDNGYAHCVILDKA 933
            WHI +RDV LKNA+  +  YWTL+FLK E+E      + + +TS+   G   C   +  
Sbjct: 833 TWHIQSRDVVLKNAARMSATYWTLKFLKNELEKKKDIRFTVMVTSVPHMGTVSCAFPNLN 892

Query: 934 FAVGQLKINLNKNP-PLVGDQISDCEISNIQCLDGILQFE 972
            A G L ++    P P +GD I  C+++ + CLDG+++ E
Sbjct: 893 AARGTLNLDPKHTPYPAIGDLIHKCKLTKLDCLDGVIELE 932

>AFR448W Chr6 (1244187..1246640) [2454 bp, 817 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR287C (MSU1)
          Length = 817

 Score =  702 bits (1811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/822 (42%), Positives = 518/822 (63%), Gaps = 10/822 (1%)

Query: 157 PSAIVSSTLMPGDICVLKNSPFELLVCVKTPSEAMDARFTFANTDGNVVYAWKTSVHLRF 216
           P  +  +TL  GD+CVL   P +L+VCV+ P++A DAR+ FA  DG V YA K+ V LR 
Sbjct: 3   PGDLAGTTLQIGDLCVLSAVPGKLVVCVEQPTDAADARYAFAGADGAVCYATKSDVRLRV 62

Query: 217 PTIFNTTELEILQREKLHGYSPVGSVKNDKDVTFVIPTLPRRMLISNVTFRIADAAVQQL 276
           P +       +L RE  HGY+PVG+VKN+   T+++P   RR+  +     I+  AV QL
Sbjct: 63  PGLHKRPLRYLLHREADHGYAPVGTVKNNISRTYLLPVAVRRLFAALGVTEISQQAVAQL 122

Query: 277 PIIKKKLELIHRYLQSGSSPWQIPILKLVEICSNLELSNN---IEKSIATAFMKSGLSSD 333
           P +  KLEL+HR+LQS   PWQ+ + KLV++ + LEL N+     + +A    +  +   
Sbjct: 123 PEVVAKLELLHRHLQSHLGPWQLSLFKLVDLVTRLELPNSPGEASEKVAKLLAELNIGQG 182

Query: 334 ALYSLANSHFELSSKVPNKVECSRLLAVYWALLHQQGTQMWGEMTVHRGIFFPSAVTVLP 393
           +  S A+ +  +++  P +V+ +  LA YW +L QQG QMWG+++ HR +F P +VTVLP
Sbjct: 183 SYCSAADINLRMAA--PKQVDIALYLATYWGVLQQQGDQMWGDISYHRALFSPLSVTVLP 240

Query: 394 LTKQHLHYHNIIHKLRQHGGVRINRIAALINENDLASLNKSFPYIVPLLRDYAAGNLEHN 453
           L  Q L Y  ++  +++     ++  A L+N+        ++  ++ LLRDY AGN+  N
Sbjct: 241 LRDQTLFYDYLLRDMKRDDYAALDEFACLVNQGKYKEACSNYKSVLQLLRDYCAGNINSN 300

Query: 454 DTITSLISSLFRKLDEYKELNISRDVCFDLLKRINPSEPPNPLLINHELQLPVNNERVKL 513
             +  L++ LFR+LD YKE  ++R + F LL ++ P  P NPL  NH+L+LP++N R  L
Sbjct: 301 AALIYLVTRLFRRLDAYKEEEVTRTIAFQLLGQLCPETPHNPLHWNHQLELPLSNPRTAL 360

Query: 514 EQKIYDLAVPPKIEHSAEIRTEYKDLICYCIDSPDAHEIDDAVSIKSLGGAKYRIYIHVA 573
           EQK+YDLA PP  +     R E+   +CYCIDSPDAHEIDD VSI+ L G++YR+++H+A
Sbjct: 361 EQKVYDLASPPLDQEEPGPRKEFSG-VCYCIDSPDAHEIDDGVSIERLKGSRYRLHVHIA 419

Query: 574 DPASLFPEANEDGTTINSPVLDIAYQRAFTTYLPDKVFPMLPTTYARSSDLGQFGKPTKA 633
            P SLF ++   G     PV+DIA++RAFTTYLPD VFPM+P +Y R+SDLGQ+ KPTK 
Sbjct: 420 YPYSLFKKSYTPGEVPIDPVMDIAFRRAFTTYLPDLVFPMMPKSYTRASDLGQWDKPTKT 479

Query: 634 VTFSVDCTFSKSKGLCLLKDSLKVELSVLHKSTRITYEAVDELLDEPTTKPKSGKHEDLK 693
           +T SVD   SK K   + + +L++ L     S R+TY+ VD+LL+   +K +  +  DL+
Sbjct: 480 ITISVDVDLSK-KLRVVDEATLQIALGTTRTSKRVTYDYVDDLLE---SKRQDAEASDLR 535

Query: 694 TLFYIAKALRRQRIVDGGAVVFENSSTGIVSLSPDDNSELVEVSFKDQIETKSTILVSEL 753
            L+ +A++LR +R V   A++F +   G++SL+P+++ +L+ V   D   TKS  LVSEL
Sbjct: 536 LLYKVAESLREERKVLKHAIMFGDVQNGLISLTPNEDGKLLNVQLVDSKSTKSNTLVSEL 595

Query: 754 MILANSLTASYFEENQIPGIYRGYRPLNVVEDATSVPEWVKAKTQENKIISKADIAKMKS 813
           MI+ANSL   YF EN IPG+YRG   L +  +A++    ++   ++   +S +D+ K+ +
Sbjct: 596 MIMANSLAGRYFHENTIPGVYRGCTELLLKFEASNQYASLQRAMRQKGSVSSSDLVKVAA 655

Query: 814 FLTSSFYSSLPTPHDMLGTSHYLTITSPLRRFPDLVNHLQLHRTLKGLPLLYKQSQLDGM 873
           FLT+S YSS P  H M+GT  YLTITSPLRR PD++NH+QLHR L+ LP  + Q Q+D +
Sbjct: 656 FLTNSHYSSTPCRHAMVGTEEYLTITSPLRRLPDMINHMQLHRHLRSLPPCFSQEQIDAL 715

Query: 874 VWHILTRDVTLKNASVDAQRYWTLRFLKKEIEDPTKNNWKLQITSLTDNGYAHCVILDKA 933
            WHIL RDV LK+AS  +  +WTL +LK ++       W L +TSL  NG+ HC I    
Sbjct: 716 NWHILARDVALKDASKRSSVFWTLGYLKDQLCAEPDKRWDLVVTSLPLNGFVHCKIPGIF 775

Query: 934 FAVGQLKINLNKNPPLVGDQISDCEISNIQCLDGILQFEPTS 975
           ++ G+LKI    N P VG  +++C I+ +  LDG L+FE  S
Sbjct: 776 YSSGKLKIPSGANNPAVGSTVANCFITRLDSLDGTLRFEMKS 817

>YMR287C Chr13 complement(842436..845345) [2910 bp, 969 aa] {ON}
           DSS13'-5' exoribonuclease, component of the
           mitochondrial degradosome along with the ATP-dependent
           RNA helicase Suv3p; the degradosome associates with the
           ribosome and mediates turnover of aberrant or
           unprocessed RNAs
          Length = 969

 Score =  649 bits (1674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/945 (38%), Positives = 553/945 (58%), Gaps = 53/945 (5%)

Query: 39  GTNVTTESLQEDEEVIFFSQDKDILPEVEIKPFRRTKAETLMRFNDRFVQPSIDWYRKVG 98
           G     ES+ +D    F  + K + P++E+K   + K E   R+ DR+V+PS DWY    
Sbjct: 65  GPEKDIESINKD----FLQRTKGLEPDIELKQLPQIKQEFNQRYKDRYVKPSEDWYVNSW 120

Query: 99  KSHGENTDKDEFMHLLRNDISSSTLFEETLKWLSKDNYKLRNNTYNGYDTQEIEFYFDPS 158
           +S            L +  I    L     + ++K   K  N              F P 
Sbjct: 121 RS------------LTKPKIPLYKLINSDFQLITK--LKAPN-----------PMEFQPV 155

Query: 159 AIVSSTLMPGDICVLKNSPFELLVCVKTPSEAMDARFTFANTDGNVVYAWKTSVHLRFPT 218
            ++ S L  GD  +LK  P EL +CV  PS  MD R+TF   DG + +A K  V LR P 
Sbjct: 156 QLMESPLNVGDFVLLKMRPNELAMCVSLPSSTMDPRYTFVTIDGTMCFATKNRVLLRIPH 215

Query: 219 IFNTTELEILQREKLHGYSPVGSVKNDKDVTFVIPTLPRRMLISNVTFRIADAAVQQLPI 278
                   ++Q E  H + P+G+VKN  + T ++P + R+++ S    +I+  A + LPI
Sbjct: 216 KLPAGIHSLIQPESHHKHLPIGTVKNFSNQTNILPIVARQLITSRYPAQISKLAWKDLPI 275

Query: 279 IKKKLELIHRYLQSGSSPWQIPILKLVEICSNLELSNNIEKSIATAFMKSGLSSDALYSL 338
             KKL+L+HR LQ+   PWQIP   LV +   L+L+  ++        K+G+  + L SL
Sbjct: 276 TTKKLQLLHRSLQNYMGPWQIPFFTLVGLVQKLDLNKALDD-------KNGI--NYLTSL 326

Query: 339 ANSHFELSSKVPNKVECSRLLAVYWALLHQQGTQMWGEMTVHRGIFFPSAVTVLPLTKQH 398
            N++  ++  +P  +     ++ YWA++ QQ + +WGE+ ++  +  P +VT++PL  QH
Sbjct: 327 VNNYHTVND-IP--INSPTFVSTYWAIMQQQESNLWGEIHLNTALLSPISVTIIPLKSQH 383

Query: 399 LHYHNIIHKLRQHGGVRINRIAALINENDLASLNKSFPYIVPLLRDYAAGNLEHNDTITS 458
           L+Y  +I KL  +    +N+   L+NE     ++  +P ++ LL+D+AAGN  +N  I +
Sbjct: 384 LYYAQVIEKLEANSYREVNKFVKLVNERKYRDISALYPSVIQLLKDFAAGNFHNNGIIVA 443

Query: 459 LISSLFRKLDEYKELNISRDVCFDLLKRINPSEPPNPLLINHELQLPVNNERVKLEQKIY 518
           LIS +FRK++ YK+ +I+RD+C DL+  I P+  PNPLL+N +L LP +++ VK +QK+Y
Sbjct: 444 LISKIFRKIERYKDCDITRDICQDLINEITPNSIPNPLLLNMDLALPASSKLVKWQQKLY 503

Query: 519 DLA----VPPKIEHSAEIRTEYKDLICYCIDSPDAHEIDDAVSIKSLG-GAKYRIYIHVA 573
           DL     +  K   + + R ++ DL  +CIDS  AHEIDD VS+K+ G    Y +YIH+A
Sbjct: 504 DLTNIEELQWKKSGTDDDRYDFGDLRVFCIDSETAHEIDDGVSVKNYGRDGLYTLYIHIA 563

Query: 574 DPASLFPEA-NEDGTTINSPVLDIAYQRAFTTYLPDKVFPMLPTTYARSSDLGQFGKPTK 632
           DP S+FPE+ N D   I++ +L++A +R+FTTYLPD V PMLP +    SDLG+ G+ TK
Sbjct: 564 DPTSMFPESTNVDIEGISTDILNVALKRSFTTYLPDTVVPMLPQSICHLSDLGKQGQRTK 623

Query: 633 AVTFSVDCTFS---KSKGLCLLKDSLKVELSVLHKSTRITYEAVDELLDEPTTKPKSGKH 689
            ++FSVD   +     K + ++ DS K+   ++    + TYE VD +L  P ++    K 
Sbjct: 624 TISFSVDVKITSKCSGKSIEIMYDSFKIRKGIVSNFPKATYEDVDRILGTPNSEASPVK- 682

Query: 690 EDLKTLFYIAKALRRQRIVDGGAVVF-ENSSTGIVSLSPDDNSELVEVSFKDQIETKSTI 748
           +DL++L  I+K LR QRI +  AV+F E  + G+V L+ D   EL EV+F DQ ET STI
Sbjct: 683 KDLESLSMISKLLREQRIKNSNAVIFGEGFNKGLVMLNADSEGELTEVTFSDQEETLSTI 742

Query: 749 LVSELMILANSLTASYFEENQIPGIYRGYRPLNVVEDATSVPEWVKAKTQENKIISKADI 808
           LVSE+MILAN+LT  YF EN+I G++R Y+ L + E A    + +   T++       DI
Sbjct: 743 LVSEMMILANTLTGRYFAENKIGGVFRCYKQLPLGEVAQQQYDSMITSTKKGIFPKLKDI 802

Query: 809 AKMKSFLTSSFYSSLPTPHDMLGTSHYLTITSPLRRFPDLVNHLQLHRTLKGLPLLYKQS 868
            K+ S L SSFY+  P  H+M+G   YLT+TSPLRRFPDL+NHLQ+HR L+  PL + Q+
Sbjct: 803 VKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRRFPDLINHLQIHRHLQKKPLCFNQT 862

Query: 869 QLDGMVWHILTRDVTLKNASVDAQRYWTLRFLKKEIEDPTKNNWKLQITSLTDNGYAHCV 928
           Q+D ++W I +R   LK AS ++  YWTL +LKK  +   +  + + +TS+  NG+  CV
Sbjct: 863 QIDSLIWPIQSRADILKRASRNSSTYWTLNYLKKLTKLEPERTFDVMVTSVPQNGFTGCV 922

Query: 929 ILDKAFAVGQLKINLNK-NPPLVGDQISDCEISNIQCLDGILQFE 972
             D +FA G LK++ +  + P++GD + +C+IS I CL+G+L+ E
Sbjct: 923 FPDLSFARGTLKLHPSSMHYPMIGDIVKNCKISKIDCLEGMLELE 967

>ZYRO0C14938g Chr3 complement(1159657..1162557) [2901 bp, 966 aa]
           {ON} similar to uniprot|P39112 Saccharomyces cerevisiae
           YMR287C MSU1 RNase component of the mitochondrial
           degradosome along with the ATP-dependent RNA helicase
           Suv3p the degradosome associates with the ribosome and
           mediates turnover of aberrant or unprocessed RNAs
          Length = 966

 Score =  632 bits (1630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/943 (36%), Positives = 549/943 (58%), Gaps = 65/943 (6%)

Query: 48  QEDEEVI---FFSQDKDILPEVEIKPFRRTKAETLMRFNDRFVQPSIDWYRK-----VGK 99
           QED + I   F S+ KD+ P VE+K   R K E   R+  R++ P   W+++     +GK
Sbjct: 70  QEDIDRINYMFLSRTKDLEPGVEVKDLNRIKQEFYSRYGARYLNPCNSWFQRSEQNILGK 129

Query: 100 SHGENTDKDEFMHLLRNDISSSTLFEETLKWLSKDNYKLRNNTYNGYDTQEIEFYFDPSA 159
           S                       F  +L     +   ++N  +           FDP  
Sbjct: 130 S-----------------------FSRSLINADPEALGIKNKRF---------LKFDPKE 157

Query: 160 IVSSTLMPGDICVLKNSPFELLVCVKTPSEAMDARFTFANTDGNVVYAWKTSVHLRFPTI 219
           ++S  L  GD+ +LK+   +L +C+  PS   D R+TF   DG ++++ +  V +R P  
Sbjct: 158 LMSRPLQIGDLVLLKHQSPQLCMCIDVPSSTRDPRYTFTTVDGTIIFSTRNKVLMRIP-- 215

Query: 220 FNTTELEILQREKLHGYSPVGSVKNDKDVTFVIPTLPRRMLISNVTFRIADAAVQQLPII 279
            +   + +L +E  HG+ PVG VKN    TF++P +PR+ + S ++ +I+  A +++P  
Sbjct: 216 HHLPNVPLLMKEMKHGFEPVGCVKNTTTETFILPIVPRQQITSPISHQISKRAWEEMPFT 275

Query: 280 KKKLELIHRYLQSGSSPWQIPILKLVEICSNLELSNNIEKSIATAFMKSGLSSDALYSLA 339
            KKLEL+HR+LQ    PWQ+P + LV +   L++      +   A+++  + +       
Sbjct: 276 LKKLELLHRHLQDARGPWQVPFMNLVSMVEKLDMQLASASNTGAAYVEDLIRT------- 328

Query: 340 NSHFELSSKVPNKVECSRLLAVYWALLHQQGTQMWGEMTVHRGIFFPSAVTVLPLTKQHL 399
              FE  +K+ + +     L+VY A+ +QQ + +WG +   R +  P +VTV+PL  QHL
Sbjct: 329 -CTFEPQAKLDSAI----FLSVYCAIENQQQSHLWGNIHSSRALLSPVSVTVMPLRSQHL 383

Query: 400 HYHNIIHKLRQHGGVRINRIAALINENDLASLNKSFPYIVPLLRDYAAGNLEHNDTITSL 459
           ++ +++  L+      +++ A L++          +P IV LL+DYAAGN  ++ T  S+
Sbjct: 384 YHRSVLQNLKVRNYEAVSKFARLVDTGKYNEAIMEYPEIVKLLQDYAAGNFYNDATAISV 443

Query: 460 ISSLFRKLDEYKELNISRDVCFDLLKRINPSEPP-NPLLINHELQLPVNNERVKLEQKIY 518
           +S +FRK+  ++E +I+RD+C  LLK ++ S+   NPL  N +L LP ++ R   EQ IY
Sbjct: 444 VSKIFRKIQRFQEEDITRDICHQLLKELDSSQTTRNPLHYNLDLGLPSSSLRSSSEQDIY 503

Query: 519 DLAVPPKIE-HSAEIRTEYKDLICYCIDSPDAHEIDDAVSIKSLGGAKYRIYIHVADPAS 577
           +LA P   E     +R ++ D+  YCIDS  AHEIDD VSI+S    K  ++IH+ADPAS
Sbjct: 504 NLAHPVTFEGQDKNLRHDFGDMKVYCIDSETAHEIDDGVSIESHSDVKRTLHIHIADPAS 563

Query: 578 LFPEANEDGTTINSPVLDIAYQRAFTTYLPDKVFPMLPTTYARSSDLGQFGKPTKAVTFS 637
            F E  E    I S +L IA  ++FTTYLPD + PMLP +Y++++DLG+ G+  K +TFS
Sbjct: 564 FFRECQEGTHGIESEILQIALNKSFTTYLPDLMSPMLPGSYSKAADLGKQGQKAKTITFS 623

Query: 638 VDCTFSKSKGLCLLKDSLKVELSVLHKSTRITYEAVDELLDEPTTKPKSGK------HED 691
           VD ++ K+    L  +S +++L ++    ++TY  VD +L +  ++ K+G         +
Sbjct: 624 VDGSWIKNGQFQLQPESFRIKLGLVSNFPQVTYNTVDSMLAQ-ASEVKNGSANLTDDQRN 682

Query: 692 LKTLFYIAKALRRQRIVDGGAVVFENS-STGIVSLSPDDNSELVEVSFKDQIETKSTILV 750
           LK L+ I++ LR  RI    AVVF +  + G V+LSPD+N  L +VSFKDQ+ET S++LV
Sbjct: 683 LKELYAISQNLRANRINTQQAVVFGSEFNKGQVALSPDENGVLQKVSFKDQLETPSSVLV 742

Query: 751 SELMILANSLTASYFEENQIPGIYRGYRPLNVVEDATSVPEWVKAKTQENKIISKADIAK 810
           SE+MILAN+L+  +F++N +PG++R Y+PL +   A +  E +K+K +E K ++  DI  
Sbjct: 743 SEMMILANTLSGQFFKDNNLPGVFRCYQPLALGPQAQNEYELLKSKIKEGKSLTFKDICM 802

Query: 811 MKSFLTSSFYSSLPTPHDMLGTSHYLTITSPLRRFPDLVNHLQLHRTLKGLPLLYKQSQL 870
           + + L SSFYSS    H+M+G  HYLT+TSPLRRFPD++NHLQ+HR LKGLPL + +  +
Sbjct: 803 ISTILNSSFYSSDGYRHEMIGAPHYLTVTSPLRRFPDMINHLQIHRLLKGLPLCFNKDDV 862

Query: 871 DGMVWHILTRDVTLKNASVDAQRYWTLRFLKKEIEDPTKNNWKLQITSLTDNGYAHCVIL 930
           D  VWHI +RD  LK+AS  +  YWTL++LK+ +E+     + + I S+   G+  CV+ 
Sbjct: 863 DRFVWHIQSRDSILKDASRCSNTYWTLKYLKQLVENDKNKKFSVMINSVPQVGFVRCVLP 922

Query: 931 DKAFAVGQLKINLNK-NPPLVGDQISDCEISNIQCLDGILQFE 972
           D + A   LK+  N+ + P++GD I +C I+ I  L+G+L+ E
Sbjct: 923 DYSSARATLKLKPNEISHPVIGDIIENCRITKIDALEGLLEME 965

>TDEL0B00220 Chr2 complement(40373..43180) [2808 bp, 935 aa] {ON}
           Anc_8.853 YMR287C
          Length = 935

 Score =  630 bits (1625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/977 (37%), Positives = 541/977 (55%), Gaps = 79/977 (8%)

Query: 8   RRPRVAARFLAHRRYMHSGVPLFQARQSDTSGTNVTTESLQEDEEVIFFSQDKDILPEVE 67
           RRPR     L +   +   VP+ Q   ++ S  ++   +LQ      F S+ KD+ P +E
Sbjct: 25  RRPR-----LPNEELVIPAVPVEQ-ESAELSPEDIERINLQ------FLSRTKDLEPGME 72

Query: 68  IKPFRRTKAETLMRFNDRFVQPSIDWYRKVGKSHGENTDKDEFMHLLRNDISSSTLFEET 127
           +K   +   E   RF+ R+ +PS  W+ K                               
Sbjct: 73  VKQLPQIGREFRDRFDARYYEPSKIWFEK------------------------------- 101

Query: 128 LKWLSKDNY--KLRNNTYNGYDTQEIEFYFDPSAIVSSTLMPGDICVLKNSPFELLVCVK 185
             WL++  +  K+ N      DT+E+ F +  SA+++  L  GD+ +LK+ P EL +C+ 
Sbjct: 102 -NWLNRTKFSRKMLNAVPRKEDTKEV-FQYKASALMAKPLDVGDLVLLKSHPSELSMCID 159

Query: 186 TPSEAMDARFTFANTDGNVVYAWKTSVHLRFPTIFN---TTELEILQREKLHGYSPVGSV 242
            PS   D R+ F   DG++ +  ++ V +R P       +    +L RE  HG+ P+G++
Sbjct: 160 VPSSTKDPRYCFTTVDGSLKFGSRSLVLMRIPHSLPQELSKMAALLVREAKHGFEPIGTI 219

Query: 243 KNDKDVTFVIPTLPRRMLISNVTFRIADAAVQQLPIIKKKLELIHRYLQSGSSPWQIPIL 302
           KN  + T V+P + R+++ S VT RI+ +A  QLP+  KKLEL+HR LQ  + P  +P  
Sbjct: 220 KNQANETLVLPVIARQLVTSCVTQRISKSAWDQLPVTIKKLELLHRRLQDSTGPVPVPFF 279

Query: 303 KLVEICSNLELSNNIEKSIATAFMKSGLSSDALYSLANSHFELSSKVPNKVECSRLLAVY 362
            LV +  +L+++  I       +++  + +    S +             ++ S  LA Y
Sbjct: 280 DLVMMIQSLDITKAISNRDGEPYIRDVIENSRTGSTST------------IDSSCALATY 327

Query: 363 WALLHQQGTQMWGEMTVHRGIFFPSAVTVLPLTKQHLHYHNIIHKLRQHGGVRINRIAAL 422
           WA+  QQ   ++G++ +   +  P +V +LP   QHL Y  +  +L+ +G   I   + L
Sbjct: 328 WAIEAQQKNHLFGDIQISGALLSPVSVLILPFASQHLFYSELKEQLKSNGQEAIQEFSKL 387

Query: 423 INENDLASLNKSFPYIVPLLRDYAAGNLEHNDTITSLISSLFRKLDEYKELNISRDVCFD 482
            N+     L   FP+I+ +L+ YAAGNL +++ I SLI+++FRK+DE+K+ +I+RD C  
Sbjct: 388 ANKGKYTELTTRFPHIIQVLKGYAAGNLHNDEGIVSLIAAIFRKIDEFKDNDITRDACEK 447

Query: 483 LLKRINPSEP-PNPLLINHELQLPVNNERVKLEQKIYDLAVPPKIEHSAEIRTEYKDLIC 541
           LL R  P     NP+  N  L LP ++ R + +Q++YDL+ P   + S E R ++K L  
Sbjct: 448 LLSRTLPQGTVENPIYANFTLGLPDSSARSRTQQQVYDLSKPASAQ-STENRHDFKHLRV 506

Query: 542 YCIDSPDAHEIDDAVSIKSLGGAKYRIYIHVADPASLFPEA-NEDGTTINSPVLDIAYQR 600
           YCIDS +AHEIDD +SI+  G  KY ++IH+ADPASLFPE+ + + + IN  VL +A +R
Sbjct: 507 YCIDSEEAHEIDDGISIEDCGNGKYTLHIHIADPASLFPESESSEQSGINDEVLKVAAER 566

Query: 601 AFTTYLPDKVFPMLPTTYARSSDLGQFGKPTKAVTFSVDCTFSKSKGLCLLKDSLKVELS 660
            FTTYLPD V PMLP T+    DLG  GK TK +TFSVD    K   + +  DS K+ L 
Sbjct: 567 CFTTYLPDVVSPMLPQTFTTVCDLGHQGKKTKTITFSVD-VLVKDGAIKIFFDSYKIRLG 625

Query: 661 VLHKSTRITYEAVDELLDEPTTKPKSGKHE---DLKTLFYIAKALRRQRIVDGGAVVFEN 717
           ++    ++TYE VD  L EP    K+   E   DLK +  IA+ LR  RI   GA+VF +
Sbjct: 626 LVSNFPKVTYETVDRYLSEP----KNVNEEILYDLKLMHKIAEILREARIQKDGAIVFGS 681

Query: 718 S-STGIVSLSPDDNSELVEVSFKDQIETKSTILVSELMILANSLTASYFEENQIPGIYRG 776
             + G+V++SP D     E+SF DQ E+KST+LVSE MILANSL   +F E +IPGI+R 
Sbjct: 682 GFNQGLVAVSPVDQ----EISFFDQKESKSTLLVSEFMILANSLAGRFFAEKEIPGIFRT 737

Query: 777 YRPLNVVEDATSVPEWVKAKTQENKIISKADIAKMKSFLTSSFYSSLPTPHDMLGTSHYL 836
           Y+PL +   A    E +K   ++  + +  DI  + S L SSFY   PT H M+G S YL
Sbjct: 738 YQPLTLRGQADQEYERMKKSVKKGILPTTKDINMLSSLLNSSFYCEYPTAHAMIGASQYL 797

Query: 837 TITSPLRRFPDLVNHLQLHRTLKGLPLLYKQSQLDGMVWHILTRDVTLKNASVDAQRYWT 896
           T+TSPLRRFPD++NHLQ+HR L+ LPL + +  L  M+WHI  RD  LK AS     YWT
Sbjct: 798 TVTSPLRRFPDIINHLQIHRVLRNLPLCFTEDALSKMLWHIQLRDAALKKASAHQASYWT 857

Query: 897 LRFLKKEIEDPTKNNWKLQITSLTDNGYAHCVILDKAFAVGQLKINLNK-NPPLVGDQIS 955
           L+++K  I D     + + ITS+     A CV+ +   A G LK+  +  N P VGD + 
Sbjct: 858 LKYIKNLIRDTPHQRFDVTITSVPQLNVARCVLANFPSARGVLKLKPSATNIPTVGDTVK 917

Query: 956 DCEISNIQCLDGILQFE 972
            C++S I CLD +L+ E
Sbjct: 918 GCKVSKIDCLDSLLELE 934

>Smik_13.503 Chr13 complement(825111..828020) [2910 bp, 969 aa] {ON}
           YMR287C (REAL)
          Length = 969

 Score =  628 bits (1620), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/955 (37%), Positives = 546/955 (57%), Gaps = 53/955 (5%)

Query: 29  LFQARQSDTSGTNVTTESLQEDEEVIFFSQDKDILPEVEIKPFRRTKAETLMRFNDRFVQ 88
           + ++  + + GT    ES+ +D    F  + K + P++E+K   + K E   R+ DR+++
Sbjct: 55  VIESGANGSVGTEKDIESINKD----FLQRTKGLEPDIELKQLSQIKEEFYQRYKDRYIK 110

Query: 89  PSIDWYRKVGKSHGENTDKDEFMHLLRNDISSSTLFEETLKWLSKDNYKLRNNTYNGYDT 148
           PS  WY    +S  +   K  F  L+ +D+   T              KL+       D 
Sbjct: 111 PSEAWYTNTWRSLTK--PKISFHKLINSDVQLDT--------------KLK-------DL 147

Query: 149 QEIEFYFDPSAIVSSTLMPGDICVLKNSPFELLVCVKTPSEAMDARFTFANTDGNVVYAW 208
             +EF   P+ ++ + L  GD+ +LK  P EL +CV  PS  MD R+TF   DG + +A 
Sbjct: 148 DPMEF--QPAQLMENPLNVGDLVLLKVKPNELAMCVSLPSSTMDPRYTFVAIDGTMCFAT 205

Query: 209 KTSVHLRFPTIFNTTELEILQREKLHGYSPVGSVKNDKDVTFVIPTLPRRMLISNVTFRI 268
           K  V LR P         ++Q E  H + P+G++KN  + T ++P + R+++ S    +I
Sbjct: 206 KNRVLLRIPHKLPVGVNSLIQPEGHHKHLPIGTLKNISNQTNILPIVTRQLITSRYPAQI 265

Query: 269 ADAAVQQLPIIKKKLELIHRYLQSGSSPWQIPILKLVEICSNLELSNNIEKSIATAFMKS 328
           +  A + LPI  KKL+L+HR LQ+   PWQIP   LV +   L+L+  ++        K 
Sbjct: 266 SKLAWKCLPITTKKLQLLHRSLQNYMGPWQIPFFTLVGLVQKLDLNKALDG-------KY 318

Query: 329 GLSSDALYSLANSHFELSSKVPNKVECSRLLAVYWALLHQQGTQMWGEMTVHRGIFFPSA 388
           G+  D L  L N++    +   N       ++ YWA+L QQ + +WGE+ ++  +  P +
Sbjct: 319 GI--DYLTDLVNNYHTADNVAINS---PTFVSTYWAILQQQESNLWGEIHLNTALLSPIS 373

Query: 389 VTVLPLTKQHLHYHNIIHKLRQHGGVRINRIAALINENDLASLNKSFPYIVPLLRDYAAG 448
           VT++PL  QHL+Y  +I KL  +    +N    L+NE     ++  +P ++ LL+D+AAG
Sbjct: 374 VTIVPLKSQHLYYAQVIEKLEANSYKEVNTFVKLVNERKYRDISNLYPSVIQLLKDFAAG 433

Query: 449 NLEHNDTITSLISSLFRKLDEYKELNISRDVCFDLLKRINPSEPPNPLLINHELQLPVNN 508
           N  +N  I +LIS +FRK+  YK+ +I+RDVC DL+  I P+   NPLL+N +L LP ++
Sbjct: 434 NFHNNGIIVTLISKIFRKIVRYKDYDITRDVCQDLINEIVPNSLSNPLLLNMDLALPSSS 493

Query: 509 ERVKLEQKIYDLAVPPKIEH----SAEIRTEYKDLICYCIDSPDAHEIDDAVSIKSLG-G 563
           + ++ +QK+Y L     ++     +   R ++ DL  +CIDS  AHEIDD VS+++ G  
Sbjct: 494 KLMESQQKLYYLTNIEDLQRENSGNDSDRYDFGDLRVFCIDSDTAHEIDDGVSVENHGKD 553

Query: 564 AKYRIYIHVADPASLFPEANE-DGTTINSPVLDIAYQRAFTTYLPDKVFPMLPTTYARSS 622
             Y ++IH+ADP S+FPE+   D   I++ +L+IA++R+FTTYLPD V PMLP      S
Sbjct: 554 GMYTLHIHIADPTSMFPESTAIDSVGISTDILNIAFKRSFTTYLPDVVVPMLPQAICHLS 613

Query: 623 DLGQFGKPTKAVTFSVDCTFSK---SKGLCLLKDSLKVELSVLHKSTRITYEAVDELLDE 679
           DLG+ GK TK ++FSVD         K L ++ DS ++    +    + TY+ VD++L  
Sbjct: 614 DLGKHGKRTKTISFSVDVKVGYQGCGKSLEIMYDSFRIRKGFVSNFPKATYDDVDKILSA 673

Query: 680 PTTKPKSGKHEDLKTLFYIAKALRRQRIVDGGAVVF-ENSSTGIVSLSPDDNSELVEVSF 738
           P  +    K  DL++L  I+K LR QRI    AV+F E  + G+V+L+ +   EL EVSF
Sbjct: 674 PDNESSPVK-ADLESLSMISKLLREQRIKKNNAVIFGEGFNKGMVTLNANAEGELTEVSF 732

Query: 739 KDQIETKSTILVSELMILANSLTASYFEENQIPGIYRGYRPLNVVEDATSVPEWVKAKTQ 798
            +Q ET ST+LVSE+MILAN+LT  YF EN I G++R Y+ L +   A    + +   T+
Sbjct: 733 SNQEETPSTVLVSEMMILANTLTGRYFAENNIGGVFRCYKQLPLDLIAQQQYDSMITGTK 792

Query: 799 ENKIISKADIAKMKSFLTSSFYSSLPTPHDMLGTSHYLTITSPLRRFPDLVNHLQLHRTL 858
           +       DI K+ S L SSFY+  P  H+M+G   YLT+TSPLRRFPDL+NHLQ+HR L
Sbjct: 793 KGLFPKLRDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRRFPDLINHLQIHRHL 852

Query: 859 KGLPLLYKQSQLDGMVWHILTRDVTLKNASVDAQRYWTLRFLKKEIEDPTKNNWKLQITS 918
           +  PL + Q+Q+D ++W I +R   LK AS D+  YWTL +LKK  +      + + ITS
Sbjct: 853 QKKPLCFTQTQIDSLIWSIQSRADILKRASRDSSTYWTLNYLKKLAKSDPGRTYDVMITS 912

Query: 919 LTDNGYAHCVILDKAFAVGQLKINLN-KNPPLVGDQISDCEISNIQCLDGILQFE 972
           +  NG+A CV    +FA G LK+    K  P++GD + DC+IS I CL+G+L+ E
Sbjct: 913 VPQNGFAGCVFPSLSFARGTLKLQPKAKYYPMIGDIVKDCKISKIDCLEGMLELE 967

>Suva_13.477 Chr13 complement(824387..827296) [2910 bp, 969 aa] {ON}
           YMR287C (REAL)
          Length = 969

 Score =  619 bits (1596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/950 (37%), Positives = 559/950 (58%), Gaps = 75/950 (7%)

Query: 45  ESLQEDEEVIFFSQDKDILPEVEIKPFRRTKAETLMRFNDRFVQPSIDWYRKVGKSHGEN 104
           ES+ ED    F  + K + P++E+K   + K E   R+ DR+V PS  WY    +S  + 
Sbjct: 71  ESINED----FLHRIKGLEPDIELKQLYQIKEEFYKRYRDRYVVPSESWYSNSWRSLTK- 125

Query: 105 TDKDEFMHLLRNDISSSTLFEETLKWLSKDNYKLRNNTYNGYDTQEIEFYFDPSAIVSST 164
             K     L+  DI   T  E                      ++++E  F P+ ++ + 
Sbjct: 126 -PKIPSYKLINLDIHFDTKLES---------------------SKQME--FQPAQLMKNP 161

Query: 165 LMPGDICVLKNSPFELLVCVKTPSEAMDARFTFANTDGNVVYAWKTSVHLRFPTIFNTTE 224
           L  GD+ +LK+ P EL +CV  PS  MD R+TFA+ DG++ +A K  V LR P    T  
Sbjct: 162 LNVGDLVLLKSRPNELAMCVSLPSSTMDPRYTFASIDGSMSFATKNRVLLRIPQKLPTGI 221

Query: 225 LEILQREKLHGYSPVGSVKNDKDVTFVIPTLPRRMLISNVTFRIADAAVQQLPIIKKKLE 284
             ++Q E  H + P+G+VKN  + T ++P + R+M+ S    +I+  A + LPI  KKL+
Sbjct: 222 DSLVQPEDHHKHLPIGTVKNFSNQTSILPIVARQMITSKSPAQISKLAWKHLPITTKKLQ 281

Query: 285 LIHRYLQSGSSPWQIPILKLVEICSNLELSNNIEKSIATAFMKSGLSSDALYSLANSHFE 344
           L+HR LQ+   PWQIP   LV +   L+L+  ++        K+G+  + L  L NS ++
Sbjct: 282 LLHRSLQNYMGPWQIPFFTLVGLVQKLDLNKALDN-------KNGV--NYLADLVNS-YK 331

Query: 345 LSSKVPNKVECSRLLAVYWALLHQQGTQMWGEMTVHRGIFFPSAVTVLPLTKQHLHYHNI 404
            +  VP  +  +  ++ YWA++ QQ + +WG++ ++  +  P++VT++PL  +HL+Y  +
Sbjct: 332 SADSVP--MNSATFVSTYWAIVQQQESNLWGKIHLNTALLSPTSVTIIPLKSRHLYYAQV 389

Query: 405 IHKLRQHGGVRINRIAALINENDLASLNKSFPYIVPLLRDYAAGNLEHNDTITSLISSLF 464
           I KL       I+R   L+NE     ++  +P ++ LL+D+AAGN  +N  I +LIS +F
Sbjct: 390 IEKLEADNYKDIDRFVKLVNERKYRDISSLYPSVIQLLKDFAAGNFHNNGIIVTLISKIF 449

Query: 465 RKLDEYKELNISRDVCFDLLKRINPSEPPNPLLINHELQLPVNNERVKLEQKIYDLAVPP 524
           RK++ YK  +I+RD+C DL+  I P++  NPLL+N +L LP +++  + +QK+Y+L    
Sbjct: 450 RKIELYKGSDITRDICQDLVNEILPNKMINPLLLNMDLALPASSKLGQSQQKLYELTNIE 509

Query: 525 KIEH-SAEI---RTEYKDLICYCIDSPDAHEIDDAVSIKS-LGGAKYRIYIHVADPASLF 579
            ++  ++ I   R ++ DL  +CIDS  AHEIDD VSI++      Y ++IH+ADPASLF
Sbjct: 510 NMQRKNSNINGDRYDFGDLKVFCIDSETAHEIDDGVSIENHKKDGLYTLHIHIADPASLF 569

Query: 580 PEANE-DGTTINSPVLDIAYQRAFTTYLPDKVFPMLPTTYARSSDLGQFGKPTKAVTFSV 638
           PE+ + +   I + VL++A +R+FTTYLPD V PMLP +    SDLG+ G+ T+ ++FSV
Sbjct: 570 PESTDIESQGITTDVLNVALKRSFTTYLPDLVVPMLPESICDLSDLGKQGQKTRTLSFSV 629

Query: 639 DCTF---SKSKGLCLLKDSLKVELSVLHKSTRITYEAVDELLDEPTTKPKSGKHEDLKTL 695
           D      S  K + ++ +SLK+   ++    + TY  VD +L    ++    K EDL++L
Sbjct: 630 DVKVLPKSTGKPIEIIYNSLKIRKGIVSNFPKATYNDVDRILSITDSEAPPFK-EDLESL 688

Query: 696 FYIAKALRRQRIVDGGAVVF-ENSSTGIVSLSPDDNSELVEVSFKDQIETKSTILVSELM 754
             I+K LR  RI    AV+F E  + G+V+L+ +   EL EVSF DQ ET ST+LVSE+M
Sbjct: 689 SMISKLLRELRIKKNNAVIFGEGFNRGLVTLNTNKEGELTEVSFSDQAETPSTVLVSEMM 748

Query: 755 ILANSLTASYFEENQIPGIYRGYR--PLNVVEDATSVPEWVKAKTQENKIISKA------ 806
           ILAN+L   +F EN+I G++R Y+  PL+ +           A+ Q N +I+ A      
Sbjct: 749 ILANTLVGRFFAENKISGVFRCYKQLPLDAI-----------AQQQYNSLITSAKKGVFP 797

Query: 807 ---DIAKMKSFLTSSFYSSLPTPHDMLGTSHYLTITSPLRRFPDLVNHLQLHRTLKGLPL 863
              DI K+ S L SSFY+  P  H+M+G + YLT+TSPLRRFPDL+NHLQ+HR L+  PL
Sbjct: 798 KLEDITKLSSLLNSSFYTGQPFRHEMIGANQYLTVTSPLRRFPDLINHLQIHRHLQKKPL 857

Query: 864 LYKQSQLDGMVWHILTRDVTLKNASVDAQRYWTLRFLKKEIEDPTKNNWKLQITSLTDNG 923
            + Q+Q+D ++W I +R   LK AS ++  YWTL +LK  ++   +  + + ITS+  NG
Sbjct: 858 CFSQAQIDRLIWPIQSRADILKTASRNSSTYWTLNYLKTMMKSNPEKTYDVMITSVPQNG 917

Query: 924 YAHCVILDKAFAVGQLKINLN-KNPPLVGDQISDCEISNIQCLDGILQFE 972
           +A CV  D +FA G LK+N + ++ P++GD +  C+I  I CL+GIL+ E
Sbjct: 918 FAGCVFPDLSFARGTLKLNPSTEHYPMIGDTVKTCKILKIDCLEGILELE 967

>Skud_13.460 Chr13 complement(815990..818899) [2910 bp, 969 aa] {ON}
           YMR287C (REAL)
          Length = 969

 Score =  618 bits (1593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/941 (36%), Positives = 548/941 (58%), Gaps = 57/941 (6%)

Query: 45  ESLQEDEEVIFFSQDKDILPEVEIKPFRRTKAETLMRFNDRFVQPSIDWYRKVGKSHGEN 104
           ES+ +D    F  + K + P +E+K   + K E   R+ DR+++PS  WY    +S    
Sbjct: 71  ESINKD----FLHRTKGLEPNIELKQLSQIKEEFQQRYRDRYIKPSETWYTNSWRS---- 122

Query: 105 TDKDEFMHLLRNDISSSTLFEETLKWLSKDNYKLRNNTYNGYDTQEIEFYFDPSAIVSST 164
                   L +  ISS  L    ++  ++   K  N              F P  ++   
Sbjct: 123 --------LAKPKISSHNLINSNIQLDAQ--LKFSN-----------PLEFQPVQLMERP 161

Query: 165 LMPGDICVLKNSPFELLVCVKTPSEAMDARFTFANTDGNVVYAWKTSVHLRFPTIFNTTE 224
           L  GD+ +L+  P EL +CV  PS  MD R+TF   DG++ +A K  + LR P       
Sbjct: 162 LNVGDLVLLRVRPNELAMCVSLPSSTMDPRYTFVAIDGSMCFATKNRILLRIPHRLPVGV 221

Query: 225 LEILQREKLHGYSPVGSVKNDKDVTFVIPTLPRRMLISNVTFRIADAAVQQLPIIKKKLE 284
             ++Q E+ +G+ P+G++KN  + T ++P   R+++ S    +I+  A + LP   KKL+
Sbjct: 222 NSLIQPEERYGHLPIGTIKNFSNQTNILPIAARQIITSRYPAQISKLAWRDLPFTTKKLQ 281

Query: 285 LIHRYLQSGSSPWQIPILKLVEICSNLELSNNIEKSIATAFMKSGLSSDALYSLANSHFE 344
           L+HR LQ    PWQIP   LV +   L+L+  ++      +         L +L  +H +
Sbjct: 282 LLHRSLQDYRGPWQIPFFTLVGLVQRLDLNEALDDKYGATY---------LANLLGTH-Q 331

Query: 345 LSSKVPNKVECSRLLAVYWALLHQQGTQMWGEMTVHRGIFFPSAVTVLPLTKQHLHYHNI 404
            +  VP  +  +  ++ YWA++ QQ +  WGE+ ++  +  P +VTV+PL  +HL+Y  +
Sbjct: 332 TADNVP--ISSATFVSTYWAIMQQQESNFWGEIHLNTALLSPISVTVIPLKSRHLYYEQV 389

Query: 405 IHKLRQHGGVRINRIAALINENDLASLNKSFPYIVPLLRDYAAGNLEHNDTITSLISSLF 464
           + KL       INR   L+NE     ++  +P ++ +L+D+AAGN  +N  I +L+S +F
Sbjct: 390 VGKLEADDYNEINRFVKLVNERKYRDISTLYPSVIQMLKDFAAGNFHNNGIIVTLVSKIF 449

Query: 465 RKLDEYKELNISRDVCFDLLKRINPSEPPNPLLINHELQLPVNNERVKLEQKIYDLA--- 521
           RK++ YK+ +I+RD+C DL+  I P+   NPLL+N +L LP +++ V+ +QK+YDL    
Sbjct: 450 RKIERYKDCDITRDICQDLINEILPNSMSNPLLLNMDLALPASSKLVRSQQKLYDLTNIE 509

Query: 522 -VPPKIEHSAEIRTEYKDLICYCIDSPDAHEIDDAVSIKSLG-GAKYRIYIHVADPASLF 579
            +  K   ++  R ++ DL  +CIDS  AHEIDD VSI++ G    Y ++IH+ADP S+F
Sbjct: 510 DLQRKNSDNSSERYDFGDLKVFCIDSETAHEIDDGVSIENHGTDGLYTLHIHIADPTSMF 569

Query: 580 PEA-NEDGTTINSPVLDIAYQRAFTTYLPDKVFPMLPTTYARSSDLGQFGKPTKAVTFSV 638
           PE+ N D   I + +L++A +R+FTTYLPD V PMLP +    SDLG+ G+ TK ++FSV
Sbjct: 570 PESTNYDSEGIITDILNVALERSFTTYLPDVVVPMLPKSICNLSDLGKQGQKTKTISFSV 629

Query: 639 DC-TFSKSKG--LCLLKDSLKVELSVLHKSTRITYEAVDELLDEPTTKPKSGKHEDLKTL 695
           D    SK  G  L ++ DS K+   ++    ++TY+ VD +L+ P  +    K +DL++L
Sbjct: 630 DVKVMSKGDGESLEIMFDSFKIRKGIVSNFPKVTYDDVDRILNTPNDEASPVK-KDLESL 688

Query: 696 FYIAKALRRQRIVDGGAVVF-ENSSTGIVSLSPDDNSELVEVSFKDQIETKSTILVSELM 754
             ++  LR +RI +  AV+F E  + G+V+L+ ++  EL E+SF DQ+ET ST+LVSE+M
Sbjct: 689 SMVSNLLRDRRIKNNNAVIFGEGFNKGLVTLNANEEGELTEISFSDQVETLSTVLVSEMM 748

Query: 755 ILANSLTASYFEENQIPGIYRGYR--PLNVVEDATSVPEWVKAKTQENKIISKADIAKMK 812
           ILAN+LT  YF +N+I G++R Y+  PL+++  A    + +   T++       DI K+ 
Sbjct: 749 ILANTLTGKYFADNKICGVFRCYKQLPLDII--AQEQYDSMITSTKKGLFPQLKDIVKLS 806

Query: 813 SFLTSSFYSSLPTPHDMLGTSHYLTITSPLRRFPDLVNHLQLHRTLKGLPLLYKQSQLDG 872
           S L SSFY+  P  H+M+G   YLT+TSPLRRFPDL+NHLQ+HR L+  PL + Q Q+D 
Sbjct: 807 SLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRRFPDLINHLQIHRHLQKKPLCFSQVQIDR 866

Query: 873 MVWHILTRDVTLKNASVDAQRYWTLRFLKKEIEDPTKNNWKLQITSLTDNGYAHCVILDK 932
           ++W I +R   LK A  ++  YWTL +LKK  +   +  + + IT++  NG+  CV  D 
Sbjct: 867 LIWPIQSRADILKRAGRNSSTYWTLNYLKKLKKLDPEKTYDVMITAVPQNGFVSCVFPDL 926

Query: 933 AFAVGQLKINLN-KNPPLVGDQISDCEISNIQCLDGILQFE 972
           +FA G LK++ + K+ P++GD + +C+I  I CL+G+L+ E
Sbjct: 927 SFARGTLKLHPSAKHYPMIGDIVKNCKILRIDCLEGMLELE 967

>KNAG0E01140 Chr5 complement(222456..225245) [2790 bp, 929 aa] {ON}
           Anc_8.853 YMR287C
          Length = 929

 Score =  595 bits (1534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/959 (35%), Positives = 530/959 (55%), Gaps = 60/959 (6%)

Query: 18  AHRRYMHSGVPLFQARQSDTSGTNVTTESLQEDEEVIFFSQDKDILPEVEIKPFRRTKAE 77
            ++R+  S   +  +  + T   N+    ++   E +F S+ KD+ P +EIK  ++ K E
Sbjct: 23  GNKRWRKSREKVVSSSDARTPTKNLDAVDIERINE-MFLSRTKDLEPGMEIKKLKQIKKE 81

Query: 78  TLMRFNDRFVQPSIDWYRKVGKSHGENTDKDEFMHLLRNDISSSTLFEETLKWLSKDNYK 137
              RF +R+  PS  W+            +D ++      +  ST            N  
Sbjct: 82  FNTRFAERYFNPSKQWF------------QDNWV------VEPST------------NTA 111

Query: 138 LRNNTYNGYDTQEIEFYFDPSAIVSSTLMPGDICVLKNSPFELLVCVKTPSEAMDARFTF 197
            ++++ N    +   + F  S  +SS L  GD+ +    P EL +CV  P  A D R+TF
Sbjct: 112 GKSSSQNSMTGKNKHYTFKLSEFISSVLQMGDLVLTTPYPNELAMCVGLPESAEDPRYTF 171

Query: 198 ANTDGNVVYAWKTSVHLRFPTIFNTTELEILQREKLHGYSPVGSVKNDKDVTFVIPTLPR 257
               G + +  K+ VHLR P         ++ +E  H + PVG++K  +DVT+++P L R
Sbjct: 172 VTVSGKMFFGTKSFVHLRIPYRLPEKVRYLISKEGPHAFEPVGTIKGTRDVTYILPYLAR 231

Query: 258 RMLISNVTFRIADAAVQQLPIIKKKLELIHRYLQSGSSPWQIPILKLVEICSNLELSNNI 317
           +++ S +  +I   A Q+LP I K+LEL+ RYL+  +  WQ+P ++LV+    LE     
Sbjct: 232 QLVTSELPSQINKLAWQKLPSIIKRLELLSRYLRKYNGTWQVPFVQLVDAVQRLE----- 286

Query: 318 EKSIATAF--MKSGLSSDALYSLANSHFELSSKVPNKVECSRLLAVYWALLHQQGTQMWG 375
           EK     F  +KS     +L S  + H             +  LA YWA+  QQ   +WG
Sbjct: 287 EKGGPGEFEYIKSLFERPSLGSRRSIH------------AATYLATYWAIKEQQNFNIWG 334

Query: 376 EMTVHRGIFFPSAVTVLPLTK-QHLHYHNIIHKLRQHGGVRINRIAALINENDLASLNKS 434
           ++ V++    P + +V+P    +  H   I    R+H    +N+I  LIN  D   + + 
Sbjct: 335 KIHVNKAFLAPISTSVVPAASLRSFHDELINDPKRKH----VNKITDLINTKDYELVRER 390

Query: 435 FPYIVPLLRDYAAGNLEHNDTITSLISSLFRKLDEYKELNISRDVCFDLLKRINPSE-PP 493
           +P  + LL D+ AGN ++N  + +LIS +FR LD Y+E N++RD CFDLLK I+      
Sbjct: 391 YPEFLQLLSDFTAGNFDNNCEVVTLISQIFRMLDVYRECNVTRDTCFDLLKEISEDNFCE 450

Query: 494 NPLLINHELQLPVNNERVKLEQKIYDLAVPPKIEHSAEIRTEYKDLICYCIDSPDAHEID 553
           NP+L N +L L  ++ER  L++ +Y +  P     +   R ++ D+  YCIDS  AHEID
Sbjct: 451 NPILSNSDLALAQSSERSALQKCVYSVVQPDIQLDTKTKRHDFLDMPVYCIDSETAHEID 510

Query: 554 DAVSIKSLGGAKYRIYIHVADPASLFPEANEDGTTINSPVLDIAYQRAFTTYLPDKVFPM 613
           D VSI+  G   Y +++H+ADPAS FPE+  + T + S VL IA+ ++FTTYLPD V  M
Sbjct: 511 DGVSIEKNGKGSYTLHVHIADPASFFPESYTESTKL-SDVLKIAFDKSFTTYLPDVVEAM 569

Query: 614 LPTTYARSSDLGQFGKPTKAVTFSVDCTFSKSKGLCLLKDSLKVELSVLHKSTRITYEAV 673
           LP ++ R++DLG+  K T+ +TFSV     +  GL +  D+ +  L ++    ++TY  V
Sbjct: 570 LPESFCRAADLGKQDKKTRTITFSVRVKMDEHGGLHIQSDTFRARLGLVSNFPKVTYNIV 629

Query: 674 DELLDEPTTKPKSGKHEDLKTLFYIAKALRRQRIVDGGAVVF-ENSSTGIVSLSPDDNSE 732
           D +L++ ++   S   +DL TL+ IA  LR  R+   GAVVF E  + G V L  D  ++
Sbjct: 630 DSVLNDSSSN--SPLRQDLLTLYKIASGLRHNRVKLNGAVVFGEGFNNGQVRLIRDSANK 687

Query: 733 LVEVSFKDQIETKSTILVSELMILANSLTASYFEENQIPGIYRGYRPLNVVEDATSVPEW 792
           + +++F++  ET ST+LVSELMILAN+L+ ++F EN+IPGI+R Y  L +   A S    
Sbjct: 688 VKDITFENNNETPSTVLVSELMILANTLSGNFFRENKIPGIFRCYNELKLDGKALSDYRS 747

Query: 793 VKAKTQENKIISKADIAKMKSFLTSSFYSSLPTPHDMLGTSHYLTITSPLRRFPDLVNHL 852
           ++   Q  K  +  DIAK+ S + SSFYS  P  H M+G   YLT+TSPLRR+PDL+NH+
Sbjct: 748 IQDNVQRGKNPTLKDIAKITSLMNSSFYSGEPRNHQMIGAKQYLTVTSPLRRYPDLINHI 807

Query: 853 QLHRTLKGLPLLYKQSQLDGMVWHILTRDVTLKNASVDAQRYWTLRFLKKEIEDPTKNNW 912
           QLH+ L   PL + Q  +D M+W + +R   LK+ S     YWTL +LKK IE  +   +
Sbjct: 808 QLHKHLANKPLTFSQQAIDQMIWQVQSRADILKSISTTVSAYWTLTYLKKRIEKDSSARF 867

Query: 913 KLQITSLTDNGYAHCVILDKAFAVGQLKINLNKNPPLVGDQISDCEISNIQCLDGILQF 971
            + +TS   +G  +C+  + ++A G+LK+ +++ PP +GD + DC+I++I CLD  LQ 
Sbjct: 868 DVMVTSFPQDGMVNCLFPNHSYARGKLKLKVDRLPPQIGDIVKDCQITSIDCLDSNLQL 926

>CAGL0M07051g Chr13 complement(716775..719546) [2772 bp, 923 aa]
           {ON} similar to uniprot|P39112 Saccharomyces cerevisiae
           YMR287c MSU1
          Length = 923

 Score =  591 bits (1524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/928 (37%), Positives = 520/928 (56%), Gaps = 39/928 (4%)

Query: 55  FFSQDKDILPEVEIKPFRRTKAETLMRFNDRFVQPSIDWYRKVGKS--HGENTDKDEFMH 112
           + ++ K + P+ EI+   +  +    R+  R+++PS  W++   K+  HGE    D+   
Sbjct: 28  YLARTKGLEPDFEIRQLPQIISGFNKRYRARYLEPSQRWFKADWKASDHGE----DKATR 83

Query: 113 LLRNDISSSTLFEETLKWLSKDNYKLRNNTYNGYDTQEIEFYFDPSAIVSSTLMPGDICV 172
           LLR ++    +               R N       Q++ F  DP+ ++ ++L  GDI +
Sbjct: 84  LLRPEVFDKFIINSDFH---------RGNMEQYQKAQKLSF--DPAELLRTSLNVGDIVL 132

Query: 173 LKNSPFELLVCVKTPSEAMDARFTFANTDGNVVYAWKTSVHLRFPTIFNTTELEILQREK 232
           LK    EL +CV  P    D R+TFA  DG +VYA K SV LR P        ++L+RE 
Sbjct: 133 LKQCTSELTMCVNLPQSTTDPRYTFAKKDGTLVYAMKNSVILRIPKDLPEEVNQLLKRES 192

Query: 233 LHGYSPVGSVKNDKDVTFVIPTLPRRMLISNVTFRIADAAVQQLPIIKKKLELIHRYLQS 292
            H Y  +G++KN  + T ++P L R++++S         A  QLPI+ KKLELIHRYLQ 
Sbjct: 193 NHPYQKIGTIKNSSNETEILPVLTRQLIVSFTLATFTKFAWTQLPIVLKKLELIHRYLQD 252

Query: 293 GSSPWQIPILKLVEICSNLELSNNIEKSIATAFMKSGLSSDALYSLANSHFELSSKVPNK 352
                 +  + LV I  NL +    +     A+++  +             E  S V   
Sbjct: 253 SRGSKHVNFMSLVRIIKNLNIKEATDAINGDAYVRKVID------------ESMSVVNKS 300

Query: 353 VECSRLLAVYWALLHQQGTQMWGEMTVHRGIFFPSAVTVLPLTKQHLHYHNIIHKLRQHG 412
           ++ + LLA YW +  QQ   +WG +  +  +  P+ V VLPL K HL Y  +I +L  + 
Sbjct: 301 IDPTTLLATYWGVREQQQNNLWGSVYTNTALLSPTTVAVLPLKKAHLFYQEVITRLESND 360

Query: 413 GVRINRIAALINENDLASLNKSFPYIVPLLRDYAAGNLEHNDTITSLISSLFRKLDEYKE 472
              I   A L+N+ D  S+ K + YI  LL DYAAGN+E N  +T++IS +FR +D Y++
Sbjct: 361 YQEIKAFAKLVNDKDYHSIAKRYDYIRTLLNDYAAGNIEENAVLTTIISKIFRHIDMYRD 420

Query: 473 LNISRDVCFDLLKRINP-SEPPNPLLINHELQLPVNNERVKLEQKIYDLAVPPKIEHSAE 531
            +++R +C  LL  I+P S   N +L N +L +P ++    +EQK+YD A+P  +  +  
Sbjct: 421 QDVTRSLCGKLLVEISPQSNSSNFILGNWDLNIPKSSGISSVEQKLYDTAMPTIVSDTD- 479

Query: 532 IRTEYKDLICYCIDSPDAHEIDDAVSIKSLGGAKYRIYIHVADPASLFPEA-NEDGTTIN 590
            R ++ D+  +CIDS DAHEIDD +SI+ L G + RI+IH+ADPA LFPE+ +   + I+
Sbjct: 480 -RYDFGDMPVFCIDSEDAHEIDDGISIEELDGVRSRIHIHIADPAGLFPESFDYTKSGIS 538

Query: 591 SPVLDIAYQRAFTTYLPDKVFPMLPTTYARSSDLGQFGKPTKAVTFSVDCTFSKSKGLCL 650
             VL ++ +RAFTTYLPD V PMLP ++   +DLG+  + T+ ++FS +    +  GL +
Sbjct: 539 DDVLRVSLKRAFTTYLPDLVVPMLPKSFCNRADLGKHDRKTETISFSFELVNKEDGGLHV 598

Query: 651 LKDSLKVELSVLHKSTRITYEAVDELLDEPTTKPKSGKHEDLKTLFYIAKALRRQRIVDG 710
             D+ +V L ++    ++TY+ VD +L+       S + + L+ L  +A  L  +RI D 
Sbjct: 599 DYDTFQVRLGIVSNFPKVTYDKVDSILNGDDNSLPSKQKKQLELLHTLATKLLHKRIHDD 658

Query: 711 GAVVFENS-STGIVSLSPDDNSELVEVSFKDQIETKSTILVSELMILANSLTASYFEENQ 769
            AVVF +  + G+VSLSPDD+ EL   +F DQ +TKST+LVSE MIL N L A++F+EN+
Sbjct: 659 NAVVFGDGFNKGLVSLSPDDDGELCIPTFYDQSQTKSTLLVSEFMILTNKLCAAFFQENK 718

Query: 770 IPGIYRGYRPLNVVEDATSVPEWVKAKTQENKIISKADIAKMKSFLTSSFYSSLPTPHDM 829
           IPG+YR Y  LN+   A +  E +K   +  K+ S  DI K+ S L+SSFYS  P PH M
Sbjct: 719 IPGVYRCYNGLNLGNQAKAQFELLKENIKLGKLPSLKDITKISSQLSSSFYSPFPLPHKM 778

Query: 830 LGTSHYLTITSPLRRFPDLVNHLQLHRTLKGLPLLYKQSQLDGMVWHILTRDVTLKNASV 889
           +G + YLT+TSP+RR PDL+NHLQLHR LK LPL +KQ  LD  VW    R   LK    
Sbjct: 779 IGNTAYLTVTSPMRRGPDLINHLQLHRFLKKLPLCFKQEYLDQYVWSFQARADILKIFQR 838

Query: 890 DAQRYWTLRFLKKEIEDPTKNNWKLQITSLTDNGYAHCVILDKAFAVGQLKIN-LNKNPP 948
            +  YWTL    K +E        + +TS+  NG  +C+  + ++A G LK++   K  P
Sbjct: 839 HSSTYWTL----KHLEQSGTKTHDVIVTSVPQNGTVNCLFPEYSYARGTLKLDPAMKKIP 894

Query: 949 LVGDQISDCEISNIQCLDGILQFEPTSR 976
            +GD I  C++ +I  LDGIL     +R
Sbjct: 895 RIGDTIRHCKVESIHPLDGILTLTHVNR 922

>KLTH0C03674g Chr3 complement(317119..319965) [2847 bp, 948 aa] {ON}
           similar to uniprot|P39112 Saccharomyces cerevisiae
           YMR287C MSU1 RNase component of the mitochondrial
           degradosome along with the ATP-dependent RNA helicase
           Suv3p the degradosome associates with the ribosome and
           mediates turnover of aberrant or unprocessed RNAs
          Length = 948

 Score =  585 bits (1507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/911 (34%), Positives = 522/911 (57%), Gaps = 23/911 (2%)

Query: 64  PEVEIKPFRRTKAETLMRFNDRFVQPSIDWYRKVGKSHGENTDKDEFMHLLRNDISSSTL 123
           P VEIK     +     RF ++   PS +W R    +     D   ++++    +SS   
Sbjct: 57  PGVEIKQLSHIQKGLDERFYNQHFLPSKNWCRDNAVNWANMKD---YLNMDLTSLSS--- 110

Query: 124 FEETLKWLSKDNYKLRNNTYNGYDTQEIEFYFDPSAIVSSTLMPGDICVLKNSPFELLVC 183
                K  +  N  L+   +   D++   F   PS ++ S+L  GD+ +L++ P +L +C
Sbjct: 111 -----KQRADMNDSLKPEVF---DSESGTFRMHPSHLLDSSLKIGDLVLLRSDPSQLCMC 162

Query: 184 VKTPSEAMDARFTFANTDGNVVYAWKTSVHLRFPTIFNTTELEILQREKLHGYSPVGSVK 243
           V+ P+E  +  + FA  DG++ +  +  + LR P+        +++ E     + +G+VK
Sbjct: 163 VEVPTEVTNPSYAFATIDGHIRFGERNMILLRIPSFHKAAAKYLIKEEVPFLNTRIGAVK 222

Query: 244 NDKDVTFVIPTLPRRMLISNVTFRIADAAVQQLPIIKKKLELIHRYLQSGSSPWQIPILK 303
           +  + TF++  + R++  S V F I  AA  ++ +  KKLEL+HR+LQ  + PWQ+ I K
Sbjct: 223 DSPEKTFMLSIVARQLYTSYVPFEITKAAWNRMGVTTKKLELLHRFLQRSTGPWQMSIFK 282

Query: 304 LVEICSNLELSNNIEKSIATAFMKSGLSSDALYSLANSHFELSSKVPNKVECSRLLAVYW 363
           L E+ + L++ +  + S   ++++  L    ++  A+     S +    ++ S  LA YW
Sbjct: 283 LCELVALLDI-DKCQSSSTGSYIEGILKEAGMFRDAHPIESFSGRSLKSIDASDFLATYW 341

Query: 364 ALLHQQGTQMWGEMTVHRGIFFPSAVTVLPLTKQHLHYHNIIHKLRQHGGVRINRIAALI 423
           +L+ QQ   +WG++  HR +  P +VTVLPLT  HL+Y  ++ +L++     +   A LI
Sbjct: 342 SLVQQQEHNLWGQIHSHRAMLTPISVTVLPLTSHHLYYKEVLKELKKDNYAALESFAKLI 401

Query: 424 NENDLASLNKSFPYIVPLLRDYAAGNLEHNDTITSLISSLFRKLDEYKELNISRDVCFDL 483
           N  +  S    +P I  LLRDYAAGN  +N  I +++S LFRKLD+Y+  +I+RD+C + 
Sbjct: 402 NTGERNSAKLQYPQISRLLRDYAAGNFHNNGPIITIVSKLFRKLDKYQNNDITRDLCHEF 461

Query: 484 LKRINPSEPPNPLLINHELQLPVNNERVKLEQKIYDLAVPPKIEHSAEIRTEYKDLICYC 543
           L+ +     PNP L+++E++ P  +ER  LEQKIYDLA+P + +  +  R ++  +  YC
Sbjct: 462 LQELTCESIPNPQLLSNEIRSPSTSERAVLEQKIYDLALPNQNDDISR-RHDFGKMNVYC 520

Query: 544 IDSPDAHEIDDAVSIKSLGGAKYRIYIHVADPASLFPEANEDGTTINSPVLDIAYQRAFT 603
           IDS  AHEIDD +SI++ G   Y ++IH+ADP SLF  + E   + +  + +IA QR FT
Sbjct: 521 IDSETAHEIDDGISIEATGENAYTLHIHIADPVSLFSNSQEG--SFSKEIWNIALQRGFT 578

Query: 604 TYLPDKVFPMLPTTYARSSDLGQFGKPTKAVTFSVDCTFSKSKGLCLLKDSLKVELSVLH 663
           +YLPD V PMLP +Y+++ DLG+ G  +K ++FSVD    K+  + +L+++  V+L ++ 
Sbjct: 579 SYLPDCVTPMLPKSYSKAGDLGKDGIASKTLSFSVDIRCRKN-NVEILEETFSVKLGLVS 637

Query: 664 KSTRITYEAVDELLDEPTTKPKSGKHEDLKTLFYIAKALRRQRIVDGGAVVF-ENSSTGI 722
           +  R+TY+ VD +L     +  S + ++L+TL  IA  LR +R+ +  A++F E  + G+
Sbjct: 638 QFPRVTYKVVDRILG--LEQDASQQTQELRTLHKIALLLRSKRVKEQNAIIFGEGFNRGL 695

Query: 723 VSLSPDDNSELVEVSFKDQIETKSTILVSELMILANSLTASYFEENQIPGIYRGYRPLNV 782
           V L P   +    +SF+DQ ET ST+LVSE+MILAN++   +F +  IPG++R Y+ L +
Sbjct: 696 VKLMPTQTNTATALSFEDQEETASTVLVSEIMILANTMAGKFFRDRGIPGVFRCYKGLQL 755

Query: 783 VEDATSVPEWVKAKTQENKIISKADIAKMKSFLTSSFYSSLPTPHDMLGTSHYLTITSPL 842
            ++A      ++      K  S  DIAK+ S L SSFYS+    H+M+G   YL +TSPL
Sbjct: 756 KDNARQGYNSLRDMMHSQKFPSAKDIAKLSSLLNSSFYSARAEKHEMIGAPAYLPVTSPL 815

Query: 843 RRFPDLVNHLQLHRTLKGLPLLYKQSQLDGMVWHILTRDVTLKNASVDAQRYWTLRFLKK 902
           RRF DLVNH QLH  L G PL + + Q+  + WHI +RDV L+ A+ D+  +WTL  LK 
Sbjct: 816 RRFADLVNHWQLHCYLAGFPLKFSEDQVSDLAWHIQSRDVVLRKAARDSASFWTLVHLKS 875

Query: 903 EIEDPTKNNWKLQITSLTDNGYAHCVILDKAFAVGQLKINLNKNPPL-VGDQISDCEISN 961
           + E        + +TS+   G   CV+ + + A G LK+    +  + +GD + +C I+ 
Sbjct: 876 QQELNPSRRLSVMVTSVPRLGVVRCVLPELSTARGILKLKPEASSTVAIGDVVHNCRITR 935

Query: 962 IQCLDGILQFE 972
           + CLD I++ E
Sbjct: 936 LDCLDSIMELE 946

>Kwal_27.10213 s27 complement(243200..246010) [2811 bp, 936 aa] {ON}
           YMR287C (MSU1) - component of 3'-5'exonuclease complex
           [contig 39] FULL
          Length = 936

 Score =  583 bits (1502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/936 (34%), Positives = 525/936 (56%), Gaps = 43/936 (4%)

Query: 50  DEEVIFFSQDKDILPEVEIKPFRRTKAETLMRFNDRFVQPSIDWYRKVGKSHGE-----N 104
           D   I + +   + P VEIK     ++    R+ ++++ PS +W R  G   G      N
Sbjct: 29  DSAKIIYKRAGQLEPGVEIKQLSEIQSGLNDRYYEQYLIPSKEWCRDNGTKWGGMKNYLN 88

Query: 105 TDKDEFMHLLRNDISSSTLFEETLKWLSKDNYKLRNNTYNGYDTQEIEFYFDPSAIVSST 164
            D        + D+ +S   E  +                 YD     F   P  ++ S 
Sbjct: 89  MDLMSLSEKQQADMDAS--LEPKV-----------------YDKTSETFRLVPKELLKSP 129

Query: 165 LMPGDICVLKNSPFELLVCVKTPSEAMDARFTFANTDGNVVYAWKTSVHLRFPTIFNTTE 224
           L  GD+ +L+++P +L  CV+ P++ M+  + FA  DG + YA ++ + LR P+    + 
Sbjct: 130 LKIGDLVLLRSNPTQLCTCVEVPTDVMNPSYAFATIDGQIKYAMRSMILLRIPSFHRRSA 189

Query: 225 LEILQREKLHGYSPVGSVKNDKDVTFVIPTLPRRMLISNVTFRIADAAVQQLPIIKKKLE 284
             +++ EK +  + +G+VK+  + TF++P L R++  S   F+I   A  ++ I+ +KLE
Sbjct: 190 HHLIREEKPYLDARIGTVKDSPEKTFILPILARQLYTSYAPFKITKQAWSRMAILTQKLE 249

Query: 285 LIHRYLQSGSSPWQIPILKLVEICSNLEL----SNNIEKSIATAFMKSGLSSDALYSLAN 340
           L+HR+LQ  S PWQ+ I KL ++   L+L    S++ E  I   F K GL+        N
Sbjct: 250 LLHRFLQRSSGPWQVSIFKLCQMAVMLDLEKFRSSHAESYIKELFQKLGLNGS-----PN 304

Query: 341 SHFELSSKVP--NKVECSRLLAVYWALLHQQGTQMWGEMTVHRGIFFPSAVTVLPLTKQH 398
           S  + S  +     V+ +  LA +WAL  QQ   +WG+   H+ +  P +VTVLPL  +H
Sbjct: 305 SFQKQSGNLHYIESVDAADYLATFWALEQQQENNLWGQFQTHQAMLAPLSVTVLPLASRH 364

Query: 399 LHYHNIIHKLRQHGGVRINRIAALINENDLASLNKSFPYIVPLLRDYAAGNLEHNDTITS 458
           L+Y  ++  L++     I + A L+N  +    +   P    +L+DYAAGN  +N  + +
Sbjct: 365 LYYETVLKDLKKDNHRLITKFAGLVNSGNFTGADSEVPQFKQILKDYAAGNFHNNGAMAT 424

Query: 459 LISSLFRKLDEYKELNISRDVCFDLLKRINPSEPPNPLLINHELQLPVNNERVKLEQKIY 518
           ++S LFR +D +K  +I+RD+C +L+++++     NPLL++ +L LP ++    LE+KIY
Sbjct: 425 VVSKLFRSIDVFKGRDITRDLCHELMEKLSHRNTLNPLLLSDDLALPSSSANTALEEKIY 484

Query: 519 DLAVPPKIEHSAEIRTEYKDLICYCIDSPDAHEIDDAVSIKSLGGAKYRIYIHVADPASL 578
           ++A P   E     R ++  +  YCIDS  AHEIDD +SI+ LG   + ++IH+ADP SL
Sbjct: 485 EMAQPSTKE-DIPARFDFSSMNVYCIDSESAHEIDDGISIEPLGRNAFTLHIHIADPVSL 543

Query: 579 FPEANEDGTTINSPVLDIAYQRAFTTYLPDKVFPMLPTTYARSSDLGQFGKPTKAVTFSV 638
           F E  + GT  N  V +IAY+R FTTYLPD V PMLP ++  +  LG     +K V+FSV
Sbjct: 544 FTE--DGGTKFNDEVWNIAYRRGFTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTVSFSV 601

Query: 639 DCTFSKSKGLCLLKDSLKVELSVLHKSTRITYEAVDELLDEPTTKPKSGKHEDLKTLFYI 698
           +       GL + ++S KV L    K  ++TY++VD +L +   K +  K  +L+TL+ I
Sbjct: 602 NIKMHDG-GLRIDEESFKVRLGYATKFPKVTYDSVDRILQQNNDKTQEAK--ELRTLYQI 658

Query: 699 AKALRRQRIVDGGAVVF-ENSSTGIVSLSPDDNSELVEVSFKDQIETKSTILVSELMILA 757
           +  L+ +RI +  A++F E  + G+V L+  ++  L ++ F+DQ +T ST+LVSE+MILA
Sbjct: 659 SLLLQSKRINEQRAIIFGEGFNRGLVKLNEGESGRLDKIGFEDQSQTPSTVLVSEMMILA 718

Query: 758 NSLTASYFEENQIPGIYRGYRPLNVVEDATSVPEWVKAKTQENKIISKADIAKMKSFLTS 817
           N+L   YF+ N+IPG++R Y+ L +   A    E ++A TQ   + +  DIAK+ S L S
Sbjct: 719 NTLAGRYFQVNKIPGVFRCYKELLLKSGARESYESLRAMTQSTSLPAVEDIAKLSSLLNS 778

Query: 818 SFYSSLPTPHDMLGTSHYLTITSPLRRFPDLVNHLQLHRTLKGLPLLYKQSQLDGMVWHI 877
           SFY+  P  H M+G   YLT+TSPLRRFPDL+NHLQ+ + L   PL + +  +D M+WH+
Sbjct: 779 SFYTGTPDRHSMIGAPAYLTVTSPLRRFPDLINHLQIRQHLTQNPLPFSKLDIDEMIWHL 838

Query: 878 LTRDVTLKNASVDAQRYWTLRFLKKEIEDPTKNNWKLQITSLTDNGYAHCVILDKAFAVG 937
            +RD+ ++ A+ D+  +WTL+ LK   +        + +TS+   G+  CV+ D + A G
Sbjct: 839 QSRDLVIRKAARDSASFWTLKHLKSLQDSSPDRKISVMVTSIPRMGFVRCVLPDLSAARG 898

Query: 938 QLKINLNKNPPL-VGDQISDCEISNIQCLDGILQFE 972
            LK+    +  + +GD + +C I+ + CLD +++ +
Sbjct: 899 ILKLKPEVSADVAIGDLMHNCVITKLDCLDAVMELK 934

>KAFR0L01970 Chr12 complement(372452..375250) [2799 bp, 932 aa] {ON}
           Anc_8.853 YMR287C
          Length = 932

 Score =  572 bits (1474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/972 (35%), Positives = 557/972 (57%), Gaps = 60/972 (6%)

Query: 17  LAHRRYMHSGVPLFQA----RQSDTSGTN----VTTESLQEDE----EVIFFSQDKDILP 64
           L   R +HS    F+A    R+S T   N      T  L+++E      +F S+   + P
Sbjct: 4   LCATRRLHSSRLSFRALQKQRRSRTKNKNENPSFGTTPLKKEEIKLINKLFLSRTSGLEP 63

Query: 65  EVEIKPFRRTKAETLMRFNDRFVQPSIDWYRKVGKSHGENTDKDEFMHLLRNDISSSTLF 124
           ++EIK     + +   R+  R + PS  WY        E+  KD    +L  +  S  L 
Sbjct: 64  DLEIKELADIEKDYNERYLKRIIWPSKRWY--------EHDWKDRSTKILGMERFSKNLI 115

Query: 125 EETLKWLSKDNYKLRNNTYNGYDTQEIEFYFDPSAIVSSTLMPGDICVLKNSPFELLVCV 184
                  +K N+  RN     + TQE+         + S L  GDI +LK++  EL +CV
Sbjct: 116 NG-----AKPNFNKRNEGIT-FHTQEL---------LESPLKVGDIVLLKSNATELSMCV 160

Query: 185 KTPSEAMDARFTFANTDGNVVYAWKTSVHLRFPTIFNTTELEILQREKLHGYSPVGSVKN 244
             P  A D R+TFA   GN++++ ++S++LR P         ++ RE  HG++P+G +K+
Sbjct: 161 ALPESADDPRYTFATIKGNLLFSTRSSINLRIPYSIPNGIANLITREIPHGFNPIGVIKS 220

Query: 245 DKDVTFVIPTLPRRMLISNVTFRIADAAVQQLPIIKKKLELIHRYLQSGSSPWQIPILKL 304
             + TF++PT+ R+ + S   F ++  A ++LP+  KKLE++HR+LQ+    +QIP  +L
Sbjct: 221 SINETFILPTVTRQHITSLKPFTVSHIAWEELPLTIKKLEVLHRFLQNPLGWYQIPFFQL 280

Query: 305 VEICSNLELSNNIEKSIATAFMKSGLSSDALYSLANSHFELSSKVPNKVECSRLLAVYWA 364
           V +   +++S+  ++     +MK+ + +    S  +S+        N ++ SR L+ YWA
Sbjct: 281 VHLVDTIDMSSCNDRK----YMKTLIDN----SKNDSY--------NNLDASRCLSTYWA 324

Query: 365 LLHQQGTQMWGEMTVHRGIFFPSAVTVLPLTKQHLHYHN-IIHKLRQHGGVRINRIAALI 423
           ++ QQ T MWG++  +     P +VTV PL K + H+++ ++   +Q    +I ++  L+
Sbjct: 325 IIEQQETNMWGDIQRNSCSMSPISVTVNPL-KAYQHFNDYLVCGTKQKDLDKIGQVTRLM 383

Query: 424 NENDLASLNKSFPYIVPLLRDYAAGNLEHNDTITSLISSLFRKLDEYKELNISRDVCFDL 483
           NE +   + + +P  + +L+DYA+GNL  N  +  LIS+  RKL+ YK++++S+ VC+ L
Sbjct: 384 NEKNYTIIKEKYPEFMSMLKDYASGNLNQNSQVAVLISAFLRKLNYYKDMDVSKTVCYKL 443

Query: 484 LKRINPSEP-PNPLLINHELQLPVNNERVKLEQKIYDLAVPPKIEHSAEIRTEYKDLICY 542
           L+ I+P++   N LL NH+L L  ++   +  +++Y L   P+I   A+ R ++ +L  Y
Sbjct: 444 LQEIDPTQFFDNILLFNHDLNLSNSSNLGQSNKQLYALC-GPQISADAD-RVDFGNLRVY 501

Query: 543 CIDSPDAHEIDDAVSIKSLGGAKYRIYIHVADPASLFPEANEDGTTINSPVLDIAYQRAF 602
           CIDS  AHEIDD +SI + G   Y + IH+ADP+ LF  A+E    +N  V  +A +++F
Sbjct: 502 CIDSETAHEIDDGISIINKGNGIYSLSIHIADPSILFSGASEIQGPLNDDVFKLAMEKSF 561

Query: 603 TTYLPDKVFPMLPTTYARSSDLGQFGKPTKAVTFSVDCTFSKSKGLCLLKDSLKVELSVL 662
           TTYLPD V P+LP TY+ ++DLG+ G+ T A+TF+V+      + L +L D+  ++LS +
Sbjct: 562 TTYLPDIVEPLLPNTYSEAADLGKNGQVTNAMTFTVNVKTLPDETLHVLYDTFDIKLSKI 621

Query: 663 HKSTRITYEAVDELLDEPTTKPKSGKHEDLKTLFYIAKALRRQRIVDGGAVVF-ENSSTG 721
               ++TY  V+++L        S K +DL+ L  IA+ALR  R+ +GGAVVF E  + G
Sbjct: 622 RNFPKVTYSRVNKILQSSDYSNPSVK-QDLEDLHKIARALRNNRMKNGGAVVFGEGFNKG 680

Query: 722 IVSLSPDDNSELVEVSFKDQIETKSTILVSELMILANSLTASYFEENQIPGIYRGYRPLN 781
           ++    +  +E+  V F DQ ET +T+LVSELMIL N+L   +F++N IPGIYR Y  L 
Sbjct: 681 MIEFFEEGQAEVKNVKFIDQEETPATLLVSELMILTNTLCGWFFKKNNIPGIYRSYNKLL 740

Query: 782 VVEDATSVPEWVKAKTQENKIISKADIAKMKSFLTSSFYSSLPTPHDMLGTSHYLTITSP 841
           +   AT     +++ T+     S  D+ ++ S + SS Y+S P  H+M+G   YLT+TSP
Sbjct: 741 LGSKATMEYMSLQSSTKSGVSPSIKDMTRVSSLMNSSVYTSKPRMHEMIGAQQYLTVTSP 800

Query: 842 LRRFPDLVNHLQLHRTLKGLPLLYKQSQLDGMVWHILTRDVTLKNASVDAQRYWTLRFLK 901
           LRRFPDL+NH Q+HR LK LP ++   +L  ++WHI +R   LK  S     YWTL +L+
Sbjct: 801 LRRFPDLLNHFQIHRFLKKLPFVFNDEKLQNLIWHIQSRADILKKMSRAINTYWTLEYLQ 860

Query: 902 KEI-EDPTKNNWKLQITSLTDNGYAHCVILDKAFAVGQLKINLNKNPPLVGDQISDCEIS 960
           K I E+P K  + + ITS+ +NG  +C+  D +FA G+LK+      P++GD +++C I 
Sbjct: 861 KAIFENPNK-RFDVMITSVPNNGVVNCLFPDMSFARGKLKLKKGMPYPVIGDTVTNCRIV 919

Query: 961 NIQCLDGILQFE 972
            ++ LDGIL  E
Sbjct: 920 KLESLDGILYLE 931

>NCAS0C00300 Chr3 (39415..42237) [2823 bp, 940 aa] {ON} Anc_8.853
           YMR287C
          Length = 940

 Score =  549 bits (1415), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 326/922 (35%), Positives = 512/922 (55%), Gaps = 60/922 (6%)

Query: 64  PEVEIKPFRRTKAETLMRFNDRFVQPSIDWYRKVGKSHGENTDKDEFMHLLRNDISSSTL 123
           P +++K   +   E   RF  R+++PS  WY                             
Sbjct: 63  PNIQLKSLPQIYREYEKRFLSRYIRPSKFWY----------------------------- 93

Query: 124 FEETLKWLSKD-----NYKLRNNTYNGYDTQEIEFYFDPSAIVSSTLMPGDICVLKNSPF 178
             ETL WL+ D     N    NN      +++    FD + +  + L   D+ +L+ +P 
Sbjct: 94  --ETL-WLNNDTKPPFNKLFLNNPLPDSISKKQLLNFDYNDLAKTPLKIRDLAILRATPS 150

Query: 179 ELLVCVKTPSEAMDARFTFANTDGNVVYAWKTSVHLRFPTIFNTTELEILQREKLHGYSP 238
           EL +CV+ P    D R+TFA+  G + + +++ + +R P         ++ +E  H +SP
Sbjct: 151 ELSMCVQLPESVEDPRYTFASRSGKLYFVYRSMIKIRIPYQVPKGIQGLILKELQHEFSP 210

Query: 239 VGSVKNDKDVTFVIPTLPRRMLISNVTFRIADAAVQQLPIIKKKLELIHRYLQSGSSPWQ 298
           +G++K++   TF++P L R +L       I  AA  Q PI+ KKLEL+HRYLQ+   P  
Sbjct: 211 IGTLKSNTKDTFILPYLARNLLSRTGLSDINKAASYQRPIVMKKLELLHRYLQNDKGPTS 270

Query: 299 IPILKLVEICSNLELSNNIEKSIATAFMKSGLSSDALYSLANSHFELSSKVPNKVECSRL 358
           IP   L+ + + L+LS  +        +++G  +D + +L       ++  P+ +  S  
Sbjct: 271 IPFTHLINLVNKLDLSQALH-------LQAG--NDYIINLIKE----ANDPPSIMNASLT 317

Query: 359 LAVYWALLHQQGTQMWGEMTVHRGIFFPSAVTVLPLTKQHLHYHNIIHKLRQHGGVRINR 418
           +AVYW+L+    T +W  +  +    FP+ VTVLPL    +HY  +I  L ++   ++N+
Sbjct: 318 IAVYWSLVELSETFLWDGINRNSASLFPTTVTVLPLLSYRVHYTELIEDLERNNYKQLNK 377

Query: 419 IAALINENDLASLNKSFPYIVPLLRDYAAGNLEHNDTITSLISSLFRKLDEYKELNISRD 478
            + L+N+ +   + +SF  I+ LL++Y AGNL++N  IT+LIS LFR + EY+  +I+RD
Sbjct: 378 FSNLVNDKNYQEIEQSFSKIINLLQEYTAGNLQNNPKITTLISKLFRGIKEYQRCDITRD 437

Query: 479 VCFDLLKRINPSEPP--NPLLINHELQLPVNNERVKLEQKIYDLAVPPK--IEHSAEIRT 534
           +C +LL +  PS  P  NPLL NH+L    +++  + +Q +YD   P    I+ S   R 
Sbjct: 438 LCNELLMKF-PSIKPNSNPLLKNHDLATRADSQHGQRQQILYDYVKPNDLLIQESLRDRF 496

Query: 535 EYKDLICYCIDSPDAHEIDDAVSIKSLGGAKYRIYIHVADPASLFPEA-NEDGT-TINSP 592
           ++ DL  YCIDS  AHEIDD +SI+     K+ ++IH+ADPA  FPE  NE G   +   
Sbjct: 497 DFGDLRVYCIDSETAHEIDDGISIEKKFNGKFTLHIHIADPAIFFPECNNEKGVLGLQDD 556

Query: 593 VLDIAYQRAFTTYLPDKVFPMLPTTYARSSDLGQFGKPTKAVTFSVDCTFSKSK-GLCLL 651
           VL IAY+ +FTTYLPD V PMLP +Y + +DLG  GK T +++FSVD   +K K  L + 
Sbjct: 557 VLKIAYENSFTTYLPDTVVPMLPKSYCKMADLGINGKKTPSISFSVDVILNKEKSNLKIC 616

Query: 652 KDSLKVELSVLHKSTRITYEAVDELLDEPTTKPKSGKHEDLKTLFYIAKALRRQRIVDGG 711
            D+ ++ L ++    + TY+ VD++L       +    +DL+ L  IA  LR +R  + G
Sbjct: 617 YDTFQIRLGLVSNFPKATYDNVDDILSSEVNSEQKLLQDDLRQLSMIAGILRNKRTQENG 676

Query: 712 AVVF-ENSSTGIVSLSPDDNSELVEVSFKDQIETKSTILVSELMILANSLTASYFEENQI 770
           A+ F E  + G    S D  +E   +SF DQ  TKS  LV+ELMILAN+L   YF+EN+I
Sbjct: 677 AITFGEGFNRGTPKYSEDSETESDVISFVDQKNTKSNELVTELMILANTLCGRYFKENKI 736

Query: 771 PGIYRGYRPLNVVEDATSVPEWVKAKTQENKIISKADIAKMKSFLTSSFYSSLPTPHDML 830
            G+YR Y  LN+   A      ++ + +  K+ +  DI K++S L SS+YS  P+ HDM+
Sbjct: 737 FGVYRCYNDLNLEPKAKMQYNKLREECKNGKLPTLEDIVKVQSLLNSSYYSEHPSRHDMI 796

Query: 831 GTSHYLTITSPLRRFPDLVNHLQLHRTLKGLPLLYKQSQLDGMVWHILTRDVTLKNASVD 890
           G+  YLT+TSPLRRF DLV+H+QLH  LKG PL + Q  +   V HI +R   L+  S +
Sbjct: 797 GSEQYLTVTSPLRRFTDLVSHIQLHNHLKGHPLPFNQKAIRNFVPHIQSRADKLRKISTE 856

Query: 891 AQRYWTLRFLKKEIEDPTKNNWKLQITSLTDNGYAHCVILDKAFAVGQLKINLN-KNPPL 949
           +    TL +LK  ++      + ++ITS+   G A C+I + +FA G+++++ + K  P 
Sbjct: 857 SNVCMTLSYLKNLLKTKPDTMFDVKITSVPSEGRARCLIPEYSFARGEIRLSPSLKVYPK 916

Query: 950 VGDQISDCEISNIQCLDGILQF 971
           VGD ++ C++  I C+DGIL+F
Sbjct: 917 VGDTVNSCKVVKISCVDGILEF 938

>Kpol_237.4 s237 complement(4514..7264) [2751 bp, 916 aa] {ON}
           complement(4514..7264) [2751 nt, 917 aa]
          Length = 916

 Score =  536 bits (1381), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 321/919 (34%), Positives = 511/919 (55%), Gaps = 67/919 (7%)

Query: 72  RRTKAETLMRFNDRFVQPSIDWYRKVGKSHGENTDKDEFMHLLRNDISSSTLFEETLKWL 131
           ++ K+ ++ RFN  + QPS  WY+ +  S    +             +++T    + KWL
Sbjct: 43  QKIKSNSIKRFNLTYNQPSNTWYKSLLISSPPPSLPCSPSTSTSTSATTATSTSNSPKWL 102

Query: 132 S---KDNYKLRNNTYNGYDTQEIEFYFDPSAIVSSTLMPGDICVLKNSPFELLVCVKTPS 188
           S   K+N+    N  N                       GDI +L      L +C++ P 
Sbjct: 103 SFIPKNNHTFNINQLN------------------KKFNRGDIVLLSQDLSNLYMCIELPQ 144

Query: 189 EAMDARFTFANTDGNVVYAWKTSVHLRFPTIFNTTEL---EILQREKLHGYSPVGSVKND 245
              D R++FAN++G++++A ++SV LR P    T  L   + LQ E   G   VG+VKN 
Sbjct: 145 STADPRYSFANSNGDIIFANRSSVLLRIPLQLPTNLLLSDDFLQPEPTQG---VGTVKNS 201

Query: 246 KDVTFVIPTLPRRMLISNVTFRIADAAVQQLPIIKKKLELIHRYLQSGSSPWQIPILKLV 305
            D  +V+P L R+++IS     I+  A   LPI+ KKL+L+HR LQ+      IP+++L 
Sbjct: 202 IDNPYVLPVLLRQLVISPSLSTISSNANNLLPIVLKKLQLLHRNLQAFKI---IPLVQLS 258

Query: 306 EICSNLEL----SNNIEKSIATAFMKSGLSSDALYSLANSHFELSSKVPNKVECSRLLAV 361
            +  NL+L    SN+ E  I+     S           N ++ + S     +  S L+A 
Sbjct: 259 SLVQNLDLTKATSNDGESYISNFIANS-----------NENYSIES-----INSSNLIAT 302

Query: 362 YWALLHQQGTQMWGEMTVHRGIFFPSAVTVLPLTKQHLHYHNIIHKLRQHGGVRINRIAA 421
           +WA+  QQ   +WG++   + + FP AV++LPL   +++Y  I+        + ++    
Sbjct: 303 FWAIRQQQQDHLWGDIHYSKALLFPLAVSILPLQSNYMYYKEIL------PAIELDHSIE 356

Query: 422 LINENDLASLNKSFPYIVPLLRDYAAGNLEHNDTITSLISSLFRKLDEYKELNISRDVCF 481
              +N + +    FP ++ LL+ YA+G +  +D I ++IS +FR LD+YK+ ++SRD+C 
Sbjct: 357 RFTKNGIPNTPNEFPQLLNLLKQYASGAVLMDDKIVTMISKIFRNLDDYKKYDVSRDLCQ 416

Query: 482 DLLKRINPSEPP--NPLLINHELQLPVNNERVKLEQKIYDLAVPPKIEHSAEIRTEYKDL 539
            L   + P E    N LL N +L LP+ + R + ++K+Y +  P +  +++  R ++ DL
Sbjct: 417 KLYNELVPKEQKIQNSLLYNTDLALPLASNRTEEQEKVYQMYNPIQTSNNSN-RHDFGDL 475

Query: 540 ICYCIDSPDAHEIDDAVSIKSLGGAKYRIYIHVADPASLFPEANEDGTTI-NSPVLDIAY 598
             +CID   AHEIDD VSI+      Y +++H+ADP+S F   N+    I N  +L IA 
Sbjct: 476 RVFCIDEKTAHEIDDGVSIEYKQNNVYTLHVHIADPSSYFKICNDHNVNIENDEILKIAL 535

Query: 599 QRAFTTYLPDKVFPMLPTTYARSSDLGQFGKPTKAVTFSVDCTFSKSK-GLCLLKDSLKV 657
           QR+FTTYLPD+V PMLP    R++DLG+ G+ TK +TFSVD   +K    + +L ++ +V
Sbjct: 536 QRSFTTYLPDQVLPMLPKLLCRAADLGKTGEKTKTITFSVDVKLNKKDMTVKVLDNTFQV 595

Query: 658 ELSVLHKSTR-ITYEAVDELLDEPTTKPKSGKHE-DLKTLFYIAKALRRQRIVDGGAVVF 715
            L  +    + +TY  VD +L++     +  K E DLK++F IAK L   RI++   +  
Sbjct: 596 RLGYVSNFVKDMTYSDVDSILNDSKESGRDKKVEKDLKSMFLIAKGLNNSRIMNNAVIFS 655

Query: 716 ENSSTGIVSLSPDD-NSELVEVSFKDQIETKSTILVSELMILANSLTASYFEENQIPGIY 774
           +  + G + L+ D+   E+ +++FK    T S ILVSELMILANSL   +F EN IP IY
Sbjct: 656 DEINNGKIELTKDEITGEVTQINFKGGKFTDSNILVSELMILANSLAGKFFAENGIPAIY 715

Query: 775 RGYRPLNVVEDATSVPEWVKAKTQENKIISKADIAKMKSFLTSSFYSSLPTPHDMLGTSH 834
           R Y  L + +DA S    + +  +  K  +  DI K+ S   +S +++ P+PH M+ T +
Sbjct: 716 RSYSDLLLGKDAQSEYNAMLSNLKLGKRPTLKDINKISSLFNTSKFTTYPSPHSMIATKY 775

Query: 835 YLTITSPLRRFPDLVNHLQLHRTLKGLPLLYKQSQLDGMVWHILTRDVTLKNASVDAQRY 894
           Y T+TSPLRRFPD++NHLQ+HR L   PL + Q  L+ M W+I T+DV L+++S     Y
Sbjct: 776 YATVTSPLRRFPDMINHLQIHRILSKQPLCFTQRDLENMNWNIQTKDVILRSSSRMINTY 835

Query: 895 WTLRFLKKEI-EDPTKNNWKLQITSLTDNGYAHCVILDKAFAVGQLKINLN-KNPPLVGD 952
           WTLR +K ++ EDP K  + + ITS+  NG AHC++   +FA G+L  + N ++ PL+GD
Sbjct: 836 WTLRHIKDQLSEDPDK-KFDVMITSVQQNGVAHCILAQFSFAKGKLVFDPNDESHPLIGD 894

Query: 953 QISDCEISNIQCLDGILQF 971
            +S+C+I+ I CL  +L+F
Sbjct: 895 TVSNCKITKIDCLGNVLEF 913

>NDAI0K00320 Chr11 (60516..63404) [2889 bp, 962 aa] {ON} Anc_8.853
           YMR287C
          Length = 962

 Score =  536 bits (1381), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 331/944 (35%), Positives = 526/944 (55%), Gaps = 59/944 (6%)

Query: 48  QEDEEVI---FFSQDKDILPEVEIKPFRRTKAETLMRFNDRFVQPSIDWYRKVGKSHGEN 104
           +ED ++I   F  +  D+ P++ +K   +   E   RFN R++QPS  WY    +S+ E 
Sbjct: 51  REDIQLIQANFLKRTNDLEPDIRLKTTAQIHYELDKRFNARYLQPSKSWY----ESNWEK 106

Query: 105 TDKDEFMHLLRNDISSSTLFEETLKWLSKDNYKLRNNTYNGYDTQEIEFYFDPSAIVSST 164
            ++      +R             + ++KD  + + N Y     + ++F  +    V+  
Sbjct: 107 LNEKRLTLSIR-------------ELINKDPAEFKFNYY-----KNLKFNIED---VTEP 145

Query: 165 LMPGDICVLKNSPFELLVCVKTPSEAMDARFTFANTDGNVVYAWKTSVHLRFPTIFNTTE 224
           L  GDI +LK +  E  +C+  P    D R+TF ++ G++++  ++ + L+ P       
Sbjct: 146 LKIGDIVLLKTNTSEFSMCIDLPQSLKDPRYTFISSTGDLIFGMRSMILLKIPFKLPGNI 205

Query: 225 LEILQREKLHGYSPVGSVKNDKDVTFVIPTLPRRMLISNVTFRIADAAVQQLPIIKKKLE 284
             ++ +E  H Y+P+G++K+  D T ++P + R++LI+ +  +I+  A +QLP+I KKLE
Sbjct: 206 ERLIIKEPAHKYNPIGTIKSSLDETVLVPVIARQLLINFMPAQISKCATKQLPVIIKKLE 265

Query: 285 LIHRYLQSGSSPWQIPILKLVEICSNLELSNNIEKSIATAFMKSGLSSDALYSLANSHFE 344
           L+HRYLQ  S P QI   KL+ I   L L    +      ++   L     Y    +   
Sbjct: 266 LLHRYLQDFSGPQQIHFHKLINIIEALNLDRATDYEKGNEYVNELLKQK--YYNDYTDLS 323

Query: 345 LSSKVPNKVECSRLLAVYWALLHQQGTQMWGEMTVHRGIFFPSAVTVLPLTKQHLHYHNI 404
           LSS     ++ +  L+ YWA++ QQ   +WGE+  +    FP+ VT+LP +  H++Y  +
Sbjct: 324 LSS-----LDATVALSTYWAIIEQQDLFLWGEIKRNSSSLFPTTVTILPFS-HHVYYTKL 377

Query: 405 IHKLRQHGGVRINRIAALINENDLAS----LNKSFPYIVPLLRDYAAGNLEHNDTITSLI 460
           I  LR++   R N  +A INE++L +    +   FP  + LL++Y AGNL  N  I +++
Sbjct: 378 IKSLRKNNFRRTNEFSAFINEHNLNTSSPEIQFKFPEFLHLLKEYCAGNLLDNPKIITIL 437

Query: 461 SSLFRKLDEYKELNISRDVCFDLLKRINPSEP--PNPLLINHELQLPVNNERVKLEQKIY 518
           S +FR L+++KE +I++D+ ++LL ++ P+     NPLL NH+L LP N+ R + + K+Y
Sbjct: 438 SKIFRNLNDFKERDITKDLAYELLTKLIPTSNLLANPLLANHDLSLPTNSGRGENQSKLY 497

Query: 519 DLAVPPKIE--HSAEIRTEYKDLICYCIDSPDAHEIDDAVSIKSLGGAK--YRIYIHVAD 574
           +LA P KIE   +   R  + DL  YCIDS  AHEIDD +SIK        Y   +    
Sbjct: 498 ELATPTKIESGETTTKRHNFNDLNVYCIDSETAHEIDDGISIKKYLKIDLLYSFILLTLQ 557

Query: 575 PASLFPEANEDGTTINSPVLDIAYQRAFTTYLPDKVFPMLPTTYARSSDLGQFGKPTKAV 634
             S+     E  T I+  +L IAY R+FTTYLPD V PMLP+ Y   SDLG+  +  + +
Sbjct: 558 FISMKDSNKEKKTGIDDDILKIAYYRSFTTYLPDNVVPMLPSKYCEMSDLGKSNQNIETL 617

Query: 635 TFSVDCTF----SKSKGLCLLKDSLKVELSVLHKSTRITYEAVDELLDEPTTKPKSGKHE 690
           TFSVD T     +  + L +L D+ K++  ++    ++TY+ VD++LD  T  P +   E
Sbjct: 618 TFSVDITIFDGSNNEETLKILYDTFKIQFGLVSNFPKVTYDTVDKILDNSTKIPDTSITE 677

Query: 691 DLKTLFYIAKALRRQRIVDGGAVVF-ENSSTGIVSLSPDDNSELVEVSFKDQIETKSTIL 749
           DL+ L  IAK LR+ RI +  A+VF E  + GI    PD  S   E+ F DQ  + S  L
Sbjct: 678 DLRQLSRIAKLLRKYRINENNAIVFGEGFNRGI----PDLQSTEDEIIFTDQKNSDSNEL 733

Query: 750 VSELMILANSLTASYFEENQIPGIYRGYRPLNVVEDATSVPEWVKAKTQENKIISKADIA 809
           VSE+MILAN+LT  Y ++++IP IYR Y PL++  +A      +++K  + ++ S  D+A
Sbjct: 734 VSEMMILANTLTGKYCKDHKIPVIYRCYSPLDIGPEAQQECIILRSKNID-RLPSNIDMA 792

Query: 810 KMKSFLTSSFYSSLPTPHDMLGTSHYLTITSPLRRFPDLVNHLQLHRTLKGLPLLYKQSQ 869
           KM SFL SS+YS  P+ H MLG+  Y T+TSPLRRFPDL+NH+QLH  LKG  L +  + 
Sbjct: 793 KMSSFLNSSYYSGTPSRHSMLGSDEYATVTSPLRRFPDLLNHIQLHNHLKGYQLPFTPNH 852

Query: 870 LDGMVWHILTRDVTLKNASVDAQRYWTLRFLKKEI-EDPTKNNWKLQITSLTDNGYAHCV 928
           +   +  I +R  TLKN         TL ++K  I ++PTK  + + +TS+   G A C 
Sbjct: 853 VAHYLTTIQSRSDTLKNIGNAVYTEMTLNYIKLLINKEPTK-AFDVLVTSVPIEGSARCA 911

Query: 929 ILDKAFAVGQLKINLNKNP-PLVGDQISDCEISNIQCLDGILQF 971
           I+   +A G +K+    NP P++GD I+ C+++ I  ++G L+ 
Sbjct: 912 IVGYEYARGTIKLKAEINPVPIIGDIITKCKVTKIFPIEGALEL 955

>TPHA0I00350 Chr9 complement(65929..68760) [2832 bp, 943 aa] {ON}
           Anc_8.853 YMR287C
          Length = 943

 Score =  508 bits (1309), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 327/937 (34%), Positives = 524/937 (55%), Gaps = 72/937 (7%)

Query: 55  FFSQDKDILPEVEIKPFRRTKAETLMRFNDRFVQPSIDWYRKVGKSHGENTDKDEFMHLL 114
           F  + K +    EIK     + +++M FN+ ++ PS  W+  V  S              
Sbjct: 44  FLERTKGLEHISEIKEVDEIQNQSMMTFNNEYIVPSKVWFDTVTSSGS-----------F 92

Query: 115 RNDISSSTLFEETLKWLSKDNYKLRNNTYNGYDTQEIEFYFDPSAIVSSTLMPGDICVLK 174
            ND+ + TL  +  KW    +  ++ N          ++ F+   +   +L  GD+ +L+
Sbjct: 93  SNDLINETLISK--KWKKFPDLPIKMNG---------DYSFNALQLFDRSLDIGDLVLLR 141

Query: 175 NSPFELLVCVKTPSEAMDARFTFANTDGNVVYAWKTSVHLRFPTIFNTTELEILQREKLH 234
           NS  ELL+CV  P    D RFTFA  DG +V++ K +V LR   I NT    IL  + + 
Sbjct: 142 NSDKELLMCVDIPMSIEDPRFTFAKPDGTLVFSTKQNVTLR---ILNTLPKNILNHDLIK 198

Query: 235 GYSPVGSVKNDKDVTFVIPTLP---RRMLISNVTFRIADAAVQQLPIIKKKLELIHRYLQ 291
                G +   ++    +P+LP   R++  S +   I+  A + L +  KKLE++HRY+ 
Sbjct: 199 NKYEAGLINRKENNAIKLPSLPVVARQIATSPLPSEISRIAARDLNVNLKKLEVLHRYIS 258

Query: 292 SGSSPWQIPILKLVEICSNLELSNNIEKSIATAFMKSGLSSDALYS---LANSHFELSSK 348
            G     I  LKLV +  N++L+            ++    DA +    + N+  ++  +
Sbjct: 259 DGVETSSISFLKLVHLVQNVDLN---------KLARNRADHDANHISNIIRNTKDDI--Q 307

Query: 349 VPNKVECSRLLAVYWALLHQQGTQMWGEMTVHRGIFFPSAVTVLPLTKQHLHYHNIIHKL 408
              K++   LL+ YWA++ QQ +Q+WG++ +H  + FP +V+VLP       ++N+I+  
Sbjct: 308 YMTKIDAITLLSTYWAVIQQQQSQLWGDIQIHSALLFPISVSVLP-------FNNVIYLN 360

Query: 409 ----RQHGGVRINRIAALINENDLASLNKSFPYIVPLLRDYAAGNLEHNDTITSLISSLF 464
               R      IN+    IN+++L  +N+ FP  + +L++Y  G    N+ IT++IS LF
Sbjct: 361 ETIPRVATDENINKFTEAINKHNLEKINEKFPDFLNMLKEYGNGCYYGNEKITTIISKLF 420

Query: 465 RKLDEYKELNISRDVCFDLLKRINPSEPP-NPLLINHELQLPVNNERVKLEQKIYDLAVP 523
           R+++ YK   +SRD C  L   +NPS    N LL++ +L LP  +   + EQ IY L   
Sbjct: 421 RRIETYKNKELSRDNCQKLYNELNPSNKILNSLLLSKDLCLPEISGTTRTEQLIYSLT-- 478

Query: 524 PKIEHSAEI---RTEYKDLICYCIDSPDAHEIDDAVSIKSLGGAKYRIYIHVADPASLFP 580
            ++++ A I   R ++KDL  +CID   AHEIDD VS+    G   R++IH+ADPASLFP
Sbjct: 479 -EVDNHAIIDQRRHDFKDLKVFCIDEKTAHEIDDGVSVLRKDGNITRLFIHIADPASLFP 537

Query: 581 EANE-DGTTINSPVLDIAYQRAFTTYLPDKVFPMLPTTYARSSDLGQFGKPTKAVTFSVD 639
             N  +  + +  +L+IA++RAFTTYLP+ V PMLP ++   SDLG  GK T  +TFSVD
Sbjct: 538 LHNTIENNSTSDEILNIAFRRAFTTYLPEFVLPMLPKSFCTKSDLGNTGKMTNTITFSVD 597

Query: 640 CTFSKSKGLCLLKDSLKVELSVLHKSTR-ITYEAVDELLDEPTTKPKSGKHEDLKTLFYI 698
             F KS    +L+D+ +++L  ++   +  TY+ VD++L+  + K ++    DL+ + +I
Sbjct: 598 --FDKS-SCSILEDTFEIQLGKVNNFPKNTTYKEVDKILNS-SIKRENDIERDLREMRFI 653

Query: 699 AKALRRQRIVDGGAVVF-ENSSTGIVSL--SPDDNSELVEVSFKDQIETKSTILVSELMI 755
           A  LR+ RI D  AV+F E  + G V+L     D  +  +V+FKD   T S I+VSE MI
Sbjct: 654 ANHLRKCRI-DNSAVIFGEGFNKGAVNLIEKKQDGEKSYKVNFKDSETTPSNIIVSEFMI 712

Query: 756 LANSLTASYFEENQIPGIYRGYRPLNVVEDATSVPEWVKAKTQENKIISKADIAKMKSFL 815
           LANSL   YF+ ++IP IY+ Y+ LN+   A+S  + +     + ++ S  +I+K+ S L
Sbjct: 713 LANSLAGKYFKNHKIPAIYKTYKGLNMKPKASSQFKKI-LNVNKKRLPSIKEISKIGSLL 771

Query: 816 TSSFYSSLPTPHDMLGTSHYLTITSPLRRFPDLVNHLQLHRTLKGLPLLYKQSQLDGMVW 875
           +SS +SS P+ H+M+GT  Y T+TSPLRRFPDL+NH QLHR L   PL + Q +LD MVW
Sbjct: 772 SSSTFSSKPSIHEMIGTDQYATVTSPLRRFPDLINHFQLHRYLTNQPLCFSQEKLDEMVW 831

Query: 876 HILTRDVTLKNASVDAQRYWTLRFLKKEIEDPTKNNWKLQITSLTDNGYAHCVILDKAFA 935
           H++ RD  L++ S    +YWTL++L ++IE      + + + S+++NG  HC++   ++A
Sbjct: 832 HLIERDTILRHYSRKFNKYWTLQYLNEKIEGNPLLRFDVMVQSVSENGRVHCILPKLSYA 891

Query: 936 VGQLKINLNKNP-PLVGDQISDCEISNIQCLDGILQF 971
            G LK+  +    P +G+ I +C+I+NI CL   L+F
Sbjct: 892 TGTLKLKPSATTIPAIGEIIKNCKIANIDCLGNSLEF 928

>TBLA0B02920 Chr2 complement(671467..674556) [3090 bp, 1029 aa] {ON}
            Anc_8.853 YMR287C
          Length = 1029

 Score =  474 bits (1220), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 317/1021 (31%), Positives = 545/1021 (53%), Gaps = 127/1021 (12%)

Query: 41   NVTTESLQEDEEV-----IFFSQDKDILPEVEIKPFRRTKAETLMRFNDRFVQPSIDWYR 95
            NVT  +   +E++      F  + K++ P + IK       E   RF  RF+ PS  W+ 
Sbjct: 43   NVTKHNKLSNEDIEKIKQTFLIRIKELDPSITIKELPEITNEYRKRFLQRFIIPSSKWFN 102

Query: 96   KVGKSHGENTDK-DEFMHLLRNDISSSTLFEETLKWLSKDNYKLRNNTYNGYDTQEIEFY 154
             +       T K  ++M      ++S+  F+    W  K    + +N++N   T+     
Sbjct: 103  SIEWDSRTITPKFSKYM------LNSTFSFDA---WYQK----IISNSFNLTFTKH-SLE 148

Query: 155  FDPSAIVSSTLMPGDICVLKNSPFELLVCVKTPSEAMDARFTFANTDGNVVYAWKTSVHL 214
             DP  I       GD+ +L +S   LL+CV  P    D R+TFA++DG + +  ++++ L
Sbjct: 149  LDPLNI-------GDLILLPDSS-NLLMCVDIPHNTKDPRYTFASSDGKLFFKTRSNIPL 200

Query: 215  RFPTIFNTTELE--ILQREKLHGYSPVGSVKNDKDVTFVIPTLPRRMLISNVTFRIADAA 272
            R P       ++  +L  E  HG + +G++KN +++  ++P + R++++  +   +  +A
Sbjct: 201  RIPNKLPNYLMDSRLLFTEFDHGNNSIGTIKNTQNIKILLPIIARQLVVRPILNNLNKSA 260

Query: 273  VQQLPIIKKKLELIHRYLQSGSSPWQIPILKLVEICSNLELS---NNIEKSIATAFMKSG 329
              +L II KKLELIHR +Q+G+ P+QI   KL+++   L L+   N+ +  I   F K  
Sbjct: 261  NDKLSIILKKLELIHRLIQNGNGPYQISFFKLIKLIDILNLNDFDNSKKFDINLNFSKL- 319

Query: 330  LSSDALYSLANSHFELSSKVPNKVECSRLLAVYWALLHQQGTQMWGEMTVHRGIFFPSAV 389
            LSS+ + SL +S          +++ S  LA YWA+  QQ   +WG++ V++ +  P +V
Sbjct: 320  LSSNEIESLNSS---------TEIDASTFLATYWAIRLQQQDFLWGKIQVNKALLSPISV 370

Query: 390  TVLPLTKQHLHYHNIIHKLRQHGGVRINR--IAALINE---------------------- 425
            TVLPL   H +Y+N +   R +  ++  +  + + I++                      
Sbjct: 371  TVLPLVLYHNYYNNFLQ--RSNNAIKNGKSLLDSFIDDINNQSTTNTTNNNNNTTIITTT 428

Query: 426  -------NDLASLNKSFPYIVPLLRDYAAGNLEHNDTITSLISSLFRKLDEYKELNISRD 478
                   +   ++++++P  + + ++Y AGN + N  I +LIS + R+L ++K+ ++++D
Sbjct: 429  TTNNNKLDSSKNISQNYPEFINIFQNYCAGNFDDNSKIIALISKILRRLTKFKDSDLTKD 488

Query: 479  VCFDLL-------------------------------------KRINPSEPPNPLLINH- 500
             C +LL                                       IN  +P   LL N+ 
Sbjct: 489  TCKELLDLCTSKGTSKGTSGDASGDASRNTSKDSSQGTSKDTPNGINNQDPQFNLLHNNI 548

Query: 501  ELQLPVNNERVKLEQKIYDLAVPPKIEHSAEIRTEYKDLICYCIDSPDAHEIDDAVSIKS 560
            E+ LP +++  K +   Y+L  PPK+   ++   ++ DL  YCIDS  AHEIDD +SI+ 
Sbjct: 549  EIALPNSSKLTKDQTLFYNLIEPPKLTQFSKFHHDFNDLKVYCIDSETAHEIDDGISIEK 608

Query: 561  LGGAKYRIYIHVADPASLFPEANEDGTTINSPVLDIAYQRAFTTYLPDKVFPMLPTTYAR 620
            L    + ++IH+ADP+S+F    ++    N  +L++A  ++FTTYLPD V PMLP ++ +
Sbjct: 609  LNNNLFTLHIHIADPSSIFLNHEKNSDIQN--LLNMALSKSFTTYLPDLVSPMLPKSFCK 666

Query: 621  SSDLGQFGKPTKAVTFSVDCTF-SKSKGLCLLKDSLKVELSVLHK-STRITYEAVDELLD 678
             SDLG   + T  ++FSV+    S ++ + +L ++ KV L ++ K  +  TY+ VD +L 
Sbjct: 667  LSDLGYDNQKTATISFSVNVEVDSNNESIKILHNTFKVRLGIVSKFPSNTTYDNVDRILS 726

Query: 679  EPTTKP-KSGK----HEDLKTLFYIAKALRRQRIVDGGAVVF-ENSSTGIVSLSPDDNSE 732
              T +  KSG       DL+ L  I+  L++ RI +G AV+F E  + G+V+LS   +  
Sbjct: 727  NSTEENLKSGVTSDIQNDLRNLSQISNLLKKNRIQNGNAVIFGEGFNKGLVTLSCSKDGG 786

Query: 733  LVEVSFKDQIETKSTILVSELMILANSLTASYFEENQIPGIYRGYRPLNVVEDATSVPEW 792
             V ++FKDQ +TKS  LV+E+MILANSL A  F+EN+IPGI+R Y  L++ + A    + 
Sbjct: 787  PV-INFKDQNDTKSVTLVTEMMILANSLAARLFKENKIPGIFRCYHELHLAKKAQLEFDI 845

Query: 793  VKAKTQENKIISK-ADIAKMKSFLTSSFYSSLPTPHDMLGTSHYLTITSPLRRFPDLVNH 851
            ++   + N  +    +I+K  S L SSFY+ LP PH M+G ++YLT+TSPLRRFPDLVNH
Sbjct: 846  LRENIKVNSHLPNIKEISKFGSLLNSSFYTDLPLPHQMIGAANYLTVTSPLRRFPDLVNH 905

Query: 852  LQLHRTLKGLPLLYKQSQLDGMVWHILTRDVTLKNASVDAQRYWTLRFLKKEIEDPTKNN 911
            +Q+   +K  P  Y  + +  M+  I +RD+ ++  S    +Y+ L +LK++I+      
Sbjct: 906  MQIQHFIKKKPFKYSTTDIQKMLPIIQSRDIIIRELSGKCNKYYLLNYLKEQIKKNPSQT 965

Query: 912  WKLQITSLTDNGYAHCVILDKAFAVGQLKINLNKN-PPLVGDQISDCEISNIQCLDGILQ 970
            + + ITS+++ G+ HC++ + + ++G LK+  + +  P +GD I +C+I  I  LDG L 
Sbjct: 966  FDVLITSVSNLGFIHCILPNFSSSMGILKLKPDLDFTPSIGDVIRNCKIDKIDALDGRLD 1025

Query: 971  F 971
            F
Sbjct: 1026 F 1026

>CAGL0H04411g Chr8 complement(415101..418124) [3024 bp, 1007 aa]
           {ON} highly similar to uniprot|Q08162 Saccharomyces
           cerevisiae YOL021c DIS3
          Length = 1007

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 99/406 (24%), Positives = 166/406 (40%), Gaps = 60/406 (14%)

Query: 496 LLINHELQLPVNNERV--KLEQKIYDLAVPPKIEHSAEI--------RTEYKDLICYCID 545
           LL+ H+++    +++V   L  + +D   P K+  SA I        R + +D +   ID
Sbjct: 490 LLLEHDVEYRPFSKKVLDCLPSEGHDWKAPEKLSDSAAIAKDPLLPKRRDLRDKLICSID 549

Query: 546 SPDAHEIDDAVSIKSLGGAKYRIYIHVADPASLFPEANEDGTTINSPVLDIAYQRAFTTY 605
            P+  +IDDA+  K L    + + +H+AD         + GT +++        R  + Y
Sbjct: 550 PPNCVDIDDALHAKMLENGNWEVGVHIADVTHFV----KPGTALDAE----GASRGTSVY 601

Query: 606 LPDKVFPMLPTTYARSSDLGQFGKPTKAVTFSVDCTFSKSKGLCLLKDSLKVELSVLHKS 665
           L DK   MLP      +DL           FSV     +   +     ++    SV+   
Sbjct: 602 LVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVLWELDQDANIV----NVDFTKSVIRSR 655

Query: 666 TRITYEAVDELLDEPTTKPKSGKHEDLKTLFYIAKALRRQRIVDGGAVVFENSSTGIVSL 725
              +YE     +D+P    +    + ++ L  ++K L+++R+ D GA+   N ++  V +
Sbjct: 656 EAFSYEQAQIRIDDPNQTDELT--QGMRALLQLSKKLKQKRL-DAGAL---NLASPEVKV 709

Query: 726 SPD-DNSELVEVSFKDQIETKSTILVSELMILANSLTASYFEEN--QIPGIYRGYRP--- 779
             D + S+  EV  K  + T S  LV E M+LAN   A    ++  Q   + R   P   
Sbjct: 710 HMDSETSDPNEVEIKKLLATNS--LVEEFMLLANISVARKIYDSFPQTAMLRRHAAPPST 767

Query: 780 --------LNVVEDATSVPEWVKAKTQE-NKIISKAD-----IAKMKS--------FLTS 817
                   L   +  T   E  KA     ++ + K D     + ++ S        +  S
Sbjct: 768 NFEILNEMLQTKKGLTISLESSKALADSLDRCVDKNDPYFNTLVRIMSTRCMMAAQYFYS 827

Query: 818 SFYSSLPTPHDMLGTSHYLTITSPLRRFPDLVNHLQLHRTLKGLPL 863
             YS     H  L    Y   TSP+RR+ D+V H QL   +   PL
Sbjct: 828 GAYSYSDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAAAIGYEPL 873

>KLLA0A10835g Chr1 (938712..941738) [3027 bp, 1008 aa] {ON} highly
           similar to uniprot|Q08162 Saccharomyces cerevisiae
           YOL021C DIS3 Nucleolar exosome component involved in
           rRNA processing and RNA degradation binds Gsp1p/Ran and
           enhances the GEF activity of Srm1p implicated in mitotic
           control homologous to the E. coli RNase R of the RNase
           II family
          Length = 1008

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 104/473 (21%), Positives = 191/473 (40%), Gaps = 64/473 (13%)

Query: 519 DLAVPPKIEHSAEI--RTEYKDLICYCIDSPDAHEIDDAVSIKSLGGAKYRIYIHVADPA 576
           DL  P  I +   +  R +++D +   ID P   +IDDA+  K L    + + +H+AD  
Sbjct: 523 DLTDPEAIRNDPLLPSRKDFRDKLICSIDPPGCVDIDDALHAKQLPNGNWEVGVHIADVT 582

Query: 577 SLFPEANEDGTTINSPVLDIAYQRAFTTYLPDKVFPMLPTTYARSSDLGQFGKPTKAVTF 636
                  + GT +++        R  + YL DK   MLP      +DL           F
Sbjct: 583 HFV----KPGTALDAE----GASRGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAF 632

Query: 637 SVDCTFSKSKGLCLLKDSLKVELSVLHKSTRITYEAVDELLDEPTTKPKSGKHEDLKTLF 696
           SV         +      +    SV+      +YE     +D+ T K +      ++ L 
Sbjct: 633 SVVWELDNDANIV----GVDFTKSVIRSREAFSYEKAQNRIDDETAKDELTL--GMRALL 686

Query: 697 YIAKALRRQRIVDGGAVVFENSSTGIVSLSPD-DNSELVEVSFKDQIETKSTILVSELMI 755
            ++K L+++R+ D GA+   N ++  V +  D + S+  EV  K  ++T S  LV E M+
Sbjct: 687 QLSKKLKQKRL-DAGAL---NLASPEVKVHMDSETSDPNEVEIKKLLDTNS--LVEEFML 740

Query: 756 LANSLTASYFEEN--QIPGIYRGYRP----LNVVEDATSVPEWVKAKTQENKIISKA--- 806
           LAN   A    E   Q   + R   P      ++ +   V + +    + +K ++ +   
Sbjct: 741 LANISVARKIYEAFPQTAMLRRHAAPPSTNFELLNEMLQVRKGMSISLESSKALADSLDR 800

Query: 807 -------------DIAKMKSFLTSSF-----YSSLPTPHDMLGTSHYLTITSPLRRFPDL 848
                         I   +  + + +     +S     H  L    Y   TSP+RR+ D+
Sbjct: 801 CEDPNDSYLNTLIRIMSTRCMMAAQYFHAGAFSYADFRHYGLAVDIYTHFTSPIRRYCDV 860

Query: 849 VNHLQLHRTL--KGLPLLYKQSQLDGMVWHILTRDVTLKNASVDAQRYWTLRFLKKEIED 906
           V H QL   +  + L L ++  Q   M+     R++  K+ +       ++ +   ++  
Sbjct: 861 VAHRQLAGAIGYEALDLSHRDKQKMEMI----CRNINKKHRNAQFAGRASIEYYVGQVMR 916

Query: 907 PTKNNWKLQITSLTDNGYAHCVILDKAFAVGQLKI-NLNKNP---PLVGDQIS 955
             ++     +  + +NG A  V++ K    G +++ NL +NP     + DQ S
Sbjct: 917 NNESTETGYVIKVFNNGIA--VLVPKFGVEGLIRLENLTENPQSAEFIEDQFS 967

>KAFR0C04530 Chr3 (904255..907257) [3003 bp, 1000 aa] {ON} Anc_1.367
           YOL021C
          Length = 1000

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 90/359 (25%), Positives = 146/359 (40%), Gaps = 50/359 (13%)

Query: 533 RTEYKDLICYCIDSPDAHEIDDAVSIKSLGGAKYRIYIHVADPASLFPEANEDGTTINSP 592
           RT+ +D +   ID P   +IDDA+  K L    + + +H+AD         + GT +++ 
Sbjct: 530 RTDLRDKLICSIDPPGCVDIDDALHAKRLPNGNWEVGVHIADVTHFV----KPGTALDAE 585

Query: 593 VLDIAYQRAFTTYLPDKVFPMLPTTYARSSDLGQFGKPTKAVTFSVDCTFSKSKGLCLLK 652
                  R  + YL DK   MLP      +DL           FSV    ++   +    
Sbjct: 586 ----GASRGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVIWELNEDADIV--- 636

Query: 653 DSLKVELSVLHKSTRITYEAVDELLDEPTTKPKSGKHEDLKTLFYIAKALRRQRIVDGGA 712
            ++    SV+      +YE     +D+   K +      ++ L +++K L+++R+ D GA
Sbjct: 637 -NVDFTKSVIRSREAFSYEQAQVRIDDSNQKDELTL--GMRALLHLSKKLKQKRL-DAGA 692

Query: 713 VVFENSSTGIVSLSPD-DNSELVEVSFKDQIETKSTILVSELMILANSLTAS--YFEENQ 769
           +   N ++  V +  D + S+  EV  K  + T S  LV E M+LAN   A   Y    Q
Sbjct: 693 L---NLASPEVKVHMDSETSDPGEVEIKKLLATNS--LVEEFMLLANISVARKIYDAFPQ 747

Query: 770 IPGIYRGYRP-----------LNVVEDATSVPEWVKAKTQE-NKIISKAD-----IAKMK 812
              + R   P           L+  ++ T   E  KA     ++ I   D     + ++ 
Sbjct: 748 TAMLRRHAAPPSTNFELLNEMLHQRKNMTISLESSKALADSLDRCIDPQDAYFNTLVRIM 807

Query: 813 S--------FLTSSFYSSLPTPHDMLGTSHYLTITSPLRRFPDLVNHLQLHRTLKGLPL 863
           S        +  S  YS     H  L    Y   TSP+RR+ D+V H QL   +   PL
Sbjct: 808 STRCMMAAQYFYSGAYSYPDFKHYGLAVDIYTHFTSPIRRYCDVVAHRQLAAAIDYEPL 866

>Ecym_2715 Chr2 complement(1383023..1385989) [2967 bp, 988 aa] {ON}
           similar to Ashbya gossypii AEL031C
          Length = 988

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 86/350 (24%), Positives = 141/350 (40%), Gaps = 50/350 (14%)

Query: 533 RTEYKDLICYCIDSPDAHEIDDAVSIKSLGGAKYRIYIHVADPASLFPEANEDGTTINSP 592
           R + +D +   ID P   +IDDA+  K L    + + +H+AD  + F + N   T +++ 
Sbjct: 519 RRDMRDKLICSIDPPGCVDIDDALHAKKLINGNWEVGVHIAD-VTHFVKPN---TALDAE 574

Query: 593 VLDIAYQRAFTTYLPDKVFPMLPTTYARSSDLGQFGKPTKAVTFSVDCTFSKSKGLCLLK 652
                  RA + YL DK   MLP      +DL           FSV         +    
Sbjct: 575 ----GASRATSVYLVDKRIDMLPMLLG--TDLCSLKASVDRFAFSVIWELDNDANIV--- 625

Query: 653 DSLKVELSVLHKSTRITYEAVDELLDEPTTKPKSGKHEDLKTLFYIAKALRRQRIVDGGA 712
            S++   SV+      +YE     +D+P    +      ++ L  ++K L+++R+ D GA
Sbjct: 626 -SVEFTKSVIRSREAFSYEQAQLRIDDPNQNDELTL--GMRALLQLSKKLKQKRL-DAGA 681

Query: 713 VVFENSSTGIVSLSPD-DNSELVEVSFKDQIETKSTILVSELMILANSLTASYFEEN--Q 769
           +   N ++  V +  D + S+  EV  K  + T S  LV E M+LAN   A    ++  Q
Sbjct: 682 L---NLASPEVKVHMDSETSDPSEVEIKKLLSTNS--LVEEFMLLANISVARKIYDSFPQ 736

Query: 770 IPGIYRGYRP-----------LNVVEDATSVPEWVKAKTQE-NKIISKADI--------- 808
              + R   P           L V ++ +   E  KA     ++ +   D+         
Sbjct: 737 TAMLRRHAAPPSTNFESLNEMLQVRKNMSISLESSKALADSLDRCVDSDDVYFNTLVRIM 796

Query: 809 ----AKMKSFLTSSFYSSLPTPHDMLGTSHYLTITSPLRRFPDLVNHLQL 854
                    +  S  YS     H  L    Y   TSP+RR+ D++ H QL
Sbjct: 797 STRCMMAAQYFYSGAYSYSDFRHYGLAVDIYTHFTSPIRRYCDIIAHRQL 846

>TDEL0D02380 Chr4 complement(463000..465993) [2994 bp, 997 aa] {ON}
           Anc_1.367 YOL021C
          Length = 997

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 87/359 (24%), Positives = 149/359 (41%), Gaps = 50/359 (13%)

Query: 533 RTEYKDLICYCIDSPDAHEIDDAVSIKSLGGAKYRIYIHVADPASLFPEANEDGTTINSP 592
           R + +D +   ID P   +IDDA+  K L    + + +H+AD  + F + N   T +++ 
Sbjct: 527 RRDLRDKLICSIDPPGCVDIDDALHAKRLSNGNWEVGVHIAD-VTHFVKPN---TALDAE 582

Query: 593 VLDIAYQRAFTTYLPDKVFPMLPTTYARSSDLGQFGKPTKAVTFSVDCTFSKSKGLCLLK 652
                  R  + YL DK   MLP      +DL       +   FSV      +  +  + 
Sbjct: 583 ----GASRGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVERFAFSVIWELDDNANIVNV- 635

Query: 653 DSLKVELSVLHKSTRITYEAVDELLDEPTTKPKSGKHEDLKTLFYIAKALRRQRIVDGGA 712
           D +K   SV+      +YE     +D+P  K +    E ++ L  ++  L+++R+ D GA
Sbjct: 636 DFMK---SVIKSREAFSYEQAQLRIDDPNQKDELT--EGMRALLQLSIKLKQKRL-DAGA 689

Query: 713 VVFENSSTGIVSLSPD-DNSELVEVSFKDQIETKSTILVSELMILAN-SLTASYFEE-NQ 769
           +   N ++  V +  D + S+  EV  K  + T S  LV E M+LAN S+    F+   Q
Sbjct: 690 L---NLASPEVKVHMDSETSDPNEVEIKKLLATNS--LVEEFMLLANISVARKIFDAFPQ 744

Query: 770 IPGIYRGYRP----LNVVEDATSVPEWVKAKTQENKIISKA-------------DIAKMK 812
              + R   P       + +     + +    + +K ++ +              + ++ 
Sbjct: 745 TAMLRRHAAPPSTNFETLNEMLQTRKGLSISIESSKALADSLDRCIDPQDPYFNTLVRIM 804

Query: 813 S--------FLTSSFYSSLPTPHDMLGTSHYLTITSPLRRFPDLVNHLQLHRTLKGLPL 863
           S        +  S  YS     H  L    Y   TSP+RR+ D+V H QL   +   PL
Sbjct: 805 STRCMMAAQYFYSGAYSYADFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAGAIGYEPL 863

>SAKL0D10186g Chr4 (852303..855269) [2967 bp, 988 aa] {ON} highly
           similar to uniprot|Q08162 Saccharomyces cerevisiae
           YOL021C DIS3 Nucleolar exosome component involved in
           rRNA processing and RNA degradation binds Gsp1p/Ran and
           enhances the GEF activity of Srm1p implicated in mitotic
           control homologous to the E. coli RNase R of the RNase
           II family
          Length = 988

 Score = 60.8 bits (146), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 98/406 (24%), Positives = 166/406 (40%), Gaps = 60/406 (14%)

Query: 496 LLINHELQLPVNNERV--KLEQKIYDLAVPPKIEHSAEI--------RTEYKDLICYCID 545
           LL+ H+++    +++V   L  + +D   P  ++ S  I        R + +D +   ID
Sbjct: 471 LLLEHDVEYRPFSKKVLECLPSEGHDWKAPVSLDDSDAISKDPLLPKRRDLRDKLICSID 530

Query: 546 SPDAHEIDDAVSIKSLGGAKYRIYIHVADPASLFPEANEDGTTINSPVLDIAYQRAFTTY 605
            P   +IDDA+  K L    + + +H+AD  + F +A   GT +++        R  + Y
Sbjct: 531 PPGCVDIDDALHAKQLPNGNWEVGVHIAD-VTHFVKA---GTPLDAE----GASRGTSVY 582

Query: 606 LPDKVFPMLPTTYARSSDLGQFGKPTKAVTFSVDCTFSKSKGLCLLKDSLKVELSVLHKS 665
           L DK   MLP      +DL           FSV     +   +     ++    SV+   
Sbjct: 583 LVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVIWELDQKASIV----NVDFTKSVIRSR 636

Query: 666 TRITYEAVDELLDEPTTKPKSGKHEDLKTLFYIAKALRRQRIVDGGAVVFENSSTGIVSL 725
              +YE     +D+P  K +    + ++ L  ++  L+++R+ D GA+   N ++  V +
Sbjct: 637 EAFSYEQAQLRIDDPNQKDELT--QGMRALLNLSVKLKQKRL-DAGAL---NLASPEVKV 690

Query: 726 SPD-DNSELVEVSFKDQIETKSTILVSELMILANSLTASYFEEN--QIPGIYRGYRP--- 779
             D + S+  +V  K  + T S  LV E M+LAN   A    E   Q   + R   P   
Sbjct: 691 HMDSETSDPGDVEIKKLLATNS--LVEEFMLLANISVAKKIYEAFPQTAMLRRHAAPPST 748

Query: 780 --------LNVVEDATSVPEWVKAKTQE-NKIISKAD-----IAKMKS--------FLTS 817
                   L + +  +   E  KA     ++ I   D     + ++ S        +  S
Sbjct: 749 NFETLNEMLQLRKSMSISLESSKALADSLDRCIDPQDPYFNTLVRIMSTRCMMAAQYFYS 808

Query: 818 SFYSSLPTPHDMLGTSHYLTITSPLRRFPDLVNHLQLHRTLKGLPL 863
             YS     H  L    Y   TSP+RR+ D+V H QL   +   PL
Sbjct: 809 GAYSYADFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAGAIGYEPL 854

>KLTH0H13420g Chr8 (1172833..1175793) [2961 bp, 986 aa] {ON} highly
           similar to uniprot|Q08162 Saccharomyces cerevisiae
           YOL021C DIS3 Nucleolar exosome component involved in
           rRNA processing and RNA degradation binds Gsp1p/Ran and
           enhances the GEF activity of Srm1p implicated in mitotic
           control homologous to the E. coli RNase R of the RNase
           II family
          Length = 986

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 87/375 (23%), Positives = 152/375 (40%), Gaps = 52/375 (13%)

Query: 519 DLAVPPKI--EHSAEIRTEYKDLICYCIDSPDAHEIDDAVSIKSLGGAKYRIYIHVADPA 576
           DL+ P  I  +H    R + +D +   ID P   +IDDA+  K L    + + +H+AD  
Sbjct: 500 DLSSPEAIAKDHLLPKRRDLRDKLICSIDPPGCVDIDDALHAKKLPNGNWEVGVHIAD-V 558

Query: 577 SLFPEANEDGTTINSPVLDIAYQRAFTTYLPDKVFPMLPTTYARSSDLGQFGKPTKAVTF 636
           + F +A       N+P+      R  + YL DK   MLP      ++L           F
Sbjct: 559 THFVKA-------NTPLDAEGASRGTSVYLVDKRIDMLPMLLG--TNLCSLKPYVDRFAF 609

Query: 637 SVDCTFSKSKGLCLLKDSLKVELSVLHKSTRITYEAVDELLDEPTTKPKSGKHEDLKTLF 696
           SV     ++  +     ++    SV+      +YE     +D+ + K +    + ++ L 
Sbjct: 610 SVLWELDENANIV----NVDFTKSVIKSREAFSYEQAQLRIDDESQKDELT--QGMRALL 663

Query: 697 YIAKALRRQRIVDGGAVVFENSSTGIVSLSPD-DNSELVEVSFKDQIETKSTILVSELMI 755
            ++  L+++R+ D GA+   N ++  V +  D + S+  EV  K  + T S  LV E M+
Sbjct: 664 QLSIKLKQKRL-DAGAL---NLASPEVKVHMDSETSDPGEVEIKKLLATNS--LVEEFML 717

Query: 756 LANSLTASYFEEN--QIPGIYRGYRP----LNVVEDATSVPEWVKAKTQENKIISKA--- 806
           LAN   A    E   Q   + R   P       + +   + + +    + +K ++ +   
Sbjct: 718 LANISVARRIYEAFPQTAMLRRHAAPPATNFETLNEMLQLRKGMSISLESSKALANSLDR 777

Query: 807 -------------DIAKMKSFLTSSF-----YSSLPTPHDMLGTSHYLTITSPLRRFPDL 848
                         I   +  + + +     YS     H  L    Y   TSP+RR+ D+
Sbjct: 778 CVDLEDPYFNTLVRIMSTRCMMAAQYFYAGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDV 837

Query: 849 VNHLQLHRTLKGLPL 863
           V H QL   +   PL
Sbjct: 838 VAHRQLAAAIGYEPL 852

>TBLA0D05070 Chr4 (1255978..1258971) [2994 bp, 997 aa] {ON}
           Anc_1.367 YOL021C
          Length = 997

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 109/461 (23%), Positives = 183/461 (39%), Gaps = 67/461 (14%)

Query: 520 LAVPPKIEHSAEIRTEYKDLICYCIDSPDAHEIDDAVSIKSLGGAKYRIYIHVADPASLF 579
           LA  P++    ++R +   LIC  ID P   +IDDA+  K L    + + +H+AD     
Sbjct: 518 LAKDPQLARRKDLRDK---LIC-SIDPPGCVDIDDALHAKKLPNGNWEVGVHIADVTHFV 573

Query: 580 PEANEDGTTINSPVLDIAYQRAFTTYLPDKVFPMLPTTYARSSDLGQFGKPTKAVTFSVD 639
                     N+P+      R  + YL DK   MLP      +DL           FSV 
Sbjct: 574 KP--------NTPLDAEGASRGTSVYLVDKRIDMLPLLLG--TDLCSLKPYVDRYAFSVL 623

Query: 640 CTFSKSKGLCLLKDSLKVELSVLHKSTRITYEAVDELLDEPTTKPKSGKHEDLKTLFYIA 699
                +  +      +    SV+      +YE     +D+ +   +    + ++ L  ++
Sbjct: 624 WELDDNANIV----DVNFTKSVIRSREAFSYEQAQIRIDDKSQTDELT--QGMRALLKLS 677

Query: 700 KALRRQRIVDGGAVVFENSSTGIVSLSPD-DNSELVEVSFKDQIETKSTILVSELMILAN 758
             L+++R+ D GA+   N ++  V +  D + S+  EV  K  + T S  LV E M+LAN
Sbjct: 678 IKLKQKRL-DAGAL---NLASPEVKVHMDSETSDPNEVEIKKLLATNS--LVEEFMLLAN 731

Query: 759 -SLTASYFEENQIPGIYR--GYRPLNVVED---------------------ATSVPEWVK 794
            S+    FE      + R  G  P    E                      A S+   V 
Sbjct: 732 ISVARKIFESFPQTAMLRRHGVPPSTNFETLNEMLHQRKQMTISLESSKALADSLDRCVD 791

Query: 795 AKTQE-NKIISKADIAKMKS--FLTSSFYSSLPTPHDMLGTSHYLTITSPLRRFPDLVNH 851
            K    N +I       M +  +  S  YS     H  L    Y   TSP+RR+ D+V H
Sbjct: 792 PKDPYFNTLIRIMSTRCMMAAQYFYSGAYSYSEFRHYGLAVDIYTHFTSPIRRYCDVVAH 851

Query: 852 LQLHRTLKGLPLLYKQSQLDGMVWHILTRDVTLKNASVDAQRYWTLRFLKKEIEDPTKNN 911
            QL   +   PL    S  D     ++ R++  ++ +       ++ +   ++    +NN
Sbjct: 852 RQLAGAIGYEPL--DLSHRDKNKMDMICRNINKRHRNAQFAGRASIEYYVGQV---MRNN 906

Query: 912 WKLQ---ITSLTDNGYAHCVILDKAFAV-GQLKI-NLNKNP 947
             ++   +  + +NG    V+L   F V G ++I N+ K+P
Sbjct: 907 ESVETGYVIKVLNNG---IVVLVPRFGVEGLIRIENMTKDP 944

>KNAG0C01950 Chr3 (377736..380726) [2991 bp, 996 aa] {ON} Anc_1.367
           YOL021C
          Length = 996

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 83/361 (22%), Positives = 145/361 (40%), Gaps = 54/361 (14%)

Query: 533 RTEYKDLICYCIDSPDAHEIDDAVSIKSLGGAKYRIYIHVADPASLFPEANEDGTTINSP 592
           R + +D +   ID P   +IDDA+  K L    + + +H+AD         + GT +++ 
Sbjct: 526 RKDLRDKLICSIDPPGCVDIDDALHAKKLPNGHWEVGVHIADVTHFV----KPGTALDAE 581

Query: 593 VLDIAYQRAFTTYLPDKVFPMLPTTYARSSDLGQFGKPTKAVTFSVDCTFSKSKGLCLLK 652
                  R  + YL DK   MLP      +DL           FSV     ++       
Sbjct: 582 ----GASRGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVIWELDEN------A 629

Query: 653 DSLKVEL--SVLHKSTRITYEAVDELLDEPTTKPKSGKHEDLKTLFYIAKALRRQRIVDG 710
           D + VE   SV+       YE     +D+P  K +      ++ L  ++  L+++R+ + 
Sbjct: 630 DIINVEFHKSVIRSREAFAYEQAQLRIDDP--KQQDELTLGMRALLQLSIKLKQKRL-EA 686

Query: 711 GAVVFENSSTGIVSLSPD-DNSELVEVSFKDQIETKSTILVSELMILAN-SLTASYFEEN 768
           GA+   N ++  V +  D + S+  EV  K  + T S  LV E M+LAN S+    ++  
Sbjct: 687 GAL---NLASPEVKVHMDSETSDPGEVEIKKLLATNS--LVEEFMLLANISVARKIYDSF 741

Query: 769 QIPGIYRGYRP-----LNVVEDATSVPEWVKAKTQENKIISKA-------------DIAK 810
               + R + P       ++ +     + +    + +K ++ +              + +
Sbjct: 742 PQTAMLRRHAPPPATNFEILNEMLQRRKNMSISVESSKALADSLDRCEDPKDPYFNTLVR 801

Query: 811 MKS--------FLTSSFYSSLPTPHDMLGTSHYLTITSPLRRFPDLVNHLQLHRTLKGLP 862
           + S        +  S  YS     H  L    Y   TSP+RR+ D+V H QL   +   P
Sbjct: 802 IMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDIVAHRQLAGAIDYEP 861

Query: 863 L 863
           L
Sbjct: 862 L 862

>NDAI0H03560 Chr8 (869622..872660) [3039 bp, 1012 aa] {ON} Anc_1.367
           YOL021C
          Length = 1012

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 89/361 (24%), Positives = 141/361 (39%), Gaps = 54/361 (14%)

Query: 533 RTEYKDLICYCIDSPDAHEIDDAVSIKSLGGAKYRIYIHVADPASLFPEANEDGTTINSP 592
           R + +D +   ID P   +IDDA+  K L    + + +H+AD      +    GT +++ 
Sbjct: 542 RKDLRDKLICSIDPPGCVDIDDALHAKKLPNGNWEVGVHIADVTHFVKQ----GTALDAE 597

Query: 593 VLDIAYQRAFTTYLPDKVFPMLPTTYARSSDLGQFGKPTKAVTFSVDCTFSKSKGLCLLK 652
                  R  + YL DK   MLP      +DL           FSV      +       
Sbjct: 598 ----GASRGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVLWELDSN------A 645

Query: 653 DSLKVEL--SVLHKSTRITYEAVDELLDEPTTKPKSGKHEDLKTLFYIAKALRRQRIVDG 710
           D +KV+   SV+      +YE     +D+P         + ++ L  ++  L+++R+ D 
Sbjct: 646 DIVKVDFTKSVIKSREAFSYEQAQLRIDDPNQ--TDDLTQGMRALLQLSIKLKQKRL-DN 702

Query: 711 GAVVFENSSTGIVSLSPD-DNSELVEVSFKDQIETKSTILVSELMILANSLTAS--YFEE 767
           GA+   N ++  V +  D + S+  EV  K  + T S  LV E M+LAN   A   Y   
Sbjct: 703 GAL---NLASPEVKVHMDSETSDPGEVEIKKLLATNS--LVEEFMLLANISVARKIYDAF 757

Query: 768 NQIPGIYRGYRP-----------LNVVEDATSVPEWVKAKTQE------------NKIIS 804
            Q   + R   P           L+  ++ +   E  KA                N ++ 
Sbjct: 758 PQTAMLRRHAAPPSTNFELLNEMLHRRKNMSISLESSKALADSLDRCEDPKDPYFNTLVR 817

Query: 805 KADIAKMKS--FLTSSFYSSLPTPHDMLGTSHYLTITSPLRRFPDLVNHLQLHRTLKGLP 862
                 M +  +  S  YS     H  L    Y   TSP+RR+ D+V H QL   +   P
Sbjct: 818 IMSTRCMMAAQYFYSGAYSYPDFKHYGLAVDIYTHFTSPIRRYCDVVAHRQLAGAIGYEP 877

Query: 863 L 863
           L
Sbjct: 878 L 878

>AEL031C Chr5 complement(574534..577527) [2994 bp, 997 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL021C
           (DIS3)
          Length = 997

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 86/361 (23%), Positives = 143/361 (39%), Gaps = 54/361 (14%)

Query: 533 RTEYKDLICYCIDSPDAHEIDDAVSIKSLGGAKYRIYIHVADPASLFPEANEDGTTINSP 592
           R + +D +   ID P   +IDDA+  K L    + + +H+AD         + GT +++ 
Sbjct: 528 RRDLRDKLICSIDPPGCVDIDDALHAKRLPNGNWEVGVHIADVTHFV----KPGTALDTE 583

Query: 593 VLDIAYQRAFTTYLPDKVFPMLPTTYARSSDLGQFGKPTKAVTFSVDCTFSKSKGLCLLK 652
                  RA + YL +K   MLP      +DL           FSV         +    
Sbjct: 584 ----GASRATSVYLVNKRIDMLPMLLG--TDLCSLKPYVDRFAFSVLWELDADANIV--- 634

Query: 653 DSLKVELSVLHKSTRITYEAVDELLDEPTTKPKSGKHEDLKTLFYIAKALRRQRIVDGGA 712
            ++    SV+      +YEA    +D+     +      ++ L  ++K L+++R+ D GA
Sbjct: 635 -NVDFTKSVIRSREAFSYEAAQLRIDDVNQNDELTN--GMRALLELSKKLKQKRL-DAGA 690

Query: 713 VVFENSSTGIVSLSPD-DNSELVEVSFKDQIETKSTILVSELMILANSLTASYFEEN--Q 769
           +   N ++  V +  D + S+  EV  K  + T S  LV E M+LAN   A    +   Q
Sbjct: 691 L---NLASPEVKVHMDNETSDPNEVEIKKLLATNS--LVEEFMLLANISVARKINDAFPQ 745

Query: 770 IPGIYRGYRPLNVVEDATSVPEWVKAKTQEN--------------------------KII 803
              + R   P +   +A +    V+ K   +                          +I+
Sbjct: 746 TAMLRRHAAPPSTNFEALNEMLQVRKKMAISLESSKALADSLDRCIDPEDPYFNTLVRIM 805

Query: 804 SKADIAKMKSFLTSSF-YSSLPTPHDMLGTSHYLTITSPLRRFPDLVNHLQLHRTLKGLP 862
           S   +   + F + +F YS     H  L    Y   TSP+RR+ D+V H QL   +   P
Sbjct: 806 STRCMMAAQYFYSGAFSYSDF--HHYGLAVDIYTHFTSPIRRYCDVVVHRQLAGAIGYEP 863

Query: 863 L 863
           L
Sbjct: 864 L 864

>YOL021C Chr15 complement(282421..285426) [3006 bp, 1001 aa] {ON}
           DIS3Exosome core complex catalytic subunit; possesses
           both endonuclease and 3'-5' exonuclease activity;
           involved in 3'-5' RNA processing and degradation in both
           the nucleus and the cytoplasm; has similarity to E. coli
           RNase R and to human DIS3
          Length = 1001

 Score = 55.5 bits (132), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 108/492 (21%), Positives = 198/492 (40%), Gaps = 67/492 (13%)

Query: 496 LLINHELQLPVNNERV--KLEQKIYDLAVPPKIEHSAEI--------RTEYKDLICYCID 545
           LL+ H+++    +++V   L  + +D   P K++    +        R + +D +   ID
Sbjct: 484 LLLEHDVEYRPFSKKVLECLPAEGHDWKAPTKLDDPEAVSKDPLLTKRKDLRDKLICSID 543

Query: 546 SPDAHEIDDAVSIKSLGGAKYRIYIHVADPASLFPEANEDGTTINSPVLDIAYQRAFTTY 605
            P   +IDDA+  K L    + + +H+AD         + GT +++        R  + Y
Sbjct: 544 PPGCVDIDDALHAKKLPNGNWEVGVHIADVTHFV----KPGTALDAE----GAARGTSVY 595

Query: 606 LPDKVFPMLPTTYARSSDLGQFGKPTKAVTFSVDCTFSKSKGLCLLKDSLKVELSVLHKS 665
           L DK   MLP      +DL           FSV      S  +     ++    SV+   
Sbjct: 596 LVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVIWELDDSANIV----NVNFMKSVIRSR 649

Query: 666 TRITYEAVDELLDEPTTKPKSGKHEDLKTLFYIAKALRRQRIVDGGAVVFENSSTGIVSL 725
              +YE     +D+ T   +      ++ L  ++  L+++R+ + GA+   N ++  V +
Sbjct: 650 EAFSYEQAQLRIDDKTQNDELTM--GMRALLKLSVKLKQKRL-EAGAL---NLASPEVKV 703

Query: 726 SPD-DNSELVEVSFKDQIETKSTILVSELMILANSLTAS--YFEENQIPGIYRGYRP--- 779
             D + S+  EV  K  + T S  LV E M+LAN   A   Y    Q   + R   P   
Sbjct: 704 HMDSETSDPNEVEIKKLLATNS--LVEEFMLLANISVARKIYDAFPQTAMLRRHAAPPST 761

Query: 780 --------LNVVEDATSVPEWVKAKTQE-NKIISKAD-----IAKMKS--------FLTS 817
                   LN  ++ +   E  KA     ++ +   D     + ++ S        +  S
Sbjct: 762 NFEILNEMLNTRKNMSISLESSKALADSLDRCVDPEDPYFNTLVRIMSTRCMMAAQYFYS 821

Query: 818 SFYSSLPTPHDMLGTSHYLTITSPLRRFPDLVNHLQLHRTLKGLPLLYKQSQLDGMVWHI 877
             YS     H  L    Y   TSP+RR+ D+V H QL   +   PL       + M   +
Sbjct: 822 GAYSYPDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAGAIGYEPLSLTHRDKNKM--DM 879

Query: 878 LTRDVTLKNASVDAQRYWTLRFLKKEIEDPTKNNWKLQITSLTDNGYAHCVILDKAFAV- 936
           + R++  K+ +       ++ +   ++    ++     +  + +NG    V+L   F V 
Sbjct: 880 ICRNINRKHRNAQFAGRASIEYYVGQVMRNNESTETGYVIKVFNNG---IVVLVPKFGVE 936

Query: 937 GQLKI-NLNKNP 947
           G +++ NL ++P
Sbjct: 937 GLIRLDNLTEDP 948

>TPHA0A02320 Chr1 complement(485855..488902) [3048 bp, 1015 aa] {ON}
           Anc_1.367 YOL021C
          Length = 1015

 Score = 55.5 bits (132), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 86/359 (23%), Positives = 142/359 (39%), Gaps = 50/359 (13%)

Query: 533 RTEYKDLICYCIDSPDAHEIDDAVSIKSLGGAKYRIYIHVADPASLFPEANEDGTTINSP 592
           R + +D +   ID P   +IDDA+  K L    + + +H+AD         + GT +++ 
Sbjct: 545 RQDLRDKLICSIDPPGCVDIDDALHAKRLPNGNWEVGVHIADVTHFV----KPGTALDAE 600

Query: 593 VLDIAYQRAFTTYLPDKVFPMLPTTYARSSDLGQFGKPTKAVTFSVDCTFSKSKGLCLLK 652
                  R  + YL DK   MLP      +DL           FSV      +  +    
Sbjct: 601 ----GASRGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVIWELDDNAEII--- 651

Query: 653 DSLKVELSVLHKSTRITYEAVDELLDEPTTKPKSGKHEDLKTLFYIAKALRRQRIVDGGA 712
             +K   SV+      +YE     +D+     +  K   ++ L  ++  L+++R+ D GA
Sbjct: 652 -DVKFTKSVIRSREAFSYEQAQLRIDDKNQTDELTK--GMRALLELSVKLKQKRL-DAGA 707

Query: 713 VVFENSSTGIVSLSPD-DNSELVEVSFKDQIETKSTILVSELMILAN-SLTASYFEE-NQ 769
           +   N ++  V +  D + S+  EV  K  + T S  LV E M+LAN S+    F+   Q
Sbjct: 708 L---NLASPEVKVHMDSETSDPNEVEIKKLLATNS--LVEEFMLLANISVARKIFDAFPQ 762

Query: 770 IPGIYRGYRP-----------LNVVEDATSVPEWVKAKTQE-NKIISKAD--------IA 809
              + R   P           L   ++ +   E  KA     ++ I   D        I 
Sbjct: 763 TAMLRRHASPPSTNFAILNEMLQKRKNLSISLESSKALADSLDRCIDPKDPYFNTLIRIM 822

Query: 810 KMKSFLTSSFYSSLPTP-----HDMLGTSHYLTITSPLRRFPDLVNHLQLHRTLKGLPL 863
             +  + + ++ S         H  L    Y   TSP+RRF D++ H QL   +   PL
Sbjct: 823 STRCMMAAQYFYSGAYQYSDFRHYGLAVDIYTHFTSPIRRFCDVIAHRQLAGAIGYEPL 881

>ZYRO0G01166g Chr7 complement(91672..94653) [2982 bp, 993 aa] {ON}
           highly similar to uniprot|Q08162 Saccharomyces
           cerevisiae YOL021C DIS3 Nucleolar exosome component
           involved in rRNA processing and RNA degradation binds
           Gsp1p/Ran and enhances the GEF activity of Srm1p
           implicated in mitotic control homologous to the E. coli
           RNase R of the RNase II family
          Length = 993

 Score = 55.5 bits (132), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 82/360 (22%), Positives = 141/360 (39%), Gaps = 52/360 (14%)

Query: 533 RTEYKDLICYCIDSPDAHEIDDAVSIKSLGGAKYRIYIHVADPASLF-PEANEDGTTINS 591
           R + +D +   ID P   +IDDA+  K L    + + +H+AD      P    DG     
Sbjct: 523 RRDLRDKLICSIDPPGCVDIDDALHAKKLPNGNWEVGVHIADVTHFVKPNTALDGE---- 578

Query: 592 PVLDIAYQRAFTTYLPDKVFPMLPTTYARSSDLGQFGKPTKAVTFSVDCTFSKSKGLCLL 651
                   R  + YL DK   MLP      +DL           FSV    +++  +   
Sbjct: 579 -----GASRGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVLWELNENADIV-- 629

Query: 652 KDSLKVELSVLHKSTRITYEAVDELLDEPTTKPKSGKHEDLKTLFYIAKALRRQRIVDGG 711
             ++    SV+      +YE     +D+P  + +      ++ L  ++  L+ +RI + G
Sbjct: 630 --NVDFAKSVIKSREAFSYEQAQLRIDDPNQQDELT--HGMRALLKLSIKLKEKRI-NAG 684

Query: 712 AVVFENSSTGIVSLSPD-DNSELVEVSFKDQIETKSTILVSELMILANSLTASYFEEN-- 768
           A+   N ++  V +  D + S+  EV  K  + T S  LV E M+LAN   A    ++  
Sbjct: 685 AL---NLASPEVKVHMDSETSDPNEVEIKKLLATNS--LVEEFMLLANISVARKIYDSFP 739

Query: 769 QIPGIYRGYRP----LNVVEDATSVPEWVKAKTQENKIISKA-------------DIAKM 811
           Q   + R   P      ++ +     + +    + +K ++ +              + ++
Sbjct: 740 QTAMLRRHASPPSTNFELLNEMLQTRKGMSISLESSKALADSLDRCIDPKDPYFNTLVRI 799

Query: 812 KS--------FLTSSFYSSLPTPHDMLGTSHYLTITSPLRRFPDLVNHLQLHRTLKGLPL 863
            S        +  S  YS     H  L    Y   TSP+RR+ D+V H QL   +   PL
Sbjct: 800 MSTRCMMAAQYFYSGAYSYSDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAGAIGYEPL 859

>Kpol_1043.42 s1043 (83527..86493) [2967 bp, 988 aa] {ON}
           (83527..86493) [2967 nt, 989 aa]
          Length = 988

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 92/364 (25%), Positives = 149/364 (40%), Gaps = 60/364 (16%)

Query: 533 RTEYKDLICYCIDSPDAHEIDDAVSIKSLGGAKYRIYIHVADPASLFPEANEDGTTINSP 592
           R + +D +   ID P   +IDDA+  K L    + + +H+AD  + F +A   GT +++ 
Sbjct: 518 RVDLRDKLICSIDPPGCVDIDDALHAKKLPNGHFEVGVHIAD-VTHFVKA---GTPLDAE 573

Query: 593 VLDIAYQRAFTTYLPDKVFPMLPTTYARSSDLGQFGKPTKAVTFSVDCTFSKSKGLCLLK 652
                  R  + YL DK   MLP      +DL           FSV     ++       
Sbjct: 574 ----GASRGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVIWELDEN------A 621

Query: 653 DSLKVEL--SVLHKSTRITYEAVDELLDEPTTKPKSGKHE---DLKTLFYIAKALRRQRI 707
           D +KV+   SV+      +YE     +D+     K+   E    ++ L  ++  L+++R+
Sbjct: 622 DIVKVDFSKSVIRSREAFSYEQAQLRIDD-----KNQTDELTLGMRALLDLSIKLKQKRL 676

Query: 708 VDGGAVVFENSSTGIVSLSPD-DNSELVEVSFKDQIETKSTILVSELMILANSLTASYFE 766
            D GA+   N ++  V +  D + S+  EV  K  + T S  LV E M+LAN   A    
Sbjct: 677 -DAGAL---NLASPEVKVHMDSETSDPGEVEIKKLLATNS--LVEEFMLLANISVARKIY 730

Query: 767 EN--QIPGIYRGYRP-----------LNVVEDATSVPEWVKAKTQE-NKIISKAD----- 807
           ++  Q   + R   P           L   +  +   E  KA     ++ + K D     
Sbjct: 731 DSFPQTAMLRRHAAPPSTNFEILNEMLQKRKGLSISLESSKALADSLDRCVDKKDPYFNT 790

Query: 808 IAKMKS--------FLTSSFYSSLPTPHDMLGTSHYLTITSPLRRFPDLVNHLQLHRTLK 859
           + ++ S        +  S  YS     H  L    Y   TSP+RR+ D+V H QL   + 
Sbjct: 791 LVRIMSTRCMMAAQYFYSGAYSYSDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAGAIG 850

Query: 860 GLPL 863
             PL
Sbjct: 851 YEPL 854

>NCAS0D00590 Chr4 complement(98734..101730) [2997 bp, 998 aa] {ON}
           Anc_1.367
          Length = 998

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 86/359 (23%), Positives = 140/359 (38%), Gaps = 50/359 (13%)

Query: 533 RTEYKDLICYCIDSPDAHEIDDAVSIKSLGGAKYRIYIHVADPASLFPEANEDGTTINSP 592
           R + +D +   ID P   +IDDA+  K L    + + +H+AD         + GT +++ 
Sbjct: 528 RKDLRDKLICSIDPPGCVDIDDALHAKRLPNGNWEVGVHIADVTHFV----KPGTALDAE 583

Query: 593 VLDIAYQRAFTTYLPDKVFPMLPTTYARSSDLGQFGKPTKAVTFSVDCTFSKSKGLCLLK 652
                  R  + YL DK   MLP      +DL           FSV     ++  +    
Sbjct: 584 ----GASRGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVLWELDENADIV--- 634

Query: 653 DSLKVELSVLHKSTRITYEAVDELLDEPTTKPKSGKHEDLKTLFYIAKALRRQRIVDGGA 712
            ++    SV+      +YE     +D+ +        + ++ L  ++  L+++R+ D GA
Sbjct: 635 -NVDFTKSVIKSREAFSYEQAQLRIDDASQ--TDDLTQGMRALLQLSIKLKQKRL-DAGA 690

Query: 713 VVFENSSTGIVSLSPD-DNSELVEVSFKDQIETKSTILVSELMILANSLTAS--YFEENQ 769
           +   N ++  V +  D + S+  EV  K  + T S  LV E M+LAN   A   Y    Q
Sbjct: 691 L---NLASPEVKVHMDSETSDPGEVEIKKLLATNS--LVEEFMLLANISVARKIYDAFPQ 745

Query: 770 IPGIYRGYRP-----------LNVVEDATSVPEWVKAKTQE------------NKIISKA 806
              + R   P           L+  ++ +   E  KA                N ++   
Sbjct: 746 TAMLRRHAAPPSTNFELLNEMLHQRKNMSISLESSKALADSLDRCEDPKDPYFNTLVRIM 805

Query: 807 DIAKMKS--FLTSSFYSSLPTPHDMLGTSHYLTITSPLRRFPDLVNHLQLHRTLKGLPL 863
               M +  +  S  YS     H  L    Y   TSP+RRF D+V H QL   +   PL
Sbjct: 806 STRCMMAAQYFYSGAYSYPDFKHYGLAVDIYTHFTSPIRRFCDVVAHRQLAGAIGYEPL 864

>Smik_15.145 Chr15 complement(248837..251842) [3006 bp, 1001 aa]
           {ON} YOL021C (REAL)
          Length = 1001

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 109/492 (22%), Positives = 200/492 (40%), Gaps = 67/492 (13%)

Query: 496 LLINHELQLPVNNERV--KLEQKIYDLAVPPKIEHSAEI--------RTEYKDLICYCID 545
           LL+ H+++    +++V   L  + +D   P K++    +        R + +D +   ID
Sbjct: 484 LLLEHDVEYRPFSKKVLECLPAEGHDWKAPTKLDDPEAVAKDTLLTKRKDLRDKLICSID 543

Query: 546 SPDAHEIDDAVSIKSLGGAKYRIYIHVADPASLFPEANEDGTTINSPVLDIAYQRAFTTY 605
            P   +IDDA+  K L    + + +H+AD         + GT +++        R  + Y
Sbjct: 544 PPGCVDIDDALHAKRLPNGNWEVGVHIADVTHFV----KPGTALDAE----GAARGTSVY 595

Query: 606 LPDKVFPMLPTTYARSSDLGQFGKPTKAVTFSVDCTFSKSKGLCLLKDSLKVELSVLHKS 665
           L DK   MLP      +DL           FSV     ++  +  + D +K   SV+   
Sbjct: 596 LVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVIWELDENANIVNV-DFMK---SVIRSR 649

Query: 666 TRITYEAVDELLDEPTTKPKSGKHEDLKTLFYIAKALRRQRIVDGGAVVFENSSTGIVSL 725
              +YE     +D+     +      ++ L  ++  L+++R+ + GA+   N ++  V +
Sbjct: 650 EAFSYEQAQLRIDDINQNDELTLG--MRALLQLSVKLKQKRL-EAGAL---NLASPEVKV 703

Query: 726 SPD-DNSELVEVSFKDQIETKSTILVSELMILANSLTAS--YFEENQIPGIYRGYRP--- 779
             D + S+  EV  K  + T S  LV E M+LAN   A   Y    Q   + R   P   
Sbjct: 704 HMDSETSDPNEVEIKKLLATNS--LVEEFMLLANISVARKIYDAFPQTAMLRRHAAPPST 761

Query: 780 --------LNVVEDATSVPEWVKAKTQE-NKIISKAD-----IAKMKS--------FLTS 817
                   LN  ++ +   E  KA     ++ +   D     + ++ S        +  S
Sbjct: 762 NFETLNEMLNTRKNMSISLESSKALADSLDRCVDPEDPYFNTLVRIMSTRCMMAAQYFYS 821

Query: 818 SFYSSLPTPHDMLGTSHYLTITSPLRRFPDLVNHLQLHRTLKGLPLLYKQSQLDGMVWHI 877
             YS     H  L    Y   TSP+RR+ D+V H QL   +   PL       + M   +
Sbjct: 822 GAYSYPDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAGAIGYEPLSLTHRDKNKM--DM 879

Query: 878 LTRDVTLKNASVDAQRYWTLRFLKKEIEDPTKNNWKLQITSLTDNGYAHCVILDKAFAV- 936
           + R++  K+ +       ++ +   ++    ++     +  + +NG    V+L   F V 
Sbjct: 880 ICRNINRKHRNAQFAGRASIEYYVGQVMRNNESTETGYVIKVFNNG---IVVLVPKFGVE 936

Query: 937 GQLKI-NLNKNP 947
           G +++ NL K+P
Sbjct: 937 GLIRLDNLTKDP 948

>Skud_15.137 Chr15 complement(241849..244941) [3093 bp, 1030 aa]
           {ON} YOL021C (REAL)
          Length = 1030

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 105/454 (23%), Positives = 178/454 (39%), Gaps = 75/454 (16%)

Query: 533 RTEYKDLICYCIDSPDAHEIDDAVSIKSLGGAKYRIYIHVADPASLFPEANEDGTTINSP 592
           R + +D +   ID P   +IDDA+  + L    + + +H+AD                S 
Sbjct: 560 RKDLRDKVICSIDPPGCVDIDDALHARKLPNGNWEVGVHIADVTHFVKP---------ST 610

Query: 593 VLDI-AYQRAFTTYLPDKVFPMLPTTYARSSDLGQFGKPTKAVTFSVDCTFSKSKGLCLL 651
            LD     R  + YL DK   MLP      +DL           FSV      +      
Sbjct: 611 ALDAEGAARGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVMWELDDN------ 662

Query: 652 KDSLKVEL--SVLHKSTRITYEAVDELLDEPTTKPKSGKHED------LKTLFYIAKALR 703
            D + VE   SV+      +YE     +D+        K++D      ++ L  ++  L+
Sbjct: 663 ADIVNVEFMKSVIKSREAFSYEQAQLRIDD--------KNQDDELTLGMRALLKLSIKLK 714

Query: 704 RQRIVDGGAVVFENSSTGIVSLSPD-DNSELVEVSFKDQIETKSTILVSELMILANSLTA 762
           ++R+ + GA+   N ++  V +  D + S+  EV  K  + T S  LV E M+LAN   A
Sbjct: 715 QKRL-EAGAL---NLASPEVKVHMDSETSDPNEVEIKKLLATNS--LVEEFMLLANISVA 768

Query: 763 S--YFEENQIPGIYRGYRP-----------LNVVEDATSVPEWVKAKTQE-NKIISKAD- 807
              Y    Q   + R   P           LN  ++ +   E  KA     ++ +   D 
Sbjct: 769 RKIYDAFPQTAMLRRHAAPPSTNFETLNEMLNTRKNMSISLESSKALADSLDRCVDSEDP 828

Query: 808 ----IAKMKS--------FLTSSFYSSLPTPHDMLGTSHYLTITSPLRRFPDLVNHLQLH 855
               + ++ S        +  S  YS     H  L    Y   TSP+RR+ D+V H QL 
Sbjct: 829 YFNTLVRIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLA 888

Query: 856 RTLKGLPLLYKQSQLDGMVWHILTRDVTLKNASVDAQRYWTLRFLKKEIEDPTKNNWKLQ 915
             +   PL       + M   ++ R++  K+ +       ++ +   ++    ++     
Sbjct: 889 GAIGYEPLSLAHRDKNKM--DMICRNINRKHRNAQFAGRASIEYYVGQVMRSNESTETGY 946

Query: 916 ITSLTDNGYAHCVILDKAFAV-GQLKI-NLNKNP 947
           I  + +NG    V+L   F V G +++ NL K+P
Sbjct: 947 IIKVFNNG---IVVLVPKFGVEGLIRLDNLTKDP 977

>Suva_15.147 Chr15 complement(255214..258219) [3006 bp, 1001 aa]
           {ON} YOL021C (REAL)
          Length = 1001

 Score = 53.1 bits (126), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 112/494 (22%), Positives = 202/494 (40%), Gaps = 71/494 (14%)

Query: 496 LLINHELQLPVNNERV--KLEQKIYDLAVPPKIEHSAEI--------RTEYKDLICYCID 545
           LL+ H+++    +++V   L  + +D   P K++    +        R + +D +   ID
Sbjct: 484 LLLEHDVEYRPFSKKVLECLPSEGHDWKAPAKLDDPEAVSKDALLTKRKDLRDKLICSID 543

Query: 546 SPDAHEIDDAVSIKSLGGAKYRIYIHVADPASLFPEANEDGTTINSPVLDIAYQRAFTTY 605
            P   +IDDA+  K L    + + +H+AD  + F + N   T +++        R  + Y
Sbjct: 544 PPGCVDIDDALHAKRLPNGNWEVGVHIAD-VTHFVKPN---TALDAE----GAARGTSVY 595

Query: 606 LPDKVFPMLPTTYARSSDLGQFGKPTKAVTFSVDCTFSKSKGLCLLKDSLKVELSVLHKS 665
           L DK   MLP      +DL           FSV         +  + D +K   SV+   
Sbjct: 596 LVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVIWELDDDANIVNV-DFMK---SVIKSR 649

Query: 666 TRITYEAVDELLDEPTTKPK--SGKHEDLKTLFYIAKALRRQRIVDGGAVVFENSSTGIV 723
              +YE     +D+     +  SG    ++ L  ++  L+++R+ + GA+   N ++  V
Sbjct: 650 EAFSYEQAQFRIDDKNQNDELTSG----MRALLELSIKLKQKRL-EAGAL---NLASPEV 701

Query: 724 SLSPD-DNSELVEVSFKDQIETKSTILVSELMILANSLTAS--YFEENQIPGIYRGYRP- 779
            +  D + S+  EV  K  + T S  LV E M+LAN   A   Y    Q   + R   P 
Sbjct: 702 KVHMDSETSDPNEVEIKKLLATNS--LVEEFMLLANISVARKIYDAFPQTAMLRRHAAPP 759

Query: 780 ----------LNVVEDATSVPEWVKAKTQE-NKIISKAD-----IAKMKS--------FL 815
                     LN  ++ +   E  KA     ++ +   D     + ++ S        + 
Sbjct: 760 STNFEIMNEMLNTRKNMSISLESSKALADSLDRCVDPEDPYFNTLVRIMSTRCMMAAQYF 819

Query: 816 TSSFYSSLPTPHDMLGTSHYLTITSPLRRFPDLVNHLQLHRTLKGLPLLYKQSQLDGMVW 875
            S  YS     H  L    Y   TSP+RR+ D+V H QL   +   PL       + M  
Sbjct: 820 YSGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAGAIGYEPLSLTHRDKNKM-- 877

Query: 876 HILTRDVTLKNASVDAQRYWTLRFLKKEIEDPTKNNWKLQITSLTDNGYAHCVILDKAFA 935
            ++ R++  K+ +       ++ +   ++    ++     +  + +NG    V+L   F 
Sbjct: 878 DMICRNINRKHRNAQFAGRASIEYYVGQVMRNNESTETGYVIKVFNNG---IVVLVPKFG 934

Query: 936 V-GQLKI-NLNKNP 947
           V G +++ NL K+P
Sbjct: 935 VEGLIRLDNLTKDP 948

>Kwal_34.16245 s34 complement(260089..263049) [2961 bp, 986 aa] {ON}
           YOL021C (DIS3) - 3'-5' exoribonuclease complex subunit
           [contig 265] FULL
          Length = 986

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 78/350 (22%), Positives = 136/350 (38%), Gaps = 50/350 (14%)

Query: 533 RTEYKDLICYCIDSPDAHEIDDAVSIKSLGGAKYRIYIHVADPASLFPEANEDGTTINSP 592
           R + +D +   ID P   +IDDA+  K L    + + +H+AD               N+P
Sbjct: 516 RRDLRDKLICSIDPPGCVDIDDALHAKQLPNGNWEVGVHIADVTHFVKP--------NTP 567

Query: 593 VLDIAYQRAFTTYLPDKVFPMLPTTYARSSDLGQFGKPTKAVTFSVDCTFSKSKGLCLLK 652
           +      R  + YL DK   MLP      ++L           FSV     +   +    
Sbjct: 568 LDAEGASRGTSVYLVDKRIDMLPMLLG--TNLCSLKPYVDRFAFSVLWELDQDANIV--- 622

Query: 653 DSLKVELSVLHKSTRITYEAVDELLDEPTTKPKSGKHEDLKTLFYIAKALRRQRIVDGGA 712
            ++    SV+      +YE     +D+ T   +    + ++ L  ++  L+ +R+ + GA
Sbjct: 623 -NVDFTKSVIKSREAFSYEQAQLRIDDSTQTDELT--QGMRALLSLSIKLKEKRL-NAGA 678

Query: 713 VVFENSSTGIVSLSPD-DNSELVEVSFKDQIETKSTILVSELMILANSLTASYFEEN--Q 769
           +   N ++  V +  D + S+  EV  K  + T S  LV E M+LAN   A    E   Q
Sbjct: 679 L---NLASPEVKVHMDSETSDPGEVEIKKLLATNS--LVEEFMLLANISVARKIYEAFPQ 733

Query: 770 IPGIYRGYRP----LNVVEDATSVPEWVKAKTQENKIISKA-------------DIAKMK 812
              + R   P       + +   + + +    + +K ++ +              + ++ 
Sbjct: 734 TAMLRRHAAPPATNFEALNEMLQLRKGMSISLESSKALADSLDRCVDPKDPYFNTLVRIM 793

Query: 813 S--------FLTSSFYSSLPTPHDMLGTSHYLTITSPLRRFPDLVNHLQL 854
           S        +  S  YS     H  L    Y   TSP+RR+ D+V H QL
Sbjct: 794 STRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQL 843

>NDAI0C04050 Chr3 complement(921707..925489) [3783 bp, 1260 aa] {ON}
            Anc_5.307 YDR293C
          Length = 1260

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 81/364 (22%), Positives = 145/364 (39%), Gaps = 50/364 (13%)

Query: 524  PKIEHSAEIRTEYKDLICYCIDSPDAHEI--DDAVSIKSLGGAKYRIYIHVADPASLFPE 581
            P  E+   +RT++ D   Y I +   ++   + A+ +K+     + +  HV D  +   E
Sbjct: 693  PIPENELAVRTDFTDPSEYSILAIAENDSLSEFALHVKNNNDGTFELGCHVVDATAHIEE 752

Query: 582  ANEDGTTINSPVLDIAYQRAFTTYLPDKVFPMLPTTYARSSDLGQFGKPTKAVTFSVDCT 641
                    NS +   A +R+   ++P KV  +LP     S  L    K  K+ T SV  T
Sbjct: 753  --------NSSLDRRARKRSSGVFMPQKVVNLLPKALNESLSLK---KDKKSATLSVIYT 801

Query: 642  FSKSKGLCLLKDSLKVELSVLHKSTRITYEAVDELLDEPTTKPKSGKHEDLKTLFYIAKA 701
             +      L   S  V  S++  S  +T + +D+ L      P     E + T FY  + 
Sbjct: 802  LNAE---TLEIRSTTVCESIILPSRFMTAKEIDDNLASDDVDPYLSIVEKIATSFYATRI 858

Query: 702  LRRQRIVDGGAVVFENSSTGIVSLSPDDNSELVEVSFKDQIETKSTILVSELMILANSLT 761
               +  +     +FE         S DD    V+++  D+  T   ++++E+    NS  
Sbjct: 859  EYPEAKLMPTLSLFE---------SIDDEKVNVDLNILDR--TLGYVVINEIQHKVNSTI 907

Query: 762  A----------SYFEENQIPGIYRGYRPLNVVE------DATSVPEWVKA--KTQENKII 803
            A          S+      P I +     N ++      D TS+   +++  K +++ + 
Sbjct: 908  AEKIYTKLGDSSFLRREAQPVITKMSLFKNKIQKFGLDIDITSIATIIQSILKIEDSDVR 967

Query: 804  SKADIAKMKSFLTSSFYSSLPTPHDM-----LGTSHYLTITSPLRRFPDLVNHLQLHRTL 858
               +I   K+   + ++ +     D      L    Y   TSPLRR+ D V H QL   +
Sbjct: 968  VGVEILLFKTMSRAKYFVAGKVDPDQYSHYSLNLPIYTHFTSPLRRYADHVVHRQLRSAI 1027

Query: 859  KGLP 862
            +G+P
Sbjct: 1028 RGVP 1031

>Suva_2.459 Chr2 complement(810378..814154) [3777 bp, 1258 aa] {ON}
            YDR293C (REAL)
          Length = 1258

 Score = 40.0 bits (92), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 74/334 (22%), Positives = 135/334 (40%), Gaps = 54/334 (16%)

Query: 555  AVSIKSLGGAKYRIYIHVADPASLFPEANEDGTTINSPVLDIAYQRAFTTYLPDKVFPML 614
            A+ +++ G     +  HV D  S      E+G++++      A +R+   ++P K+  +L
Sbjct: 721  ALHVRNNGDGTLELGCHVVDVTSHI----EEGSSVDR----RARKRSSAVFMPQKLVSLL 772

Query: 615  PTTYARSSDLGQFGK--PTKAVTFSVDCTFSKSKGLCLLKDSLKVELSVLHKSTRITYEA 672
            P ++  +  L   GK  PT +V +++D +        L   S  V  S++  S  ++ E 
Sbjct: 773  PQSFNDTLSLAP-GKESPTISVVYTLDSS-------TLRVQSTWVGESIISPSNILSLEQ 824

Query: 673  VDELLDEPTTKPKSGKHEDLKTLFY-IAKALRRQRIVDGGAVVFENSSTGIVSLSPDDNS 731
            +DE L        SG      TL   IA++    RI D  A +        +SL    + 
Sbjct: 825  LDEKL-------LSGNPGTYLTLVQEIARSFYAARINDPEAKLLP-----TLSLLESLDD 872

Query: 732  ELVEVSFKDQIETKSTILVSELMILANSLTAS--YFEENQIPGIYRGYRPLNVVE----- 784
            E V+V       T   I+++E+    NS  A   Y +   +  + R  +P+         
Sbjct: 873  EKVKVDLNILDRTSGFIVINEIKRKVNSTVAEKIYTKLGDLALLRRQMQPIATKMASFKK 932

Query: 785  ---------DATSVPEWVKA--KTQENKIISKADIAKMKSFLTSSFYSSLPTPHDMLGTS 833
                     D ++  E +KA  K +++ +    +I   K+   + ++ +     D  G  
Sbjct: 933  KIQNFGYDVDVSTADELIKAVLKIEDDDVRVGIEILLFKTMPRARYFIAGKVDPDQYGHY 992

Query: 834  H-----YLTITSPLRRFPDLVNHLQLHRTLKGLP 862
                  Y   T P+RR+ D V H QL   +  +P
Sbjct: 993  ALNLPIYAHFTDPMRRYADHVVHRQLKSVIHDVP 1026

>TBLA0C01220 Chr3 complement(263093..265348) [2256 bp, 751 aa] {ON}
           Anc_1.366 YFR009W
          Length = 751

 Score = 38.5 bits (88), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 75/162 (46%), Gaps = 19/162 (11%)

Query: 429 ASLNKSFPYIVPLLRDYAAGNLEHNDTITSLISSLFRKLDEYKELNISRDVCF--DLLKR 486
           + + K+ P I P++ DYA G   H       +S+L     + K+L+++ ++ F  +LL+ 
Sbjct: 6   SQVRKAAPSIDPIVADYAVGYFNH-------LSTLTYDPVQSKQLDLATEISFVSELLRN 58

Query: 487 INPSEPPNPLL---INHELQLPVNNERVKLE------QKIYDLAVPPKIEHSAEIRTEYK 537
              SE     L   I+  L L ++  R KLE      +++ D+ V     + A+I T   
Sbjct: 59  AGASEDKVDTLAKEISERLNLQLDENRAKLELTGDTSKRLLDINVLKSHNNKADINTSLN 118

Query: 538 DLICYCIDSPDAHEIDDAVSIKSLGGAKYRIYIHVADPASLF 579
            L    I+     +++  V++K L  A+ +I   VA   + F
Sbjct: 119 LLNNNGIEHA-GRQMETRVNLKKLAKAEQKIAKKVAKRNNKF 159

>YDR293C Chr4 complement(1045640..1049392) [3753 bp, 1250 aa] {ON}
            SSD1Translational repressor with a role in polar growth
            and wall integrity; regulated by Cbk1p phosphorylation to
            effect bud-specific translational control and
            localization of specific mRNAs; interacts with TOR
            pathway components; contains a functional N-terminal
            nuclear localization sequence and nucleocytoplasmic
            shuttling appears to be critical to Ssd1p function
          Length = 1250

 Score = 38.5 bits (88), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 72/331 (21%), Positives = 131/331 (39%), Gaps = 48/331 (14%)

Query: 555  AVSIKSLGGAKYRIYIHVADPASLFPEANEDGTTINSPVLDIAYQRAFTTYLPDKVFPML 614
            A+ +++ G     +  HV D  S      E+G++++      A +R+   ++P K+  +L
Sbjct: 713  ALHVRNNGNGTLELGCHVVDVTSHI----EEGSSVDR----RARKRSSAVFMPQKLVNLL 764

Query: 615  PTTYARSSDLGQFGKPTKAVTFSVDCTFSKSKGLCLLKDSLKVELSVLHKSTRITYEAVD 674
            P ++   +D        ++ T SV  T   S    L   S  V  S +  S  ++ E +D
Sbjct: 765  PQSF---NDELSLAPGKESATLSVVYTLDSS---TLRIKSTWVGESTISPSNILSLEQLD 818

Query: 675  ELLDEPTTKPKSGKHEDLKTLFYIAKALRRQRIVDGGAVVFENSSTGIVSLSPDDNSELV 734
            E L   T  P S     L T+  IA++   +RI D  A +        +SL    + E V
Sbjct: 819  EKLS--TGSPTSY----LSTVQEIARSFYARRINDPEATLLP-----TLSLLESLDDEKV 867

Query: 735  EVSFKDQIETKSTILVSELMILANSLTAS--YFEENQIPGIYRGYRPLNVVE-------- 784
            +V       T   ++++E+    NS  A   Y +   +  + R  +P+            
Sbjct: 868  KVDLNILDRTLGFVVINEIKRKVNSTVAEKIYTKLGDLALLRRQMQPIATKMASFRKKIQ 927

Query: 785  ------DATSVPEWVKA--KTQENKIISKADIAKMKSFLTSSFYSSLPTPHDMLGTSH-- 834
                  D  +  E +K   K +++ +    +I   K+   + ++ +     D  G     
Sbjct: 928  NFGYNFDTNTADELIKGVLKIKDDDVRVGIEILLFKTMPRARYFIAGKVDPDQYGHYALN 987

Query: 835  ---YLTITSPLRRFPDLVNHLQLHRTLKGLP 862
               Y   T+P+RR+ D V H QL   +   P
Sbjct: 988  LPIYTHFTAPMRRYADHVVHRQLKAVIHDTP 1018

>Smik_4.542 Chr4 complement(977225..980980) [3756 bp, 1251 aa] {ON}
            YDR293C (REAL)
          Length = 1251

 Score = 37.0 bits (84), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 72/331 (21%), Positives = 131/331 (39%), Gaps = 48/331 (14%)

Query: 555  AVSIKSLGGAKYRIYIHVADPASLFPEANEDGTTINSPVLDIAYQRAFTTYLPDKVFPML 614
            A+ ++  G     +  HV D         E+G++++      A +R+   ++P K+  +L
Sbjct: 714  ALHVRDNGNGTLELGCHVVDVTGHI----EEGSSVDK----RARKRSSAVFMPQKLVNLL 765

Query: 615  PTTYARSSDLGQFGKPTKAVTFSVDCTFSKSKGLCLLKDSLKVELSVLHKSTRITYEAVD 674
            P ++   +D        ++ T SV  T   S    L   S  V  S +  S  ++ E +D
Sbjct: 766  PQSF---NDELSLAPGKESATISVVYTLDSS---TLRIKSTWVGESKISPSNILSLEQLD 819

Query: 675  ELLDEPTTKPKSGKHEDLKTLFYIAKALRRQRIVDGGAVVFENSSTGIVSLSPDDNSELV 734
            E L   T  P S     L T+  IA++   +RI D  A +        +SL    + E V
Sbjct: 820  EQLS--TESPGSY----LSTVQEIARSFYARRINDPEAKLLP-----TLSLLESLDDEKV 868

Query: 735  EVSFKDQIETKSTILVSELMILANSLTAS--YFEENQIPGIYRGYRPLNVVE-------- 784
            +V       T   ++++E+    NS  A   Y +   +  + R  +P+            
Sbjct: 869  KVDLNILDRTLGFVIINEIKKKVNSTVAEKIYTKLGDLALLRRQMQPIATKMASFRKKTQ 928

Query: 785  ------DATSVPEWVKA--KTQENKIISKADIAKMKSFLTSSFYSSLPTPHDMLGTSH-- 834
                  D  +  E +KA  + +++ +    +I   K+   + ++ S     D  G     
Sbjct: 929  NFGYNFDTNTADELMKAVLQIEDDDVRVGIEILLFKTMPRARYFISGKVDPDQYGHYALN 988

Query: 835  ---YLTITSPLRRFPDLVNHLQLHRTLKGLP 862
               Y   T+P+RR+ D V H QL   +  +P
Sbjct: 989  LPIYTHFTAPMRRYADHVVHRQLKSIIHDVP 1019

>TDEL0E03200 Chr5 (603078..606851) [3774 bp, 1257 aa] {ON} Anc_5.307
            YDR293C
          Length = 1257

 Score = 35.4 bits (80), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 97/433 (22%), Positives = 168/433 (38%), Gaps = 76/433 (17%)

Query: 459  LISSLFRKLDEYKELN-ISRDVCFDLLKRINPSEPPNPLLINHEL---QLPVNNERVKLE 514
            L+S L    D   E++ I RD  F   + ++P +P +     H L   Q  + + R   +
Sbjct: 641  LVSELGEISDPNTEIDSILRDSNFLSNEYLDPKDPKSEKSTFHSLPIAQEDLESRRQFTD 700

Query: 515  QKIYDLAVPPKIEHSAEIRTEYKDLICYCIDSPDAHEIDDAVSIKSLGGAKYRIYIHVAD 574
            Q  YD+     I  SA     Y D   +       +  DDA SI+ LG        HV D
Sbjct: 701  QNTYDILA---ITESAN----YCDFAVHI-----KNNTDDAGSIE-LG-------CHVVD 740

Query: 575  PASLFPEANEDGTTINSPVLDIAYQRAFTTYLPDKVFPMLPTTYARSSDLGQFGKPTK-- 632
              +   E        +S +   A +R+   ++P K   +LP    +S  L   GK +   
Sbjct: 741  ATAYIEE--------DSSLDRRARKRSTAVFMPQKFVDLLPQALNKSLTLAP-GKESACI 791

Query: 633  AVTFSVDCTFSKSKGLCLLKDSLKVELSVLHKSTRITYEAVDELLDEPTTKPKSGKHEDL 692
            +V +++D       G  L   S  +  SV+  S  I+ + +     E  + P +   +++
Sbjct: 792  SVVYTLD-------GKTLKVKSTWIGESVVQPSGTISVDDLSSKSAEANSNPSAYMLKNI 844

Query: 693  KTLFYIAKALRRQRIVDGGAVVFENSSTGIVSLSPDDNSELVEVSFKDQIETKSTILVSE 752
             T FY       +RI    A +     T  + L+   + E V V       +  +I+V E
Sbjct: 845  ATSFYA------ERINFPAAEL-----TPFLPLAASLDDEKVNVDLNILDRSLGSIIVGE 893

Query: 753  LMILANSLTAS--YFEENQIPGIYRGYRPLNVVE--------------DATSVPEWVKA- 795
            +    +S  A   Y +      + R  +P++                 D +S    +K+ 
Sbjct: 894  IKTKLDSSVAEKIYTKLGDSTFLRRQVQPVHTKMASFKKKVKKFGFDIDVSSADTLIKSI 953

Query: 796  -KTQENKIISKADIAKMKSFLTSSFYSSLPTPHDMLG-----TSHYLTITSPLRRFPDLV 849
             + + N + +  +I   K+   + ++ +     D  G        Y   ++PLRR+ D V
Sbjct: 954  LQIKNNDVRTGVEILLYKTMPRARYFIAGKVDPDQYGHYALNLQLYTHFSAPLRRYADHV 1013

Query: 850  NHLQLHRTLKGLP 862
             H QL   LKG+P
Sbjct: 1014 VHRQLKSVLKGVP 1026

>NDAI0A02590 Chr1 (576657..580133) [3477 bp, 1158 aa] {ON} Anc_7.234
          Length = 1158

 Score = 34.3 bits (77), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 69/153 (45%), Gaps = 26/153 (16%)

Query: 617  TYARSSDLGQFGKPTK---AVTFSVDCTFSKSKGLCLLKDSLKVELSVLHKSTRITYEAV 673
            +Y RS+ L QF        A+  +V    SK + + L +  L V  +  +    +    +
Sbjct: 939  SYKRSAKLAQFVMHRGLIIAICQAVYSICSKFEPIALYQGWLMVGYATCYTMAPVFSLTL 998

Query: 674  DELLDEPTTK--PK------SGKHEDLKTLF-YIAKALRRQRIVDGGAVVFENSSTGIVS 724
            D  +DE  TK  P+       GK    KT F ++A +  +  I+ G        S G  S
Sbjct: 999  DHDIDESLTKIYPELYKELTEGKSLSYKTFFVWVALSFFQGSIIQG-------CSQGFTS 1051

Query: 725  LSPDDNSELVEVSFKDQIETKSTILVSELMILA 757
            L  DD S++V +SF       + ++++EL+++A
Sbjct: 1052 LLTDDFSKMVAISF-------TALILNELIMVA 1077

>Skud_4.555 Chr4 complement(988201..991959) [3759 bp, 1252 aa] {ON}
            YDR293C (REAL)
          Length = 1252

 Score = 33.9 bits (76), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 69/333 (20%), Positives = 137/333 (41%), Gaps = 52/333 (15%)

Query: 555  AVSIKSLGGAKYRIYIHVADPASLFPEANEDGTTINSPVLDIAYQRAFTTYLPDKVFPML 614
            A+ +K+ G     +  H+ D  S      E+G++++      A +R+   ++P K+  +L
Sbjct: 715  ALHVKNNGDGTLELGCHIVDVTSHI----EEGSSVDR----RARKRSSAVFMPQKLVNLL 766

Query: 615  PTTYARSSDLGQFGK--PTKAVTFSVDCTFSKSKGLCLLKDSLKVELSVLHKSTRITYEA 672
            P ++     L   GK   T +V +++D +  + K    + +S+   LSVL          
Sbjct: 767  PQSFNDELSLAP-GKESATISVVYTLDSSTLRIK-TTWVGESIISPLSVLSL-------- 816

Query: 673  VDELLDEPTTKPKSGKHEDLKTLFYIAKALRRQRIVDGGAVVFENSSTGIVSLSPDDNSE 732
              E L+E  +   S  +  L ++  IA++   +RI D  A +        +SL    + E
Sbjct: 817  --EQLNEKLSIGNSDSY--LSSVQEIARSFYARRINDPEAKLLP-----TLSLLESSDDE 867

Query: 733  LVEVSFKDQIETKSTILVSELMILANSLTAS--YFEENQIPGIYRGYRPLNVVE------ 784
             V+V       T   ++++E+    N+  A   Y +   +  + R  +P+          
Sbjct: 868  KVKVDLNILDRTLGFVVINEIKRKVNATVAERIYTKLGDLALLRRQMQPIATKMASFRKK 927

Query: 785  --------DATSVPEWVKA--KTQENKIISKADIAKMKSFLTSSFYSSLPTPHDMLGTSH 834
                    D ++  E +KA  K +++ +    +I   K+   + ++ +     D  G   
Sbjct: 928  IQNFGYDFDVSTADELIKAVLKIKDDDVRVGIEILLFKTMPRARYFIAGKVDPDQYGHYA 987

Query: 835  -----YLTITSPLRRFPDLVNHLQLHRTLKGLP 862
                 Y   T+P+RR+ D V H QL   +  +P
Sbjct: 988  LNLPIYTHFTAPMRRYADHVVHRQLKSVIHDVP 1020

>KLLA0E12673g Chr5 complement(1126397..1127197) [801 bp, 266 aa]
           {ON} weakly similar to uniprot|Q06667 Saccharomyces
           cerevisiae YDR315C IPK1 Inositol 1 3 4 5 6-
           pentakisphosphate 2-kinase nuclear protein required for
           synthesis of 1 2 3 4 5 6-hexakisphosphate (phytate)
           which is integral to cell function has 2 motifs
           conserved in other fungi ipk1 gle1 double mutant is
           inviable
          Length = 266

 Score = 33.1 bits (74), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 3/63 (4%)

Query: 108 DEFMHLLRNDISSSTLFEETLKWLSKDNYKLRNNTYNGYDTQEIEFYF--DPSAIVSSTL 165
           D F  + R  ++ +  +E   KWL + +   RN T+N    ++IE+ F  DP  I+  TL
Sbjct: 108 DHFNQIYRCSLNDAITWEFKPKWLYQSSDYCRNCTHNSLKGRDIEYCFLHDPELII-ETL 166

Query: 166 MPG 168
             G
Sbjct: 167 FAG 169

>ZYRO0G16852g Chr7 complement(1381740..1385561) [3822 bp, 1273 aa]
            {ON} similar to uniprot|P24276 Saccharomyces cerevisiae
            YDR293C SSD1 Protein with a role in maintenance of
            cellular integrity interacts with components of the TOR
            pathway ssd1 mutant of a clinical S. cerevisiae strain
            displays elevated virulence
          Length = 1273

 Score = 32.3 bits (72), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 80/370 (21%), Positives = 151/370 (40%), Gaps = 51/370 (13%)

Query: 513  LEQKIYDLAVPPKIEHSAEIRTEYKDLICYCIDSPDAHEIDDAVSIKSLGGAKYRIYIHV 572
            LE+ ++  A+P   E  A  R  + + +    D P   +   A+ IK  G     +  HV
Sbjct: 701  LEKSVFQ-ALPIPQEELA-TRKRFTEQVVALADRPALSDF--AIHIKR-GPDTIELGCHV 755

Query: 573  ADPASLFPEANEDGTTINSPVLDIAYQRAFTTYLPDKVFPMLPTTYARSSDLGQFGK--P 630
             D  +      E+G++++      A +R+   ++P KV  +LP    +S  L + GK   
Sbjct: 756  VDATAHI----EEGSSLDR----RARKRSTAVFMPQKVVDLLPQALNKSLTL-EAGKTSA 806

Query: 631  TKAVTFSVDCTFSKSKGLCLLKDSLKVELSVLHKSTRITYEAVDELLDEPTTKPKSGKHE 690
            T +V +++D    K +       S  V  SV+  S  ++ E + + L+           E
Sbjct: 807  TLSVVYTLDARTLKLR-------STWVGESVVLPSAIMSTEDITDTLESNEPGGYISLLE 859

Query: 691  DLKTLFYIAKALRRQRIVDGGAVV------FENSSTGIVSLSPDDNSELVEVSFKDQIET 744
             L T FY      ++RI   GA +      F++     V++  +  +  +     D+I T
Sbjct: 860  QLATAFY------KERIRSPGARLLPTLPLFKSLDDEKVNVDLNILNRSIGAVVVDEIRT 913

Query: 745  KSTILVSELMILANSLTASYFEENQIPGIY-------RGYRPLNVVEDATSVPEWVKA-- 795
            K    V+E +     L    F   Q+P ++       +  + L    D T+    +++  
Sbjct: 914  KLDNTVAEKIY--TRLGGLAFLRRQVPPVHTKMASFKKRVQKLGYDLDITTPDSLIQSIL 971

Query: 796  KTQENKIISKADIAKMKSFLTSSFYSSLPTPHDMLGTSH-----YLTITSPLRRFPDLVN 850
            + + + + S  +I   K+   + ++ +     D  G        Y   ++PLRR+ D V 
Sbjct: 972  EIENDDVRSGVEILLFKTMSRARYFIAGKVDPDQYGNYALNLPLYTHFSAPLRRYADHVV 1031

Query: 851  HLQLHRTLKG 860
            H QL   ++G
Sbjct: 1032 HRQLKSVIRG 1041

>SAKL0G08228g Chr7 complement(700095..702248) [2154 bp, 717 aa] {ON}
           similar to uniprot|Q06683 Saccharomyces cerevisiae
           YDR332W Hypothetical ORF
          Length = 717

 Score = 32.0 bits (71), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 37/76 (48%), Gaps = 6/76 (7%)

Query: 401 YHNIIHKLRQHGGVRINRIAALINENDLA-----SLNKSFPYI-VPLLRDYAAGNLEHND 454
           + N+I +LR       +R   L++  +LA     +L K FP + V +      G+L   D
Sbjct: 89  FSNLIDQLRASAARPTHRTLILVHRRELALQAAATLKKFFPLLNVQIEMGKYRGDLVTAD 148

Query: 455 TITSLISSLFRKLDEY 470
            I + + SL R+LD Y
Sbjct: 149 VIIASVQSLVRRLDSY 164

>TBLA0A02870 Chr1 complement(688551..692492) [3942 bp, 1313 aa] {ON}
            Anc_5.307 YDR293C
          Length = 1313

 Score = 32.3 bits (72), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 67/323 (20%), Positives = 123/323 (38%), Gaps = 38/323 (11%)

Query: 555  AVSIKSLGGAKYRIYIHVADPASLFPEANEDGTTINSPVLDIAYQRAFTTYLPDKVFPML 614
            AV IK +         HV D  +   E        NS +   A +R+   ++P K+  +L
Sbjct: 775  AVHIKEIDNDIIEFGAHVIDATAHIEE--------NSSLDRRARKRSSAVFMPQKIVNLL 826

Query: 615  PTTYARSSDLGQFGKPTKAVTFSVDCTFSKSKGLCLLKDSLKVELSVLHKSTRITYEAVD 674
            P     S  L   GK  K+ T SV C  +K         S  +  +V++ +  ++   +D
Sbjct: 827  PKVLNDSLTLAP-GK--KSATLSVICLLNKE---TYEIKSTWIGETVINPTASLSISQID 880

Query: 675  ELLDEPTTKPKSGKHEDLKTLFYIAKALRRQRIVDGGAVVFENSSTGIVSLSPDDNSEL- 733
            E +    T     K   +  +  +A+    QR+ + GA + E+ S            +L 
Sbjct: 881  EAI----TNSDQQKTSFINDMHNVAQHFYSQRLENKGAKISESLSLLESLDDEKVRVDLN 936

Query: 734  -----VEVSFKDQIETKSTILVSELMILANSLTASYFEENQIP------GIYRGYRPLNV 782
                 V  +   ++E K+  +V+E  I +    +++      P       + R  +    
Sbjct: 937  IFDRYVGTAVVTELERKANCIVAE-KIYSKLGNSAFLRRQAQPIRSKMISLQRKIQKFGY 995

Query: 783  VEDATSVPEWVKA--KTQENKIISKADIAKMKSFLTSSFYSSLPTPHDMLGTSH-----Y 835
              D TS    +++     ++ +   A++   K+   + ++ +     D  G        +
Sbjct: 996  DLDITSADSLIRSILGIDDDDVRCGAELLFFKTMTRARYFIAGKVEPDQYGDYTLNLPLF 1055

Query: 836  LTITSPLRRFPDLVNHLQLHRTL 858
               TSPLRR+ D V H QL   L
Sbjct: 1056 THFTSPLRRYADHVVHRQLKSIL 1078

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 109,130,264
Number of extensions: 5088529
Number of successful extensions: 15325
Number of sequences better than 10.0: 72
Number of HSP's gapped: 15600
Number of HSP's successfully gapped: 77
Length of query: 983
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 864
Effective length of database: 39,836,145
Effective search space: 34418429280
Effective search space used: 34418429280
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 71 (32.0 bits)